F425348

General Info

Members Datasets Scaffolds Average Seq Length
370 223 370 319

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100254269|Ga0075430_1002542692
Length 366
Sequence MNFRLGSPISNKEAKQVTEIFWHPFFASQSDNLKFKIENLKWPGFSVIAFVIVAACGAIAQAQQTGKVRRIGYLFNTTPSVAALRVEAFRQGLRELGYAEGKNIVIESRYSEGKPDRLHVLVAELVRLKVKVIVASGPIVTRAAKEATKTIPIVFAQEGDPVARGFVASLARPGGNITGLSTFGPELSGKRLELLKEIVPRLSRVAILGTSTIEDHARFLEEHEPAARALRLQLQYLDVLSSKDIETAFRAASNGRADAVLVLAGPVLTLHRKQVVDLAFKSRLPAIYNFPEFVDAGGLMTYGVSQSDLSRRAATYVDKILKGANPGDLPVEQPAKFELVINLKAAKQIGVKIPANVLARADRVIK

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 12.97
Rhizosphere 86.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10037125 3300001990 Bacteria 1502
2 JGI24743J22301_10004315 3300001991 Bacteria 2311
3 JGI24750J21931_1001313 3300002070 Bacteria 3129
4 JGI24748J21848_1002510 3300002074 Bacteria 2073
5 JGI24738J21930_10001099 3300002075 Bacteria 7649
6 JGI24034J26672_10003585 3300002239 Bacteria 2169
7 JGI24742J22300_10004910 3300002244 Bacteria 2194
8 JGI24742J22300_10006057 3300002244 Bacteria 1994
9 JGI24751J29686_10006214 3300002459 Bacteria 2433
10 Ga0070676_10023626 3300005328 Bacteria 3456
11 Ga0070683_100096789 3300005329 Bacteria 2776
12 Ga0070690_100036758 3300005330 Unclassified 3081
13 Ga0070690_100064609 3300005330 Bacteria 2365
14 Ga0068869_100014560 3300005334 Bacteria 5257
15 Ga0068869_100133262 3300005334 Bacteria 1912
16 Ga0070682_100015752 3300005337 Bacteria 4386
17 Ga0068868_100014314 3300005338 Bacteria 5844
18 Ga0070660_100039512 3300005339 Bacteria 3587
19 Ga0070689_100007296 3300005340 Bacteria 7712
20 Ga0070691_10030217 3300005341 Bacteria 2537
21 Ga0070687_100032793 3300005343 Bacteria 2558
22 Ga0070692_10046697 3300005345 Bacteria 2239
23 Ga0070668_100044706 3300005347 Bacteria 3397
24 Ga0070669_100038349 3300005353 Bacteria 3478
25 Ga0070671_100034720 3300005355 Bacteria 4175
26 Ga0070671_100206940 3300005355 Bacteria 1664
27 Ga0070674_100050565 3300005356 Bacteria 2861
28 Ga0070673_100220744 3300005364 Bacteria 1640
29 Ga0070688_100157084 3300005365 Bacteria 1559
30 Ga0070659_100051207 3300005366 Bacteria 3246
31 Ga0070709_10007589 3300005434 Bacteria 5955
32 Ga0070709_10094388 3300005434 Unclassified 1979
33 Ga0070714_100221397 3300005435 Unclassified 1739
34 Ga0070714_100444720 3300005435 Bacteria 1230
35 Ga0070713_100025840 3300005436 Bacteria 4599
36 Ga0070713_100063568 3300005436 Bacteria 3095
37 Ga0070713_100091561 3300005436 Bacteria 2616
38 Ga0070713_100204576 3300005436 Bacteria 1784
39 Ga0070713_100207172 3300005436 Unclassified 1774
40 Ga0070710_10011391 3300005437 Bacteria 4393
41 Ga0070701_10012773 3300005438 Bacteria 3796
42 Ga0070711_100076242 3300005439 Bacteria 2377
43 Ga0070711_100268028 3300005439 Bacteria 1346
44 Ga0070705_100070778 3300005440 Bacteria 2107
45 Ga0070705_100389837 3300005440 Bacteria 1028
46 Ga0070694_100069700 3300005444 Bacteria 2419
47 Ga0070708_100052348 3300005445 Unclassified 3620
48 Ga0070708_100104285 3300005445 Bacteria 2600
49 Ga0070708_100114769 3300005445 Bacteria 2478
50 Ga0070708_100157041 3300005445 Bacteria 2118
51 Ga0070708_100202536 3300005445 Bacteria 1858
52 Ga0070663_100038247 3300005455 Bacteria 3346
53 Ga0070678_100009641 3300005456 Bacteria 5863
54 Ga0068867_100016764 3300005459 Bacteria 5205
55 Ga0068867_100304954 3300005459 Bacteria 1314
56 Ga0070685_10033475 3300005466 Bacteria 2888
57 Ga0070706_100026236 3300005467 Bacteria 5362
58 Ga0070706_100220475 3300005467 Unclassified 1770
59 Ga0070706_100316597 3300005467 Bacteria 1455
60 Ga0070706_100362355 3300005467 Bacteria 1351
61 Ga0070707_100011016 3300005468 Bacteria 8421
62 Ga0070707_100014065 3300005468 Bacteria 7498
63 Ga0070707_100146751 3300005468 Bacteria 2296
64 Ga0070707_100222156 3300005468 Bacteria 1839
65 Ga0070698_100182682 3300005471 Bacteria 2035
66 Ga0070698_100288706 3300005471 Bacteria 1571
67 Ga0070698_100372309 3300005471 Bacteria 1361
68 Ga0070698_100381323 3300005471 Bacteria 1342
69 Ga0070698_100383349 3300005471 Bacteria 1338
70 Ga0070699_100004994 3300005518 Bacteria 11692
71 Ga0070699_100007576 3300005518 Bacteria 9439
72 Ga0070699_100030389 3300005518 Bacteria 4663
73 Ga0070699_100116695 3300005518 Unclassified 2346
74 Ga0070684_100191644 3300005535 Bacteria 1860
75 Ga0070697_100052048 3300005536 Bacteria 3328
76 Ga0070697_100127476 3300005536 Unclassified 2132
77 Ga0070697_100327850 3300005536 Bacteria 1319
78 Ga0070672_100204369 3300005543 Bacteria 1652
79 Ga0070686_100029022 3300005544 Bacteria 3360
80 Ga0070686_100100272 3300005544 Bacteria 1955
81 Ga0070695_100122846 3300005545 Bacteria 1779
82 Ga0070696_100089445 3300005546 Bacteria 2189
83 Ga0070696_100112123 3300005546 Bacteria 1965
84 Ga0070696_100117602 3300005546 Bacteria 1921
85 Ga0070696_100145158 3300005546 Bacteria 1737
86 Ga0070696_100190511 3300005546 Bacteria 1526
87 Ga0070704_100095878 3300005549 Bacteria 2223
88 Ga0068855_100247378 3300005563 Bacteria 1990
