F425567

General Info

Members Datasets Scaffolds Average Seq Length
370 193 740 108

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0875035|Ga0501070_0875035_156_506
Length 116
Sequence VTDDGSALAWTVLGDPSRRQIVSALADTPRAVGELADRLPISRPAVSQHLRVLKDAGVVIDEVHGTRRVYRVDPVALSALRDQLDTFWRRTLGGFADLAQSGAANSEPKTRTRRRP

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.57
Metatranscriptomes 2.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 5.14
Rhizosphere 92.43
Stem 0
Stem Tuber 0
Unclassified 2.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0875035 3300049586 Bacteria 702
2 Ga0070658_10578004 3300005327 Bacteria 973
3 Ga0070658_10779099 3300005327 Bacteria 831
4 Ga0070683_101122748 3300005329 Bacteria 755
5 Ga0070683_101778322 3300005329 Unclassified 592
6 Ga0068868_100193872 3300005338 Bacteria 1690
7 Ga0070660_101552509 3300005339 Bacteria 563
8 Ga0070675_100196461 3300005354 Bacteria 1750
9 Ga0070659_100499147 3300005366 Unclassified 1037
10 Ga0070667_100287445 3300005367 Bacteria 1478
11 Ga0070667_101683907 3300005367 Bacteria 596
12 Ga0070709_10035370 3300005434 Bacteria 3035
13 Ga0070709_11282289 3300005434 Unclassified 590
14 Ga0070714_100013283 3300005435 Bacteria 6596
15 Ga0070714_100102004 3300005435 Bacteria 2529
16 Ga0070714_100177739 3300005435 Bacteria 1935
17 Ga0070714_100731414 3300005435 Bacteria 956
18 Ga0070714_100892772 3300005435 Unclassified 863
19 Ga0070713_100042648 3300005436 Bacteria 3704
20 Ga0070713_100047644 3300005436 Bacteria 3524
21 Ga0070713_100426999 3300005436 Bacteria 1241
22 Ga0070713_100715363 3300005436 Bacteria 957
23 Ga0070710_10001781 3300005437 Bacteria 10191
24 Ga0070710_10368127 3300005437 Bacteria 956
25 Ga0070711_100009506 3300005439 Bacteria 5995
26 Ga0070663_102178247 3300005455 Unclassified 500
27 Ga0070678_101703310 3300005456 Bacteria 593
28 Ga0070681_10612947 3300005458 Bacteria 1003
29 Ga0070685_10484431 3300005466 Bacteria 872
30 Ga0070706_100135972 3300005467 Bacteria 2294
31 Ga0070706_101902739 3300005467 Bacteria 540
32 Ga0070707_100113485 3300005468 Bacteria 2629
33 Ga0070707_101298951 3300005468 Bacteria 694
34 Ga0070698_100334612 3300005471 Bacteria 1445
35 Ga0070698_101309589 3300005471 Bacteria 675
36 Ga0070679_100110267 3300005530 Bacteria 2738
37 Ga0070679_100696725 3300005530 Bacteria 958
38 Ga0070684_100131699 3300005535 Bacteria 2256
39 Ga0070684_100360246 3300005535 Bacteria 1338
40 Ga0070684_100761849 3300005535 Bacteria 904
41 Ga0070697_100541813 3300005536 Bacteria 1020
42 Ga0070704_100077614 3300005549 Bacteria 2434
43 Ga0068852_100632316 3300005616 Bacteria 1077
44 Ga0068852_100812032 3300005616 Bacteria 950
45 Ga0068852_102021579 3300005616 Bacteria 598
46 Ga0068863_100050968 3300005841 Bacteria 3923
47 Ga0068863_100263463 3300005841 Bacteria 1667
48 Ga0068863_101691938 3300005841 Bacteria 642
49 Ga0068860_100436515 3300005843 Bacteria 1300
50 Ga0081455_10374354 3300005937 Bacteria 997
51 Ga0081538_10064981 3300005981 Bacteria 2059
52 Ga0081540_1148871 3300005983 Bacteria 927
53 Ga0070717_10058691 3300006028 Bacteria 3182
54 Ga0070717_10335982 3300006028 Bacteria 1348
55 Ga0070717_11048818 3300006028 Bacteria 742
56 Ga0070717_11052825 3300006028 Bacteria 741
57 Ga0070715_10003949 3300006163 Bacteria 4799
58 Ga0070715_10948201 3300006163 Bacteria 533
59 Ga0070716_100001057 3300006173 Bacteria 12068
60 Ga0070716_100505323 3300006173 Bacteria 892
61 Ga0070712_100004578 3300006175 Bacteria 8538
62 Ga0070712_100512732 3300006175 Bacteria 1006