89 Ga0070664_100088585 3300005564 Bacteria 2676
90 Ga0068854_100015869 3300005578 Bacteria 5005
91 Ga0068856_100286676 3300005614 Bacteria 1664
92 Ga0070702_100042572 3300005615 Bacteria 2554
93 Ga0068852_100110771 3300005616 Bacteria 2495
94 Ga0068852_100155817 3300005616 Bacteria 2128
95 Ga0068859_100033231 3300005617 Bacteria 5180
96 Ga0068859_100103905 3300005617 Bacteria 2899
97 Ga0068866_10031333 3300005718 Bacteria 2560
98 Ga0068851_10015712 3300005834 Bacteria 3611
99 Ga0068870_10010724 3300005840 Bacteria 4219
100 Ga0068863_100113473 3300005841 Bacteria 2581
101 Ga0068858_100211940 3300005842 Bacteria 1833
102 Ga0068860_100023203 3300005843 Bacteria 5997
103 Ga0068860_100122093 3300005843 Bacteria 2495
104 Ga0068862_100052161 3300005844 Bacteria 3498
105 Ga0068862_100052276 3300005844 Unclassified 3495
106 Ga0081455_10023483 3300005937 Bacteria 5736
107 Ga0081455_10056352 3300005937 Bacteria 3338
108 Ga0070717_10050126 3300006028 Bacteria 3429
109 Ga0070717_10171932 3300006028 Bacteria 1885
110 Ga0070717_10338340 3300006028 Bacteria 1343
111 Ga0070717_10363749 3300006028 Bacteria 1295
112 Ga0075365_10032293 3300006038 Bacteria 3364
113 Ga0070715_10008158 3300006163 Bacteria 3640
114 Ga0070715_10009587 3300006163 Bacteria 3418
115 Ga0070715_10009594 3300006163 Bacteria 3417
116 Ga0070715_10017046 3300006163 Bacteria 2743
117 Ga0070716_100184632 3300006173 Bacteria 1372
118 Ga0070712_100042294 3300006175 Bacteria 3133
119 Ga0097621_100024745 3300006237 Bacteria 4692
120 Ga0097621_100123453 3300006237 Bacteria 2198
121 Ga0075428_100052060 3300006844 Bacteria 4489
122 Ga0075428_100088981 3300006844 Bacteria 3368
123 Ga0075428_100467857 3300006844 Bacteria 1350
124 Ga0075430_100254269 3300006846 Bacteria 1456
125 Ga0075431_100558246 3300006847 Unclassified 1132
126 Ga0075433_10279063 3300006852 Bacteria 1480
127 Ga0075433_10316640 3300006852 Bacteria 1381
128 Ga0075434_100097354 3300006871 Bacteria 2947
129 Ga0075434_100403753 3300006871 Bacteria 1387
130 Ga0075434_100435861 3300006871 Bacteria 1332
131 Ga0075434_100449645 3300006871 Unclassified 1309
132 Ga0068865_100015904 3300006881 Bacteria 4805
133 Ga0097620_100033233 3300006931 Bacteria 5180
134 Ga0097620_100103904 3300006931 Bacteria 2899
135 Ga0075435_100263180 3300007076 Bacteria 1470
136 Ga0111539_10325343 3300009094 Bacteria 1789
137 Ga0111539_10473689 3300009094 Bacteria 1458
138 Ga0111539_10539370 3300009094 Bacteria 1359
139 Ga0111539_10593611 3300009094 Unclassified 1290
140 Ga0105247_10007699 3300009101 Bacteria 6590
141 Ga0114129_10025350 3300009147 Bacteria 8402
142 Ga0114129_10076776 3300009147 Bacteria 4650
143 Ga0114129_10107293 3300009147 Bacteria 3857
144 Ga0114129_10134594 3300009147 Bacteria 3392
145 Ga0114129_10189062 3300009147 Bacteria 2797
146 Ga0114129_10221548 3300009147 Bacteria 2552
147 Ga0114129_10602054 3300009147 Bacteria 1424
148 Ga0114129_10873234 3300009147 Unclassified 1142
149 Ga0105243_10054611 3300009148 Bacteria 3172
150 Ga0105241_10030889 3300009174 Bacteria 4007
151 Ga0105248_10038309 3300009177 Bacteria 5365
152 Ga0105248_10094786 3300009177 Bacteria 3361
153 Ga0105248_10096674 3300009177 Bacteria 3327
154 Ga0105249_10028938 3300009553 Bacteria 5001
155 Ga0105249_10061008 3300009553 Bacteria 3460
156 Ga0105249_10157623 3300009553 Bacteria 2191
157 Ga0105249_10275728 3300009553 Bacteria 1677
158 Ga0105249_10456263 3300009553 Bacteria 1317
159 Ga0105239_10003524 3300010375 Bacteria 19165
160 Ga0105239_10742330 3300010375 Bacteria 1123
161 Ga0105246_10015439 3300011119 Bacteria 4826
162 Ga0157374_10018790 3300013296 Bacteria 6109
163 Ga0157378_10012681 3300013297 Bacteria 7374
164 Ga0163162_10042757 3300013306 Bacteria 4536
165 Ga0163162_10303773 3300013306 Bacteria 1728
166 Ga0163162_10403237 3300013306 Unclassified 1500
167 Ga0163162_10798340 3300013306 Bacteria 1061
168 Ga0157375_10225251 3300013308 Bacteria 2034
169 Ga0157375_10315316 3300013308 Bacteria 1728
170 Ga0163163_10119803 3300014325 Bacteria 2665
171 Ga0157377_10025774 3300014745 Bacteria 3139
172 Ga0157379_10042542 3300014968 Bacteria 4056
173 Ga0163161_10060388 3300017792 Bacteria 2759
174 Ga0163161_10346771 3300017792 Bacteria 1179
175 Ga0207697_10074850 3300025315 Bacteria 1422
176 Ga0207656_10064509 3300025321 Bacteria 1614
177 Ga0207692_10029038 3300025898 Unclassified 2623
178 Ga0207692_10072893 3300025898 Bacteria 1815
179 Ga0207710_10006142 3300025900 Bacteria 5141
180 Ga0207688_10004653 3300025901 Bacteria 7476
181 Ga0207685_10023103 3300025905 Unclassified 2112
182 Ga0207685_10023260 3300025905 Bacteria 2107
183 Ga0207699_10006070 3300025906 Bacteria 5819
184 Ga0207699_10131144 3300025906 Unclassified 1635
185 Ga0207645_10065511 3300025907 Bacteria 2322
186 Ga0207643_10011076 3300025908 Bacteria 4868
187 Ga0207684_10018827 3300025910 Bacteria 5906
188 Ga0207684_10084321 3300025910 Unclassified 2706
189 Ga0207684_10162891 3300025910 Bacteria 1921
190 Ga0207654_10175165 3300025911 Bacteria 1396