63 Ga0070712_101272381 3300006175 Bacteria 641
64 Ga0075367_10067719 3300006178 Bacteria 2141
65 Ga0075367_11105423 3300006178 Bacteria 507
66 Ga0068871_100151702 3300006358 Bacteria 1976
67 Ga0075431_100104296 3300006847 Bacteria 2926
68 Ga0075431_100461251 3300006847 Bacteria 1265
69 Ga0075429_100166408 3300006880 Bacteria 1931
70 Ga0111539_10581814 3300009094 Bacteria 1304
71 Ga0105245_10008695 3300009098 Bacteria 8853
72 Ga0105245_10948834 3300009098 Bacteria 903
73 Ga0114129_11244543 3300009147 Bacteria 925
74 Ga0114129_11771588 3300009147 Bacteria 752
75 Ga0105237_10646664 3300009545 Bacteria 1064
76 Ga0105238_10554066 3300009551 Bacteria 1154
77 Ga0105238_10570557 3300009551 Bacteria 1137
78 Ga0105239_10092540 3300010375 Bacteria 3338
79 Ga0105239_11780982 3300010375 Bacteria 713
80 Ga0157371_10890407 3300013102 Bacteria 674
81 Ga0157370_10244221 3300013104 Bacteria 1661
82 Ga0157370_10568893 3300013104 Bacteria 1039
83 Ga0157369_10075224 3300013105 Bacteria 3621
84 Ga0157369_10098059 3300013105 Bacteria 3126
85 Ga0157369_10226659 3300013105 Bacteria 1955
86 Ga0157369_11298160 3300013105 Unclassified 742
87 Ga0157378_10891899 3300013297 Bacteria 920
88 Ga0157372_10044627 3300013307 Bacteria 4913
89 Ga0157372_10838904 3300013307 Bacteria 1067
90 Ga0157372_11015537 3300013307 Bacteria 960
91 Ga0157372_11634731 3300013307 Bacteria 741
92 Ga0157380_10954468 3300014326 Bacteria 888
93 Ga0157377_10662566 3300014745 Bacteria 753
94 Ga0157376_10107767 3300014969 Bacteria 2446
95 Ga0197907_10253038 3300020069 Bacteria 551
96 Ga0197907_10398862 3300020069 Bacteria 2385
97 Ga0197907_11102948 3300020069 Bacteria 1714
98 Ga0206356_11517425 3300020070 Bacteria 1233
99 Ga0206354_11289006 3300020081 Bacteria 1465
100 Ga0206353_11610419 3300020082 Bacteria 1822
101 Ga0206353_11647773 3300020082 Bacteria 2444
102 Ga0207656_10176024 3300025321 Bacteria 1025
103 Ga0207692_10000973 3300025898 Bacteria 10421
104 Ga0207692_10251818 3300025898 Bacteria 1059
105 Ga0207647_10148433 3300025904 Bacteria 1371
106 Ga0207685_10012750 3300025905 Bacteria 2576
107 Ga0207685_10723235 3300025905 Bacteria 543
108 Ga0207699_10013891 3300025906 Bacteria 4135
109 Ga0207699_10019228 3300025906 Bacteria 3637
110 Ga0207684_11123700 3300025910 Bacteria 653
111 Ga0207695_10281965 3300025913 Bacteria 1555
112 Ga0207693_10013769 3300025915 Bacteria 6513
113 Ga0207693_10043937 3300025915 Bacteria 3512
114 Ga0207693_10321276 3300025915 Bacteria 1212
115 Ga0207693_10679501 3300025915 Bacteria 798
116 Ga0207663_10149841 3300025916 Bacteria 1635
117 Ga0207660_10336121 3300025917 Bacteria 1208
118 Ga0207657_10448804 3300025919 Unclassified 1012
119 Ga0207649_10476241 3300025920 Bacteria 946
120 Ga0207652_10587166 3300025921 Bacteria 1000
121 Ga0207652_11214789 3300025921 Bacteria 656
122 Ga0207646_10125513 3300025922 Bacteria 2307
123 Ga0207694_11192917 3300025924 Bacteria 644
124 Ga0207659_10258865 3300025926 Bacteria 1415
125 Ga0207687_10012307 3300025927 Bacteria 5595
126 Ga0207700_10000342 3300025928 Bacteria 27369
127 Ga0207700_10011560 3300025928 Bacteria 5636
128 Ga0207664_10004418 3300025929 Bacteria 9524
129 Ga0207664_10021032 3300025929 Bacteria 4843
130 Ga0207664_10032774 3300025929 Bacteria 3985
131 Ga0207664_10290095 3300025929 Unclassified 1438
132 Ga0207664_10373411 3300025929 Bacteria 1265
133 Ga0207664_11884140 3300025929 Bacteria 521
134 Ga0207644_10219680 3300025931 Bacteria 1506
135 Ga0207690_11240703 3300025932 Bacteria 623