191 Ga0207671_10113800 3300025914 Bacteria 2061
192 Ga0207693_10047527 3300025915 Bacteria 3372
193 Ga0207693_10119594 3300025915 Bacteria 2069
194 Ga0207693_10127998 3300025915 Unclassified 1996
195 Ga0207663_10080367 3300025916 Bacteria 2131
196 Ga0207663_10108918 3300025916 Bacteria 1876
197 Ga0207662_10012428 3300025918 Bacteria 4741
198 Ga0207657_10298760 3300025919 Bacteria 1276
199 Ga0207646_10011330 3300025922 Bacteria 8652
200 Ga0207646_10019859 3300025922 Bacteria 6237
201 Ga0207646_10348022 3300025922 Bacteria 1339
202 Ga0207681_10058351 3300025923 Bacteria 2642
203 Ga0207694_10306193 3300025924 Bacteria 1309
204 Ga0207650_10096692 3300025925 Bacteria 2266
205 Ga0207650_10450200 3300025925 Bacteria 1071
206 Ga0207687_10016715 3300025927 Bacteria 4823
207 Ga0207700_10052696 3300025928 Bacteria 3044
208 Ga0207700_10056339 3300025928 Bacteria 2959
209 Ga0207700_10378655 3300025928 Bacteria 1237
210 Ga0207664_10074034 3300025929 Bacteria 2750
211 Ga0207644_10035136 3300025931 Bacteria 3510
212 Ga0207644_10165762 3300025931 Bacteria 1721
213 Ga0207690_10138464 3300025932 Bacteria 1790
214 Ga0207706_10006318 3300025933 Bacteria 11007
215 Ga0207709_10027521 3300025935 Bacteria 3277
216 Ga0207669_10018709 3300025937 Bacteria 3588
217 Ga0207704_10045847 3300025938 Bacteria 2600
218 Ga0207665_10061491 3300025939 Bacteria 2546
219 Ga0207665_10203443 3300025939 Bacteria 1444
220 Ga0207691_10218066 3300025940 Bacteria 1655
221 Ga0207711_10090426 3300025941 Unclassified 2691
222 Ga0207711_10126520 3300025941 Unclassified 2286
223 Ga0207689_10036847 3300025942 Bacteria 4059
224 Ga0207679_10147924 3300025945 Bacteria 1908
225 Ga0207667_10118475 3300025949 Bacteria 2728
226 Ga0207712_10057510 3300025961 Bacteria 2744
227 Ga0207712_10116054 3300025961 Bacteria 2017
228 Ga0207712_10166372 3300025961 Bacteria 1719
229 Ga0207640_10026916 3300025981 Bacteria 3498
230 Ga0207658_10079749 3300025986 Bacteria 2505
231 Ga0207703_10066901 3300026035 Bacteria 2956
232 Ga0207639_10113671 3300026041 Bacteria 2211
233 Ga0207678_10074456 3300026067 Bacteria 2910
234 Ga0207702_10116057 3300026078 Bacteria 2388
235 Ga0207648_10018891 3300026089 Bacteria 6227
236 Ga0207676_10052283 3300026095 Bacteria 3192
237 Ga0207674_10047328 3300026116 Bacteria 4409
238 Ga0207683_10022454 3300026121 Bacteria 5417
239 Ga0207683_10176741 3300026121 Bacteria 1935
240 Ga0207698_10032394 3300026142 Bacteria 3786
241 Ga0207428_10233827 3300027907 Bacteria 1375
242 Ga0268266_10062186 3300028379 Bacteria 3221
243 Ga0268265_10026630 3300028380 Bacteria 4116
244 Ga0268265_10221321 3300028380 Bacteria 1656
245 Ga0268264_10034788 3300028381 Bacteria 4146
246 Ga0268264_10097911 3300028381 Bacteria 2543
247 Ga0268264_10262014 3300028381 Bacteria 1611
248 Ga0373923_0045650 3300035111 Bacteria 1820
249 Ga0373936_0121651 3300035113 Bacteria 1115
250 Ga0373945_0003958 3300035116 Bacteria 4686
251 Ga0373954_0142494 3300035118 Bacteria 1169
252 Ga0373946_0034040 3300035171 Bacteria 2054
253 Ga0373935_0013800 3300035692 Unclassified 4878
254 Ga0373927_0045299 3300035695 Bacteria 2845
255 Ga0436360_0210154 3300039438 Bacteria 3362
256 Ga0451798_0913698 3300041458 Bacteria 1612
257 Ga0495592_0219146 3300046454 Unclassified 1273
258 Ga0495603_0036298 3300046455 Unclassified 2959
259 Ga0495641_0112679 3300046461 Bacteria 1213
260 Ga0495651_0114537 3300046462 Bacteria 1989
261 Ga0495580_0155581 3300046472 Bacteria 1583
262 Ga0495582_0082633 3300046473 Bacteria 1784
263 Ga0495605_0079058 3300046474 Archaea 1541
264 Ga0495664_0019158 3300046477 Bacteria 3931
265 Ga0495594_0060275 3300046499 Bacteria 2099
266 Ga0495594_0101271 3300046499 Bacteria 1620
267 Ga0495608_0046561 3300046511 Bacteria 2886
268 Ga0495618_0008152 3300046514 Bacteria 6347
269 Ga0495628_0056676 3300046516 Bacteria 3084
270 Ga0495644_0086496 3300046523 Unclassified 1182
271 Ga0495666_0151919 3300046526 Bacteria 1076
272 Ga0495652_0032623 3300046529 Bacteria 4553
273 Ga0495665_0024378 3300046531 Bacteria 3250
274 Ga0495640_0225071 3300046533 Unclassified 1182
275 Ga0495586_0138235 3300046535 Bacteria 1366
276 Ga0495598_0003597 3300046537 Bacteria 3305
277 Ga0495667_0068225 3300046559 Bacteria 2322
278 Ga0495634_0023523 3300046642 Bacteria 4329
279 Ga0495634_0218302 3300046642 Bacteria 1178
280 Ga0495611_0136573 3300046648 Bacteria 1145
281 Ga0495635_0128512 3300046663 Unclassified 1727
282 Ga0495661_0128021 3300046665 Bacteria 1395
283 Ga0495657_0320252 3300046675 Unclassified 922
284 Ga0495599_0083297 3300046678 Bacteria 1997
285 Ga0495624_0017937 3300046690 Bacteria 4742
286 Ga0495670_0018275 3300046691 Bacteria 3452
287 Ga0495670_0070722 3300046691 Bacteria 1766
288 Ga0495671_0167878 3300046692 Unclassified 1067
289 Ga0495649_0083472 3300046694 Bacteria 1707
290 Ga0495600_0004307 3300046809 Bacteria 8516
291 Ga0495581_0072727 3300047315 Bacteria 1989
292 Ga0495604_0337523 3300047317 Bacteria 1004
293 Ga0495676_0251102 3300047321 Bacteria 1206
294 Ga0495680_0095901 3300047322 Bacteria 2216