136 Ga0207665_10015332 3300025939 Bacteria 5032
137 Ga0207661_10530318 3300025944 Bacteria 1077
138 Ga0207661_10569734 3300025944 Bacteria 1038
139 Ga0207679_10190378 3300025945 Bacteria 1705
140 Ga0207640_10236024 3300025981 Bacteria 1410
141 Ga0207677_10121269 3300026023 Bacteria 1967
142 Ga0207678_10144329 3300026067 Bacteria 2032
143 Ga0207678_11760857 3300026067 Bacteria 543
144 Ga0207702_10878630 3300026078 Bacteria 888
145 Ga0207702_11867418 3300026078 Unclassified 592
146 Ga0207641_10131078 3300026088 Bacteria 2251
147 Ga0207698_10340702 3300026142 Bacteria 1412
148 Ga0207698_10892851 3300026142 Bacteria 896
149 Ga0268264_10319867 3300028381 Bacteria 1467
150 Ga0265773_1008338 3300031018 Bacteria 829
151 Ga0307413_11611071 3300031824 Bacteria 577
152 Ga0307406_10538761 3300031901 Bacteria 953
153 Ga0307407_10046941 3300031903 Bacteria 2448
154 Ga0307409_100380283 3300031995 Bacteria 1342
155 Ga0307409_100849484 3300031995 Bacteria 924
156 Ga0307416_100253165 3300032002 Bacteria 1716
157 Ga0307416_101516538 3300032002 Bacteria 776
158 Ga0307411_10608178 3300032005 Bacteria 941
159 Ga0307415_101695376 3300032126 Bacteria 609
160 Ga0373926_0058662 3300035083 Bacteria 1400
161 Ga0373934_0000071 3300035086 Bacteria 35066
162 Ga0373934_0004319 3300035086 Bacteria 5248
163 Ga0373934_0120558 3300035086 Bacteria 1067
164 Ga0373951_0000186 3300035091 Bacteria 22467
165 Ga0373923_0448173 3300035111 Bacteria 625
166 Ga0373936_0510385 3300035113 Bacteria 559
167 Ga0373945_0115012 3300035116 Bacteria 1065
168 Ga0373953_0000043 3300035117 Bacteria 32688
169 Ga0373953_0016461 3300035117 Bacteria 2699
170 Ga0373953_0198516 3300035117 Bacteria 867
171 Ga0373954_0002700 3300035118 Bacteria 7466
172 Ga0373954_0066690 3300035118 Bacteria 1704
173 Ga0373954_0229469 3300035118 Bacteria 914
174 Ga0373954_0508725 3300035118 Bacteria 597
175 Ga0373956_0002704 3300035119 Bacteria 7177
176 Ga0373956_0037775 3300035119 Bacteria 2135
177 Ga0373956_0076669 3300035119 Bacteria 1530
178 Ga0373957_0000288 3300035120 Bacteria 12713
179 Ga0373943_0793179 3300035170 Bacteria 563
180 Ga0373946_0103600 3300035171 Bacteria 1279
181 Ga0373955_0000894 3300035172 Bacteria 12801
182 Ga0373955_0627641 3300035172 Bacteria 658
183 Ga0373955_0940499 3300035172 Unclassified 532
184 Ga0373942_0036448 3300035207 Bacteria 1325
185 Ga0373961_0129414 3300035241 Bacteria 844
186 Ga0373924_0000588 3300035410 Bacteria 11189
187 Ga0373924_0283066 3300035410 Bacteria 735
188 Ga0373924_0426148 3300035410 Bacteria 594
189 Ga0373931_0109320 3300035691 Bacteria 1566
190 Ga0373935_0691909 3300035692 Bacteria 749
191 Ga0373927_0209615 3300035695 Bacteria 1280
192 Ga0373933_0000283 3300035724 Bacteria 32966
193 Ga0373933_0040241 3300035724 Bacteria 2753
194 Ga0373937_0000560 3300036401 Bacteria 32978
195 Ga0373937_0026180 3300036401 Bacteria 5270
196 Ga0373937_0032658 3300036401 Bacteria 4722
197 Ga0373937_0301833 3300036401 Bacteria 1513
198 Ga0310109_045868 3300036534 Bacteria 566
199 Ga0373925_0203976 3300037068 Bacteria 1573
200 Ga0373925_0733565 3300037068 Bacteria 814
201 Ga0395898_0341985 3300037466 Bacteria 1427
202 Ga0395898_0489074 3300037466 Bacteria 1171
203 Ga0395898_0687186 3300037466 Bacteria 965
204 Ga0451849_0332783 3300041505 Bacteria 546
205 Ga0466969_0183655 3300044656 Bacteria 957
206 Ga0466969_0546037 3300044656 Bacteria 530
207 Ga0466965_0160800 3300044683 Bacteria 1178
208 Ga0466965_0198790 3300044683 Bacteria 1063
209 Ga0466965_0364656 3300044683 Bacteria 793
210 Ga0466965_0511066 3300044683 Bacteria 675
211 Ga0466965_0568763 3300044683 Bacteria 641
212 Ga0466965_0811167 3300044683 Bacteria 542
213 Ga0466966_0279891 3300044684 Bacteria 1003
214 Ga0466961_0070595 3300044693 Bacteria 2217
215 Ga0466961_0124643 3300044693 Bacteria 1617
216 Ga0466961_0138511 3300044693 Bacteria 1524
217 Ga0466963_0009293 3300044694 Bacteria 5921
218 Ga0466963_0050834 3300044694 Bacteria 2744
219 Ga0466963_0079189 3300044694 Bacteria 2223
220 Ga0466963_0086950 3300044694 Bacteria 2125
221 Ga0466963_0240988 3300044694 Bacteria 1268
222 Ga0466963_0280354 3300044694 Bacteria 1171
223 Ga0466963_0548711 3300044694 Bacteria 816
224 Ga0466963_0592759 3300044694 Bacteria 783
225 Ga0466964_0037149 3300044706 Bacteria 1955
226 Ga0466964_0195837 3300044706 Bacteria 967
227 Ga0466964_0225132 3300044706 Bacteria 913
228 Ga0466971_0028531 3300044719 Bacteria 2496
229 Ga0466971_0180094 3300044719 Bacteria 993
230 Ga0466971_0440954 3300044719 Bacteria 638
231 Ga0466971_0607816 3300044719 Bacteria 545
232 Ga0466970_0317141 3300044765 Bacteria 881
233 Ga0466970_0383419 3300044765 Bacteria 800
234 Ga0466970_0691244 3300044765 Bacteria 594
235 Ga0466957_0182676 3300044842 Bacteria 1370
236 Ga0466957_0226275 3300044842 Bacteria 1237
237 Ga0466957_0265012 3300044842 Bacteria 1146
238 Ga0466957_0362290 3300044842 Bacteria 985
239 Ga0466957_0961836 3300044842 Bacteria 612
240 Ga0466960_0145766 3300044901 Bacteria 1261
241 Ga0466960_0178560 3300044901 Bacteria 1149
242 Ga0466960_0502597 3300044901 Bacteria 710
243 Ga0466959_0214871 3300045049 Bacteria 1335
244 Ga0466959_0263096 3300045049 Bacteria 1187
245 Ga0466959_0445833 3300045049 Bacteria 878
246 Ga0466958_0150507 3300045836 Bacteria 1468
247 Ga0466958_0223227 3300045836 Bacteria 1202
248 Ga0466958_0362663 3300045836 Bacteria 933
249 Ga0466958_0530338 3300045836 Bacteria 764
250 Ga0466967_0063345 3300045976 Bacteria 3285
251 Ga0466967_0174788 3300045976 Bacteria 2023
252 Ga0466967_0265790 3300045976 Bacteria 1642
253 Ga0466967_0628219 3300045976 Bacteria 1061
254 Ga0466967_0681391 3300045976 Bacteria 1018
255 Ga0466967_0930942 3300045976 Bacteria 864
256 Ga0466967_1220260 3300045976 Bacteria 749
257 Ga0466967_1495519 3300045976 Bacteria 673
258 Ga0466967_2115745 3300045976 Bacteria 559
259 Ga0466967_2324598 3300045976 Bacteria 532
260 Ga0466967_2600967 3300045976 Bacteria 501
261 Ga0495592_0000403 3300046454 Bacteria 32941
262 Ga0495592_0711554 3300046454 Bacteria 603
263 Ga0495603_0076037 3300046455 Bacteria 1971
264 Ga0495629_0032816 3300046459 Bacteria 3675
265 Ga0495641_0020198 3300046461 Bacteria 3385
266 Ga0495641_0219845 3300046461 Bacteria 852
267 Ga0495641_0264749 3300046461 Bacteria 773
268 Ga0495651_0000499 3300046462 Bacteria 30439
269 Ga0495651_0000980 3300046462 Bacteria 22144
270 Ga0495651_0002467 3300046462 Bacteria 14301
271 Ga0495653_0003507 3300046463 Bacteria 12625
272 Ga0495653_0008300 3300046463 Bacteria 8513
273 Ga0495580_0205947 3300046472 Bacteria 1354
274 Ga0495582_0165186 3300046473 Bacteria 1259
275 Ga0495594_0043614 3300046499 Bacteria 2459
276 Ga0495608_0000310 3300046511 Bacteria 34155
277 Ga0495608_0005330 3300046511 Bacteria 9188
278 Ga0495618_0469791 3300046514 Bacteria 761
279 Ga0495628_0264681 3300046516 Bacteria 1280
280 Ga0495652_0003100 3300046529 Bacteria 16615
281 Ga0495652_0014345 3300046529 Bacteria 7113
282 Ga0495652_0092257 3300046529 Bacteria 2474
283 Ga0495652_0234166 3300046529 Bacteria 1371
284 Ga0495665_0176304 3300046531 Bacteria 1111