295 Ga0495681_0062582 3300047470 Bacteria 1711
296 Ga0495684_0003035 3300047471 Bacteria 13210
297 Ga0496100_0047365 3300048903 Bacteria 2769
298 Ga0496101_0000630 3300048904 Bacteria 21384
299 Ga0496101_0314149 3300048904 Bacteria 1229
300 Ga0496102_0033100 3300048905 Bacteria 4644
301 Ga0496102_0087070 3300048905 Bacteria 2885
302 Ga0496103_0013452 3300048906 Bacteria 4853
303 Ga0496104_0000368 3300048907 Bacteria 39833
304 Ga0496104_0007425 3300048907 Bacteria 9686
305 Ga0496104_0010378 3300048907 Bacteria 8320
306 Ga0496104_0090900 3300048907 Bacteria 2917
307 Ga0496104_0329283 3300048907 Bacteria 1440
308 Ga0496105_0008646 3300048908 Bacteria 7918
309 Ga0496105_0035992 3300048908 Bacteria 4076
310 Ga0496105_0108001 3300048908 Bacteria 2297
311 Ga0496106_0018608 3300048909 Bacteria 5141
312 Ga0496106_0042188 3300048909 Bacteria 3421
313 Ga0496106_0047912 3300048909 Bacteria 3217
314 Ga0496107_0112808 3300048910 Bacteria 1999
315 Ga0496107_0231918 3300048910 Bacteria 1374
316 Ga0496108_0000882 3300048911 Bacteria 23371
317 Ga0496108_0058130 3300048911 Bacteria 3249
318 Ga0496108_0223178 3300048911 Bacteria 1637
319 Ga0496108_0305931 3300048911 Bacteria 1385
320 Ga0496109_0000618 3300048912 Bacteria 29626
321 Ga0496109_0018844 3300048912 Bacteria 6072
322 Ga0496109_0369217 3300048912 Bacteria 1355
323 Ga0496109_0409495 3300048912 Unclassified 1281
324 Ga0496110_0015198 3300048913 Bacteria 6403
325 Ga0496110_0016647 3300048913 Bacteria 6141
326 Ga0496110_0176733 3300048913 Bacteria 1938
327 Ga0496110_0217275 3300048913 Bacteria 1738
328 Ga0496111_0003947 3300048914 Bacteria 9307
329 Ga0496111_0012512 3300048914 Bacteria 5748
330 Ga0496111_0175757 3300048914 Bacteria 1592
331 Ga0496111_0373479 3300048914 Unclassified 1055
332 Ga0496112_0006822 3300048915 Bacteria 10064
333 Ga0496112_0030715 3300048915 Bacteria 5203
334 Ga0496112_0149986 3300048915 Unclassified 2299
335 Ga0496112_0238682 3300048915 Unclassified 1771
336 Ga0496112_0240215 3300048915 Bacteria 1764
337 Ga0496112_0269028 3300048915 Unclassified 1653
338 Ga0496113_0001212 3300048916 Bacteria 14140
339 Ga0496113_0001474 3300048916 Bacteria 13127
340 Ga0496113_0019535 3300048916 Bacteria 4743
341 Ga0496113_0100646 3300048916 Bacteria 2239
342 Ga0496113_0191260 3300048916 Bacteria 1624
343 Ga0496114_0037581 3300048917 Bacteria 4004
344 Ga0501075_0312607 3300049591 Unclassified 1197
345 Ga0501076_0153151 3300049592 Unclassified 1876
346 Ga0501076_0360202 3300049592 Bacteria 1195
347 Ga0501081_0050845 3300049743 Bacteria 2856
348 nmdc:mga05p37_13381_c1 3300050507 Bacteria 9832
349 nmdc:mga05p37_167420_c1 3300050507 Bacteria 2682
350 nmdc:mga05p37_40867_c1 3300050507 Bacteria 5694
351 nmdc:mga05p37_80621_c2 3300050507 Bacteria 1751
352 nmdc:mga05p37_85573_c1 3300050507 Bacteria 3885
353 nmdc:mga09592_170379_c1 3300050508 Bacteria 1882
354 nmdc:mga0qj67_73958_c1 3300050509 Bacteria 2722
355 nmdc:mga06r32_145966_c1 3300050510 Bacteria 2343
356 nmdc:mga08y16_420080_c1 3300050511 Bacteria 1367
357 nmdc:mga0n895_466637_c1 3300050512 Bacteria 1274
358 nmdc:mga0n895_536903_c1 3300050512 Bacteria 1176
359 nmdc:mga0n895_546125_c1 3300050512 Bacteria 1165
360 nmdc:mga0n895_98675_c1 3300050512 Bacteria 2928
361 nmdc:mga0a205_156480_c1 3300050515 Bacteria 2177
362 nmdc:mga0a205_27280_c1 3300050515 Bacteria 5454
363 Ga0495601_0001006 3300053077 Bacteria 15442
364 Ga0495601_0058879 3300053077 Bacteria 2435
365 Ga0495612_0003506 3300053078 Bacteria 6502
366 Ga0495595_0018244 3300053084 Bacteria 3031
367 Ga0495619_0002548 3300053085 Bacteria 11932
368 Ga0495619_0107164 3300053085 Bacteria 1906
369 Ga0495619_0162028 3300053085 Bacteria 1545
370 Ga0501082_0432785 3300060353 Bacteria 1149

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10456263 Ga0105249_104562632 235
2 3300053085 Ga0495619_0107164 Ga0495619_0107164_885_1700 236
3 3300048904 Ga0496101_0314149 Ga0496101_0314149_125_1087 249
4 3300048907 Ga0496104_0010378 Ga0496104_0010378_371_1333 249
5 3300048908 Ga0496105_0008646 Ga0496105_0008646_1800_2762 249
6 3300009147 Ga0114129_10189062 Ga0114129_101890622 264
7 3300050508 nmdc:mga09592_170379_c1 nmdc:mga09592_170379_c1_909_1817 264
8 3300005355 Ga0070671_100206940 Ga0070671_1002069401 269
9 3300005616 Ga0068852_100155817 Ga0068852_1001558172 269
10 3300006237 Ga0097621_100123453 Ga0097621_1001234532 269
11 3300025931 Ga0207644_10165762 Ga0207644_101657621 269
12 3300025941 Ga0207711_10090426 Ga0207711_100904261 269
13 3300026121 Ga0207683_10176741 Ga0207683_101767412 269
14 3300005434 Ga0070709_10094388 Ga0070709_100943882 270
15 3300005435 Ga0070714_100221397 Ga0070714_1002213972 270
16 3300005436 Ga0070713_100025840 Ga0070713_1000258405 270
17 3300006871 Ga0075434_100449645 Ga0075434_1004496452 270
18 3300009094 Ga0111539_10593611 Ga0111539_105936112 270
19 3300009147 Ga0114129_10873234 Ga0114129_108732342 270
20 3300025906 Ga0207699_10131144 Ga0207699_101311442 270