285 Ga0495640_0064135 3300046533 Bacteria 2485
286 Ga0495586_0234617 3300046535 Bacteria 1045
287 Ga0495587_0000348 3300046536 Bacteria 32978
288 Ga0495587_0014129 3300046536 Bacteria 5013
289 Ga0495587_0321151 3300046536 Bacteria 865
290 Ga0495645_0011509 3300046543 Bacteria 6227
291 Ga0495667_0001303 3300046559 Bacteria 16358
292 Ga0495667_0020725 3300046559 Bacteria 4436
293 Ga0495635_0028976 3300046663 Bacteria 3849
294 Ga0495635_0263763 3300046663 Bacteria 1159
295 Ga0495657_0002234 3300046675 Bacteria 16398
296 Ga0495657_0094892 3300046675 Bacteria 1907
297 Ga0495599_0000267 3300046678 Bacteria 32878
298 Ga0495599_0017629 3300046678 Bacteria 4440
299 Ga0495623_0014630 3300046679 Bacteria 5075
300 Ga0495623_0017679 3300046679 Bacteria 4605
301 Ga0495623_0023127 3300046679 Bacteria 4011
302 Ga0495646_0050115 3300046680 Bacteria 2532
303 Ga0495646_0113752 3300046680 Bacteria 1538
304 Ga0495646_0155356 3300046680 Bacteria 1270
305 Ga0495658_0206290 3300046683 Bacteria 1226
306 Ga0495613_0119589 3300046689 Bacteria 1892
307 Ga0495624_0508432 3300046690 Bacteria 720
308 Ga0495600_0001964 3300046809 Bacteria 11555
309 Ga0495600_0014845 3300046809 Bacteria 4913
310 Ga0495600_0034902 3300046809 Bacteria 3265
311 Ga0495581_0229617 3300047315 Bacteria 1085
312 Ga0495604_0000550 3300047317 Bacteria 32980
313 Ga0495604_0011923 3300047317 Bacteria 6913
314 Ga0495604_0212375 3300047317 Bacteria 1336
315 Ga0495604_0532825 3300047317 Bacteria 759
316 Ga0495674_0016637 3300047319 Bacteria 6862
317 Ga0495674_0203321 3300047319 Bacteria 1642
318 Ga0495680_0000904 3300047322 Bacteria 32976
319 Ga0495680_0012942 3300047322 Bacteria 7309
320 Ga0495680_0071196 3300047322 Bacteria 2648
321 Ga0495680_1036803 3300047322 Bacteria 522
322 Ga0495675_0001504 3300047444 Bacteria 14113
323 Ga0495675_0063548 3300047444 Bacteria 2335
324 Ga0495684_0009000 3300047471 Bacteria 7709
325 Ga0495684_0819509 3300047471 Bacteria 606
326 Ga0495593_0562168 3300047673 Bacteria 572
327 Ga0495602_0000631 3300048088 Bacteria 32978
328 Ga0495602_0018569 3300048088 Bacteria 6937
329 Ga0495602_0128407 3300048088 Bacteria 2026
330 Ga0495602_0150034 3300048088 Bacteria 1834
331 Ga0495614_0404611 3300048089 Bacteria 642
332 Ga0496102_0258236 3300048905 Bacteria 1643
333 Ga0496102_0268026 3300048905 Bacteria 1610
334 Ga0496104_0116780 3300048907 Bacteria 2560
335 Ga0496104_0298497 3300048907 Bacteria 1523
336 Ga0496104_1000309 3300048907 Bacteria 740
337 Ga0496105_0021261 3300048908 Bacteria 5251
338 Ga0496105_0930459 3300048908 Bacteria 654
339 Ga0496106_0012931 3300048909 Bacteria 6160
340 Ga0496108_1793514 3300048911 Bacteria 502
341 Ga0496109_2024537 3300048912 Bacteria 508
342 Ga0496111_0074195 3300048914 Bacteria 2478
343 Ga0496111_0277754 3300048914 Bacteria 1242
344 Ga0496111_0401430 3300048914 Bacteria 1013
345 Ga0496112_0015899 3300048915 Bacteria 7033
346 Ga0496112_0085297 3300048915 Bacteria 3124
347 Ga0496112_0544398 3300048915 Bacteria 1095
348 Ga0496113_0054801 3300048916 Bacteria 2986
349 Ga0496115_0033980 3300048918 Bacteria 4030
350 Ga0496115_0866264 3300048918 Bacteria 699
351 Ga0501048_0709874 3300049582 Bacteria 722
352 Ga0501071_0449695 3300049587 Bacteria 986
353 nmdc:mga00v17_27990_c1 3300050491 Bacteria 3296
354 nmdc:mga06z11_49138_c1 3300050494 Bacteria 2150
355 nmdc:mga0qj67_646386_c1 3300050509 Bacteria 844
356 nmdc:mga08y16_1219720_c1 3300050511 Bacteria 722
357 Ga0495601_0244693 3300053077 Bacteria 1171
358 Ga0495601_0275927 3300053077 Bacteria 1096
359 Ga0495601_0938202 3300053077 Bacteria 546
360 Ga0495595_0002112 3300053084 Bacteria 7715
361 Ga0495595_0127088 3300053084 Bacteria 1244
362 Ga0495619_0097318 3300053085 Bacteria 1999
363 Ga0495619_0150171 3300053085 Bacteria 1607
364 Ga0500572_034316 3300053111 Bacteria 1437
365 Ga0500559_0027730 3300053136 Bacteria 2417
366 Ga0500630_192843 3300053159 Bacteria 804
367 Ga0466962_0079399 3300061719 Bacteria 1568
368 Ga0466962_0108878 3300061719 Bacteria 1333
369 Ga0466962_0227991 3300061719 Bacteria 913
370 Ga0466962_0447820 3300061719 Bacteria 650
371 Ga0501070_0875035
372 Ga0070658_10578004
373 Ga0070658_10779099
374 Ga0070683_101122748
375 Ga0070683_101778322
376 Ga0068868_100193872
377 Ga0070660_101552509
378 Ga0070675_100196461
379 Ga0070659_100499147
380 Ga0070667_100287445
381 Ga0070667_101683907
382 Ga0070709_10035370
383 Ga0070709_11282289
384 Ga0070714_100013283
385 Ga0070714_100102004
386 Ga0070714_100177739
387 Ga0070714_100731414
388 Ga0070714_100892772
389 Ga0070713_100042648
390 Ga0070713_100047644
391 Ga0070713_100426999
392 Ga0070713_100715363
393 Ga0070710_10001781
394 Ga0070710_10368127
395 Ga0070711_100009506
396 Ga0070663_102178247
397 Ga0070678_101703310
398 Ga0070681_10612947
399 Ga0070685_10484431
400 Ga0070706_100135972
401 Ga0070706_101902739
402 Ga0070707_100113485
403 Ga0070707_101298951
404 Ga0070698_100334612
405 Ga0070698_101309589
406 Ga0070679_100110267
407 Ga0070679_100696725
408 Ga0070684_100131699
409 Ga0070684_100360246
410 Ga0070684_100761849
411 Ga0070697_100541813
412 Ga0070704_100077614
413 Ga0068852_100632316
414 Ga0068852_100812032
415 Ga0068852_102021579
416 Ga0068863_100050968
417 Ga0068863_100263463
418 Ga0068863_101691938
419 Ga0068860_100436515
420 Ga0081455_10374354
421 Ga0081538_10064981
422 Ga0081540_1148871
423 Ga0070717_10058691
424 Ga0070717_10335982
425 Ga0070717_11048818
426 Ga0070717_11052825
427 Ga0070715_10003949
428 Ga0070715_10948201
429 Ga0070716_100001057
430 Ga0070716_100505323
431 Ga0070712_100004578
432 Ga0070712_100512732
433 Ga0070712_101272381
434 Ga0075367_10067719
435 Ga0075367_11105423
436 Ga0068871_100151702
437 Ga0075431_100104296
438 Ga0075431_100461251
439 Ga0075429_100166408
440 Ga0111539_10581814
441 Ga0105245_10008695
442 Ga0105245_10948834
443 Ga0114129_11244543
444 Ga0114129_11771588
445 Ga0105237_10646664
446 Ga0105238_10554066
447 Ga0105238_10570557
448 Ga0105239_10092540
449 Ga0105239_11780982
450 Ga0157371_10890407
451 Ga0157370_10244221
452 Ga0157370_10568893
453 Ga0157369_10075224
454 Ga0157369_10098059
455 Ga0157369_10226659
456 Ga0157369_11298160
457 Ga0157378_10891899
458 Ga0157372_10044627
459 Ga0157372_10838904
460 Ga0157372_11015537
461 Ga0157372_11634731
462 Ga0157380_10954468
463 Ga0157377_10662566
464 Ga0157376_10107767
465 Ga0197907_10253038
466 Ga0197907_10398862
467 Ga0197907_11102948
468 Ga0206356_11517425
469 Ga0206354_11289006
470 Ga0206353_11610419
471 Ga0206353_11647773
472 Ga0207656_10176024
473 Ga0207692_10000973
474 Ga0207692_10251818
475 Ga0207647_10148433
476 Ga0207685_10012750
477 Ga0207685_10723235
478 Ga0207699_10013891
479 Ga0207699_10019228
480 Ga0207684_11123700
481 Ga0207695_10281965
482 Ga0207693_10013769
483 Ga0207693_10043937
484 Ga0207693_10321276
485 Ga0207693_10679501
486 Ga0207663_10149841
487 Ga0207660_10336121
488 Ga0207657_10448804
489 Ga0207649_10476241
490 Ga0207652_10587166
491 Ga0207652_11214789
492 Ga0207646_10125513
493 Ga0207694_11192917
494 Ga0207659_10258865