21 3300025928 Ga0207700_10056339 Ga0207700_100563393 270
22 3300025939 Ga0207665_10061491 Ga0207665_100614912 270
23 3300048910 Ga0496107_0231918 Ga0496107_0231918_82_1059 270
24 3300048915 Ga0496112_0269028 Ga0496112_0269028_27_1007 270
25 3300050512 nmdc:mga0n895_466637_c1 nmdc:mga0n895_466637_c1_111_1088 270
26 3300005518 Ga0070699_100030389 Ga0070699_1000303891 272
27 3300005546 Ga0070696_100145158 Ga0070696_1001451582 272
28 3300035116 Ga0373945_0003958 Ga0373945_0003958_3853_4674 272
29 3300046648 Ga0495611_0136573 Ga0495611_0136573_283_1101 272
30 3300046675 Ga0495657_0320252 Ga0495657_0320252_87_908 272
31 3300047317 Ga0495604_0337523 Ga0495604_0337523_150_971 272
32 3300050507 nmdc:mga05p37_40867_c1 nmdc:mga05p37_40867_c1_4152_5180 272
33 3300005467 Ga0070706_100362355 Ga0070706_1003623551 286
34 3300025922 Ga0207646_10019859 Ga0207646_100198598 286
35 3300046537 Ga0495598_0003597 Ga0495598_0003597_1348_2337 287
36 3300046691 Ga0495670_0018275 Ga0495670_0018275_2287_3276 287
37 3300005468 Ga0070707_100011016 Ga0070707_1000110164 288
38 3300006038 Ga0075365_10032293 Ga0075365_100322932 288
39 3300049592 Ga0501076_0360202 Ga0501076_0360202_115_1077 289
40 3300005459 Ga0068867_100304954 Ga0068867_1003049541 290
41 3300013306 Ga0163162_10303773 Ga0163162_103037732 290
42 3300013308 Ga0157375_10315316 Ga0157375_103153162 290
43 3300009094 Ga0111539_10539370 Ga0111539_105393701 291
44 3300027907 Ga0207428_10233827 Ga0207428_102338271 291
45 3300050511 nmdc:mga08y16_420080_c1 nmdc:mga08y16_420080_c1_112_1062 291
46 3300005471 Ga0070698_100372309 Ga0070698_1003723092 292
47 3300006163 Ga0070715_10008158 Ga0070715_100081584 292
48 3300006844 Ga0075428_100052060 Ga0075428_1000520604 292
49 3300025910 Ga0207684_10162891 Ga0207684_101628912 292
50 3300046523 Ga0495644_0086496 Ga0495644_0086496_251_1132 292
51 3300005330 Ga0070690_100036758 Ga0070690_1000367581 293
52 3300005334 Ga0068869_100133262 Ga0068869_1001332622 293
53 3300005544 Ga0070686_100100272 Ga0070686_1001002723 293
54 3300005545 Ga0070695_100122846 Ga0070695_1001228461 293
55 3300005546 Ga0070696_100117602 Ga0070696_1001176022 293
56 3300005546 Ga0070696_100190511 Ga0070696_1001905112 293
57 3300005549 Ga0070704_100095878 Ga0070704_1000958782 293
58 3300005617 Ga0068859_100103905 Ga0068859_1001039052 293
59 3300005843 Ga0068860_100023203 Ga0068860_1000232038 293
60 3300005844 Ga0068862_100052276 Ga0068862_1000522765 293
61 3300005937 Ga0081455_10056352 Ga0081455_100563523 293
62 3300006846 Ga0075430_100254269 Ga0075430_1002542692 293
63 3300006931 Ga0097620_100103904 Ga0097620_1001039043 293
64 3300009147 Ga0114129_10076776 Ga0114129_100767763 293
65 3300009147 Ga0114129_10602054 Ga0114129_106020542 293
66 3300009177 Ga0105248_10038309 Ga0105248_100383092 293
67 3300009177 Ga0105248_10094786 Ga0105248_100947863 293
68 3300009553 Ga0105249_10028938 Ga0105249_100289383 293
69 3300009553 Ga0105249_10061008 Ga0105249_100610085 293
70 3300009553 Ga0105249_10275728 Ga0105249_102757282 293
71 3300017792 Ga0163161_10346771 Ga0163161_103467711 293
72 3300025941 Ga0207711_10126520 Ga0207711_101265201 293
73 3300025961 Ga0207712_10116054 Ga0207712_101160543 293
74 3300025961 Ga0207712_10166372 Ga0207712_101663722 293
75 3300028380 Ga0268265_10221321 Ga0268265_102213212 293
76 3300028381 Ga0268264_10097911 Ga0268264_100979111 293
77 3300028381 Ga0268264_10262014 Ga0268264_102620142 293
78 3300050509 nmdc:mga0qj67_73958_c1 nmdc:mga0qj67_73958_c1_1101_2153 293
79 3300050510 nmdc:mga06r32_145966_c1 nmdc:mga06r32_145966_c1_17_997 293
80 3300005445 Ga0070708_100052348 Ga0070708_1000523482 294
81 3300005468 Ga0070707_100146751 Ga0070707_1001467512 294
82 3300005471 Ga0070698_100182682 Ga0070698_1001826822 294
83 3300005518 Ga0070699_100116695 Ga0070699_1001166951 294
84 3300005536 Ga0070697_100052048 Ga0070697_1000520482 294
85 3300005937 Ga0081455_10023483 Ga0081455_100234834 294
86 3300006847 Ga0075431_100558246 Ga0075431_1005582461 294
87 3300013306 Ga0163162_10798340 Ga0163162_107983401 294
88 3300048915 Ga0496112_0238682 Ga0496112_0238682_107_1090 294
89 3300049591 Ga0501075_0312607 Ga0501075_0312607_45_965 294
90 3300049592 Ga0501076_0153151 Ga0501076_0153151_266_1246 294
91 3300049743 Ga0501081_0050845 Ga0501081_0050845_1310_2290 294
92 3300050507 nmdc:mga05p37_167420_c1 nmdc:mga05p37_167420_c1_144_1124 294
93 3300050515 nmdc:mga0a205_27280_c1 nmdc:mga0a205_27280_c1_1850_2830 294
94 3300060353 Ga0501082_0432785 Ga0501082_0432785_150_1130 294
95 3300001990 JGI24737J22298_10037125 JGI24737J22298_100371252 295
96 3300001991 JGI24743J22301_10004315 JGI24743J22301_100043152 295
97 3300002070 JGI24750J21931_1001313 JGI24750J21931_10013133 295
98 3300002074 JGI24748J21848_1002510 JGI24748J21848_10025102 295
99 3300002075 JGI24738J21930_10001099 JGI24738J21930_100010997 295
100 3300002239 JGI24034J26672_10003585 JGI24034J26672_100035852 295
101 3300002244 JGI24742J22300_10004910 JGI24742J22300_100049102 295
102 3300002244 JGI24742J22300_10006057 JGI24742J22300_100060572 295