495 Ga0207687_10012307
496 Ga0207700_10000342
497 Ga0207700_10011560
498 Ga0207664_10004418
499 Ga0207664_10021032
500 Ga0207664_10032774
501 Ga0207664_10290095
502 Ga0207664_10373411
503 Ga0207664_11884140
504 Ga0207644_10219680
505 Ga0207690_11240703
506 Ga0207665_10015332
507 Ga0207661_10530318
508 Ga0207661_10569734
509 Ga0207679_10190378
510 Ga0207640_10236024
511 Ga0207677_10121269
512 Ga0207678_10144329
513 Ga0207678_11760857
514 Ga0207702_10878630
515 Ga0207702_11867418
516 Ga0207641_10131078
517 Ga0207698_10340702
518 Ga0207698_10892851
519 Ga0268264_10319867
520 Ga0265773_1008338
521 Ga0307413_11611071
522 Ga0307406_10538761
523 Ga0307407_10046941
524 Ga0307409_100380283
525 Ga0307409_100849484
526 Ga0307416_100253165
527 Ga0307416_101516538
528 Ga0307411_10608178
529 Ga0307415_101695376
530 Ga0373926_0058662
531 Ga0373934_0000071
532 Ga0373934_0004319
533 Ga0373934_0120558
534 Ga0373951_0000186
535 Ga0373923_0448173
536 Ga0373936_0510385
537 Ga0373945_0115012
538 Ga0373953_0000043
539 Ga0373953_0016461
540 Ga0373953_0198516
541 Ga0373954_0002700
542 Ga0373954_0066690
543 Ga0373954_0229469
544 Ga0373954_0508725
545 Ga0373956_0002704
546 Ga0373956_0037775
547 Ga0373956_0076669
548 Ga0373957_0000288
549 Ga0373943_0793179
550 Ga0373946_0103600
551 Ga0373955_0000894
552 Ga0373955_0627641
553 Ga0373955_0940499
554 Ga0373942_0036448
555 Ga0373961_0129414
556 Ga0373924_0000588
557 Ga0373924_0283066
558 Ga0373924_0426148
559 Ga0373931_0109320
560 Ga0373935_0691909
561 Ga0373927_0209615
562 Ga0373933_0000283
563 Ga0373933_0040241
564 Ga0373937_0000560
565 Ga0373937_0026180
566 Ga0373937_0032658
567 Ga0373937_0301833
568 Ga0310109_045868
569 Ga0373925_0203976
570 Ga0373925_0733565
571 Ga0395898_0341985
572 Ga0395898_0489074
573 Ga0395898_0687186
574 Ga0451849_0332783
575 Ga0466969_0183655
576 Ga0466969_0546037
577 Ga0466965_0160800
578 Ga0466965_0198790
579 Ga0466965_0364656
580 Ga0466965_0511066
581 Ga0466965_0568763
582 Ga0466965_0811167
583 Ga0466966_0279891
584 Ga0466961_0070595
585 Ga0466961_0124643
586 Ga0466961_0138511
587 Ga0466963_0009293
588 Ga0466963_0050834
589 Ga0466963_0079189
590 Ga0466963_0086950
591 Ga0466963_0240988
592 Ga0466963_0280354
593 Ga0466963_0548711
594 Ga0466963_0592759
595 Ga0466964_0037149
596 Ga0466964_0195837
597 Ga0466964_0225132
598 Ga0466971_0028531
599 Ga0466971_0180094
600 Ga0466971_0440954
601 Ga0466971_0607816
602 Ga0466970_0317141
603 Ga0466970_0383419
604 Ga0466970_0691244
605 Ga0466957_0182676
606 Ga0466957_0226275
607 Ga0466957_0265012
608 Ga0466957_0362290
609 Ga0466957_0961836
610 Ga0466960_0145766
611 Ga0466960_0178560
612 Ga0466960_0502597
613 Ga0466959_0214871
614 Ga0466959_0263096
615 Ga0466959_0445833
616 Ga0466958_0150507
617 Ga0466958_0223227
618 Ga0466958_0362663
619 Ga0466958_0530338
620 Ga0466967_0063345
621 Ga0466967_0174788
622 Ga0466967_0265790
623 Ga0466967_0628219
624 Ga0466967_0681391
625 Ga0466967_0930942
626 Ga0466967_1220260
627 Ga0466967_1495519
628 Ga0466967_2115745
629 Ga0466967_2324598
630 Ga0466967_2600967
631 Ga0495592_0000403
632 Ga0495592_0711554
633 Ga0495603_0076037
634 Ga0495629_0032816
635 Ga0495641_0020198
636 Ga0495641_0219845
637 Ga0495641_0264749
638 Ga0495651_0000499
639 Ga0495651_0000980
640 Ga0495651_0002467
641 Ga0495653_0003507
642 Ga0495653_0008300
643 Ga0495580_0205947
644 Ga0495582_0165186
645 Ga0495594_0043614
646 Ga0495608_0000310
647 Ga0495608_0005330
648 Ga0495618_0469791
649 Ga0495628_0264681
650 Ga0495652_0003100