103 3300002459 JGI24751J29686_10006214 JGI24751J29686_100062142 295
104 3300005328 Ga0070676_10023626 Ga0070676_100236262 295
105 3300005329 Ga0070683_100096789 Ga0070683_1000967892 295
106 3300005330 Ga0070690_100064609 Ga0070690_1000646092 295
107 3300005334 Ga0068869_100014560 Ga0068869_1000145607 295
108 3300005337 Ga0070682_100015752 Ga0070682_1000157522 295
109 3300005338 Ga0068868_100014314 Ga0068868_1000143144 295
110 3300005339 Ga0070660_100039512 Ga0070660_1000395122 295
111 3300005340 Ga0070689_100007296 Ga0070689_1000072967 295
112 3300005341 Ga0070691_10030217 Ga0070691_100302172 295
113 3300005343 Ga0070687_100032793 Ga0070687_1000327932 295
114 3300005345 Ga0070692_10046697 Ga0070692_100466972 295
115 3300005347 Ga0070668_100044706 Ga0070668_1000447062 295
116 3300005353 Ga0070669_100038349 Ga0070669_1000383492 295
117 3300005355 Ga0070671_100034720 Ga0070671_1000347205 295
118 3300005356 Ga0070674_100050565 Ga0070674_1000505652 295
119 3300005364 Ga0070673_100220744 Ga0070673_1002207441 295
120 3300005365 Ga0070688_100157084 Ga0070688_1001570842 295
121 3300005366 Ga0070659_100051207 Ga0070659_1000512072 295
122 3300005434 Ga0070709_10007589 Ga0070709_100075894 295
123 3300005435 Ga0070714_100444720 Ga0070714_1004447201 295
124 3300005436 Ga0070713_100063568 Ga0070713_1000635682 295
125 3300005436 Ga0070713_100091561 Ga0070713_1000915612 295
126 3300005436 Ga0070713_100204576 Ga0070713_1002045762 295
127 3300005436 Ga0070713_100207172 Ga0070713_1002071724 295
128 3300005437 Ga0070710_10011391 Ga0070710_100113912 295
129 3300005438 Ga0070701_10012773 Ga0070701_100127732 295
130 3300005439 Ga0070711_100076242 Ga0070711_1000762422 295
131 3300005439 Ga0070711_100268028 Ga0070711_1002680282 295
132 3300005440 Ga0070705_100070778 Ga0070705_1000707782 295
133 3300005440 Ga0070705_100389837 Ga0070705_1003898371 295
134 3300005444 Ga0070694_100069700 Ga0070694_1000697002 295
135 3300005445 Ga0070708_100104285 Ga0070708_1001042852 295
136 3300005445 Ga0070708_100114769 Ga0070708_1001147692 295
137 3300005445 Ga0070708_100157041 Ga0070708_1001570412 295
138 3300005445 Ga0070708_100202536 Ga0070708_1002025363 295
139 3300005455 Ga0070663_100038247 Ga0070663_1000382473 295
140 3300005456 Ga0070678_100009641 Ga0070678_1000096412 295
141 3300005459 Ga0068867_100016764 Ga0068867_1000167645 295
142 3300005466 Ga0070685_10033475 Ga0070685_100334752 295
143 3300005467 Ga0070706_100026236 Ga0070706_1000262362 295
144 3300005467 Ga0070706_100220475 Ga0070706_1002204753 295
145 3300005467 Ga0070706_100316597 Ga0070706_1003165972 295
146 3300005468 Ga0070707_100014065 Ga0070707_1000140656 295
147 3300005468 Ga0070707_100222156 Ga0070707_1002221561 295
148 3300005471 Ga0070698_100288706 Ga0070698_1002887063 295
149 3300005471 Ga0070698_100381323 Ga0070698_1003813232 295
150 3300005471 Ga0070698_100383349 Ga0070698_1003833492 295
151 3300005518 Ga0070699_100004994 Ga0070699_1000049945 295
152 3300005518 Ga0070699_100007576 Ga0070699_1000075765 295
153 3300005535 Ga0070684_100191644 Ga0070684_1001916442 295
154 3300005536 Ga0070697_100127476 Ga0070697_1001274762 295
155 3300005536 Ga0070697_100327850 Ga0070697_1003278501 295
156 3300005543 Ga0070672_100204369 Ga0070672_1002043692 295
157 3300005544 Ga0070686_100029022 Ga0070686_1000290222 295
158 3300005546 Ga0070696_100089445 Ga0070696_1000894452 295
159 3300005546 Ga0070696_100112123 Ga0070696_1001121232 295
160 3300005563 Ga0068855_100247378 Ga0068855_1002473782 295
161 3300005564 Ga0070664_100088585 Ga0070664_1000885852 295
162 3300005578 Ga0068854_100015869 Ga0068854_1000158699 295
163 3300005614 Ga0068856_100286676 Ga0068856_1002866762 295
164 3300005615 Ga0070702_100042572 Ga0070702_1000425722 295
165 3300005616 Ga0068852_100110771 Ga0068852_1001107712 295
166 3300005617 Ga0068859_100033231 Ga0068859_1000332318 295
167 3300005718 Ga0068866_10031333 Ga0068866_100313332 295
168 3300005834 Ga0068851_10015712 Ga0068851_100157122 295
169 3300005840 Ga0068870_10010724 Ga0068870_100107242 295
170 3300005841 Ga0068863_100113473 Ga0068863_1001134732 295
171 3300005842 Ga0068858_100211940 Ga0068858_1002119402 295
172 3300005843 Ga0068860_100122093 Ga0068860_1001220932 295
173 3300005844 Ga0068862_100052161 Ga0068862_1000521612 295
174 3300006028 Ga0070717_10050126 Ga0070717_100501263 295
175 3300006028 Ga0070717_10171932 Ga0070717_101719321 295
176 3300006028 Ga0070717_10338340 Ga0070717_103383402 295
177 3300006028 Ga0070717_10363749 Ga0070717_103637491 295
178 3300006163 Ga0070715_10009587 Ga0070715_100095873 295
179 3300006163 Ga0070715_10009594 Ga0070715_100095942 295
180 3300006163 Ga0070715_10017046 Ga0070715_100170462 295
181 3300006173 Ga0070716_100184632 Ga0070716_1001846322 295
182 3300006175 Ga0070712_100042294 Ga0070712_1000422942 295
183 3300006237 Ga0097621_100024745 Ga0097621_1000247452 295
184 3300006844 Ga0075428_100088981 Ga0075428_1000889815 295
185 3300006844 Ga0075428_100467857 Ga0075428_1004678571 295
186 3300006852 Ga0075433_10279063 Ga0075433_102790632 295
187 3300006852 Ga0075433_10316640 Ga0075433_103166402 295
188 3300006871 Ga0075434_100097354 Ga0075434_1000973542 295
189 3300006871 Ga0075434_100403753 Ga0075434_1004037532 295
190 3300006871 Ga0075434_100435861 Ga0075434_1004358612 295
191 3300006881 Ga0068865_100015904 Ga0068865_1000159047 295
192 3300006931 Ga0097620_100033233 Ga0097620_1000332338 295
193 3300007076 Ga0075435_100263180 Ga0075435_1002631801 295
194 3300009094 Ga0111539_10325343 Ga0111539_103253432 295
195 3300009094 Ga0111539_10473689 Ga0111539_104736892 295
196 3300009101 Ga0105247_10007699 Ga0105247_100076991 295
197 3300009147 Ga0114129_10025350 Ga0114129_100253507 295
198 3300009147 Ga0114129_10107293 Ga0114129_101072934 295
199 3300009147 Ga0114129_10134594 Ga0114129_101345942 295
200 3300009147 Ga0114129_10221548 Ga0114129_102215483 295
201 3300009148 Ga0105243_10054611 Ga0105243_100546114 295
202 3300009174 Ga0105241_10030889 Ga0105241_100308892 295
203 3300009177 Ga0105248_10096674 Ga0105248_100966743 295
204 3300009553 Ga0105249_10157623 Ga0105249_101576231 295
205 3300010375 Ga0105239_10003524 Ga0105239_1000352421 295
206 3300010375 Ga0105239_10742330 Ga0105239_107423302 295
207 3300011119 Ga0105246_10015439 Ga0105246_100154392 295
208 3300013296 Ga0157374_10018790 Ga0157374_100187907 295
209 3300013297 Ga0157378_10012681 Ga0157378_1001268110 295
210 3300013306 Ga0163162_10042757 Ga0163162_100427572 295
211 3300013306 Ga0163162_10403237 Ga0163162_104032372 295
212 3300013308 Ga0157375_10225251 Ga0157375_102252512 295
213 3300014325 Ga0163163_10119803 Ga0163163_101198032 295
214 3300014745 Ga0157377_10025774 Ga0157377_100257742 295
215 3300014968 Ga0157379_10042542 Ga0157379_100425422 295
216 3300017792 Ga0163161_10060388 Ga0163161_100603882 295
217 3300025315 Ga0207697_10074850 Ga0207697_100748502 295
218 3300025321 Ga0207656_10064509 Ga0207656_100645092 295
219 3300025898 Ga0207692_10029038 Ga0207692_100290381 295
220 3300025898 Ga0207692_10072893 Ga0207692_100728931 295
221 3300025900 Ga0207710_10006142 Ga0207710_100061427 295
222 3300025901 Ga0207688_10004653 Ga0207688_1000465310 295
223 3300025905 Ga0207685_10023103 Ga0207685_100231032 295
224 3300025905 Ga0207685_10023260 Ga0207685_100232602 295
225 3300025906 Ga0207699_10006070 Ga0207699_100060704 295
226 3300025907 Ga0207645_10065511 Ga0207645_100655112 295
227 3300025908 Ga0207643_10011076 Ga0207643_100110762 295
228 3300025910 Ga0207684_10018827 Ga0207684_100188273 295
229 3300025910 Ga0207684_10084321 Ga0207684_100843212 295
230 3300025911 Ga0207654_10175165 Ga0207654_101751651 295
231 3300025914 Ga0207671_10113800 Ga0207671_101138001 295
232 3300025915 Ga0207693_10047527 Ga0207693_100475274 295
233 3300025915 Ga0207693_10119594 Ga0207693_101195941 295
234 3300025915 Ga0207693_10127998 Ga0207693_101279981 295
235 3300025916 Ga0207663_10080367 Ga0207663_100803672 295
236 3300025916 Ga0207663_10108918 Ga0207663_101089182 295
237 3300025918 Ga0207662_10012428 Ga0207662_100124284 295
238 3300025919 Ga0207657_10298760 Ga0207657_102987601 295
239 3300025922 Ga0207646_10011330 Ga0207646_100113302 295
240 3300025922 Ga0207646_10348022 Ga0207646_103480222 295
241 3300025923 Ga0207681_10058351 Ga0207681_100583513 295
242 3300025924 Ga0207694_10306193 Ga0207694_103061932 295
243 3300025925 Ga0207650_10096692 Ga0207650_100966921 295
244 3300025925 Ga0207650_10450200 Ga0207650_104502001 295
245 3300025927 Ga0207687_10016715 Ga0207687_100167152 295
246 3300025928 Ga0207700_10052696 Ga0207700_100526962 295
247 3300025928 Ga0207700_10378655 Ga0207700_103786551 295
248 3300025929 Ga0207664_10074034 Ga0207664_100740342 295
249 3300025931 Ga0207644_10035136 Ga0207644_100351362 295
250 3300025932 Ga0207690_10138464 Ga0207690_101384642 295
251 3300025933 Ga0207706_10006318 Ga0207706_1000631814 295
252 3300025935 Ga0207709_10027521 Ga0207709_100275212 295
253 3300025937 Ga0207669_10018709 Ga0207669_100187094 295
254 3300025938 Ga0207704_10045847 Ga0207704_100458472 295
255 3300025939 Ga0207665_10203443 Ga0207665_102034432 295
256 3300025940 Ga0207691_10218066 Ga0207691_102180662 295
257 3300025942 Ga0207689_10036847 Ga0207689_100368472 295
258 3300025945 Ga0207679_10147924 Ga0207679_101479242 295
259 3300025949 Ga0207667_10118475 Ga0207667_101184752 295
260 3300025961 Ga0207712_10057510 Ga0207712_100575103 295
261 3300025981 Ga0207640_10026916 Ga0207640_100269165 295
262 3300025986 Ga0207658_10079749 Ga0207658_100797492 295
263 3300026035 Ga0207703_10066901 Ga0207703_100669012 295
264 3300026041 Ga0207639_10113671 Ga0207639_101136712 295
265 3300026067 Ga0207678_10074456 Ga0207678_100744562 295
266 3300026078 Ga0207702_10116057 Ga0207702_101160572 295
267 3300026089 Ga0207648_10018891 Ga0207648_100188918 295
268 3300026095 Ga0207676_10052283 Ga0207676_100522832 295
269 3300026116 Ga0207674_10047328 Ga0207674_100473288 295
270 3300026121 Ga0207683_10022454 Ga0207683_100224542 295