651 Ga0495652_0014345
652 Ga0495652_0092257
653 Ga0495652_0234166
654 Ga0495665_0176304
655 Ga0495640_0064135
656 Ga0495586_0234617
657 Ga0495587_0000348
658 Ga0495587_0014129
659 Ga0495587_0321151
660 Ga0495645_0011509
661 Ga0495667_0001303
662 Ga0495667_0020725
663 Ga0495635_0028976
664 Ga0495635_0263763
665 Ga0495657_0002234
666 Ga0495657_0094892
667 Ga0495599_0000267
668 Ga0495599_0017629
669 Ga0495623_0014630
670 Ga0495623_0017679
671 Ga0495623_0023127
672 Ga0495646_0050115
673 Ga0495646_0113752
674 Ga0495646_0155356
675 Ga0495658_0206290
676 Ga0495613_0119589
677 Ga0495624_0508432
678 Ga0495600_0001964
679 Ga0495600_0014845
680 Ga0495600_0034902
681 Ga0495581_0229617
682 Ga0495604_0000550
683 Ga0495604_0011923
684 Ga0495604_0212375
685 Ga0495604_0532825
686 Ga0495674_0016637
687 Ga0495674_0203321
688 Ga0495680_0000904
689 Ga0495680_0012942
690 Ga0495680_0071196
691 Ga0495680_1036803
692 Ga0495675_0001504
693 Ga0495675_0063548
694 Ga0495684_0009000
695 Ga0495684_0819509
696 Ga0495593_0562168
697 Ga0495602_0000631
698 Ga0495602_0018569
699 Ga0495602_0128407
700 Ga0495602_0150034
701 Ga0495614_0404611
702 Ga0496102_0258236
703 Ga0496102_0268026
704 Ga0496104_0116780
705 Ga0496104_0298497
706 Ga0496104_1000309
707 Ga0496105_0021261
708 Ga0496105_0930459
709 Ga0496106_0012931
710 Ga0496108_1793514
711 Ga0496109_2024537
712 Ga0496111_0074195
713 Ga0496111_0277754
714 Ga0496111_0401430
715 Ga0496112_0015899
716 Ga0496112_0085297
717 Ga0496112_0544398
718 Ga0496113_0054801
719 Ga0496115_0033980
720 Ga0496115_0866264
721 Ga0501048_0709874
722 Ga0501071_0449695
723 nmdc:mga00v17_27990_c1
724 nmdc:mga06z11_49138_c1
725 nmdc:mga0qj67_646386_c1
726 nmdc:mga08y16_1219720_c1
727 Ga0495601_0244693
728 Ga0495601_0275927
729 Ga0495601_0938202
730 Ga0495595_0002112
731 Ga0495595_0127088
732 Ga0495619_0097318
733 Ga0495619_0150171
734 Ga0500572_034316
735 Ga0500559_0027730
736 Ga0500630_192843
737 Ga0466962_0079399
738 Ga0466962_0108878
739 Ga0466962_0227991
740 Ga0466962_0447820

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

15

61

0.98

PF12840

HTH_20

Helix-turn-helix domain

13

62

0.97

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

15

60

0.92

PF12802

MarR_2

MarR family

15

68

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9499 10 81
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9474 18 73
2quf-assembly1.cif.gz_A crystal structure of transcription factor axxa-pf0095 from pyrococcus furiosus 0.9433 10 73
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9375 18 72
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9324 31 73
ID Description Score Start End Superfamily
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9793 17 72 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9619 13 77 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9594 15 71 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9474 18 73 1.10.10.10
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.94 18 73 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0H5CYU2-F1-model_v4 Transcriptional regulator, ArsR family 0.988 7 88 GO:0003700
AF-A0A1C6S2G9-F1-model_v4 Transcriptional regulator, ArsR family 0.9867 3 96 GO:0003700
AF-A0A7X5UP31-F1-model_v4 DNA-binding transcriptional ArsR family regulator 0.985 3 103 GO:0003677
GO:0003700
AF-A0A1C6B492-F1-model_v4 HTH-type transcriptional repressor AseR 0.9805 5 87 GO:0003700
AF-A0A0N9N295-F1-model_v4 ArsR family transcriptional regulator 0.9789 1 109 GO:0003700

Map