271 3300026142 Ga0207698_10032394 Ga0207698_100323945 295
272 3300028379 Ga0268266_10062186 Ga0268266_100621863 295
273 3300028380 Ga0268265_10026630 Ga0268265_100266302 295
274 3300028381 Ga0268264_10034788 Ga0268264_100347882 295
275 3300035111 Ga0373923_0045650 Ga0373923_0045650_433_1407 295
276 3300035113 Ga0373936_0121651 Ga0373936_0121651_91_1065 295
277 3300035118 Ga0373954_0142494 Ga0373954_0142494_46_1020 295
278 3300035171 Ga0373946_0034040 Ga0373946_0034040_981_1955 295
279 3300035692 Ga0373935_0013800 Ga0373935_0013800_1501_2475 295
280 3300035695 Ga0373927_0045299 Ga0373927_0045299_824_1798 295
281 3300039438 Ga0436360_0210154 Ga0436360_0210154_954_1931 295
282 3300041458 Ga0451798_0913698 Ga0451798_0913698_399_1286 295
283 3300046454 Ga0495592_0219146 Ga0495592_0219146_152_1126 295
284 3300046455 Ga0495603_0036298 Ga0495603_0036298_549_1523 295
285 3300046461 Ga0495641_0112679 Ga0495641_0112679_100_1074 295
286 3300046462 Ga0495651_0114537 Ga0495651_0114537_959_1933 295
287 3300046472 Ga0495580_0155581 Ga0495580_0155581_548_1522 295
288 3300046473 Ga0495582_0082633 Ga0495582_0082633_422_1396 295
289 3300046474 Ga0495605_0079058 Ga0495605_0079058_451_1377 295
290 3300046477 Ga0495664_0019158 Ga0495664_0019158_375_1349 295
291 3300046499 Ga0495594_0060275 Ga0495594_0060275_283_1209 295
292 3300046499 Ga0495594_0101271 Ga0495594_0101271_583_1557 295
293 3300046511 Ga0495608_0046561 Ga0495608_0046561_450_1424 295
294 3300046514 Ga0495618_0008152 Ga0495618_0008152_950_1924 295
295 3300046516 Ga0495628_0056676 Ga0495628_0056676_156_1130 295
296 3300046526 Ga0495666_0151919 Ga0495666_0151919_66_1040 295
297 3300046529 Ga0495652_0032623 Ga0495652_0032623_1301_2275 295
298 3300046531 Ga0495665_0024378 Ga0495665_0024378_2003_2977 295
299 3300046533 Ga0495640_0225071 Ga0495640_0225071_265_1155 295
300 3300046535 Ga0495586_0138235 Ga0495586_0138235_316_1290 295
301 3300046559 Ga0495667_0068225 Ga0495667_0068225_547_1521 295
302 3300046642 Ga0495634_0023523 Ga0495634_0023523_260_1234 295
303 3300046642 Ga0495634_0218302 Ga0495634_0218302_53_940 295
304 3300046663 Ga0495635_0128512 Ga0495635_0128512_231_1205 295
305 3300046665 Ga0495661_0128021 Ga0495661_0128021_265_1191 295
306 3300046678 Ga0495599_0083297 Ga0495599_0083297_710_1684 295
307 3300046690 Ga0495624_0017937 Ga0495624_0017937_357_1331 295
308 3300046691 Ga0495670_0070722 Ga0495670_0070722_376_1302 295
309 3300046692 Ga0495671_0167878 Ga0495671_0167878_17_991 295
310 3300046694 Ga0495649_0083472 Ga0495649_0083472_564_1451 295
311 3300046809 Ga0495600_0004307 Ga0495600_0004307_4716_5690 295
312 3300047315 Ga0495581_0072727 Ga0495581_0072727_750_1724 295
313 3300047321 Ga0495676_0251102 Ga0495676_0251102_74_1048 295
314 3300047322 Ga0495680_0095901 Ga0495680_0095901_272_1246 295
315 3300047470 Ga0495681_0062582 Ga0495681_0062582_676_1653 295
316 3300047471 Ga0495684_0003035 Ga0495684_0003035_2245_3219 295
317 3300048903 Ga0496100_0047365 Ga0496100_0047365_821_1708 295
318 3300048904 Ga0496101_0000630 Ga0496101_0000630_19915_20802 295
319 3300048905 Ga0496102_0033100 Ga0496102_0033100_784_1773 295
320 3300048905 Ga0496102_0087070 Ga0496102_0087070_1419_2306 295
321 3300048906 Ga0496103_0013452 Ga0496103_0013452_1534_2421 295
322 3300048907 Ga0496104_0000368 Ga0496104_0000368_23299_24288 295
323 3300048907 Ga0496104_0007425 Ga0496104_0007425_795_1784 295
324 3300048907 Ga0496104_0090900 Ga0496104_0090900_1541_2428 295
325 3300048907 Ga0496104_0329283 Ga0496104_0329283_107_1090 295
326 3300048908 Ga0496105_0035992 Ga0496105_0035992_2849_3736 295
327 3300048908 Ga0496105_0108001 Ga0496105_0108001_689_1678 295
328 3300048909 Ga0496106_0018608 Ga0496106_0018608_791_1780 295
329 3300048909 Ga0496106_0042188 Ga0496106_0042188_2218_3207 295
330 3300048909 Ga0496106_0047912 Ga0496106_0047912_1212_2099 295
331 3300048910 Ga0496107_0112808 Ga0496107_0112808_585_1574 295
332 3300048911 Ga0496108_0000882 Ga0496108_0000882_20900_21889 295
333 3300048911 Ga0496108_0058130 Ga0496108_0058130_2299_3186 295
334 3300048911 Ga0496108_0223178 Ga0496108_0223178_447_1430 295
335 3300048911 Ga0496108_0305931 Ga0496108_0305931_95_1084 295
336 3300048912 Ga0496109_0000618 Ga0496109_0000618_27361_28350 295
337 3300048912 Ga0496109_0018844 Ga0496109_0018844_3015_3902 295
338 3300048912 Ga0496109_0369217 Ga0496109_0369217_163_1146 295
339 3300048912 Ga0496109_0409495 Ga0496109_0409495_75_1052 295
340 3300048913 Ga0496110_0015198 Ga0496110_0015198_1912_2799 295
341 3300048913 Ga0496110_0016647 Ga0496110_0016647_795_1784 295
342 3300048913 Ga0496110_0176733 Ga0496110_0176733_599_1576 295
343 3300048913 Ga0496110_0217275 Ga0496110_0217275_578_1561 295
344 3300048914 Ga0496111_0003947 Ga0496111_0003947_3733_4722 295
345 3300048914 Ga0496111_0012512 Ga0496111_0012512_2558_3445 295
346 3300048914 Ga0496111_0175757 Ga0496111_0175757_159_1124 295
347 3300048914 Ga0496111_0373479 Ga0496111_0373479_31_1011 295
348 3300048915 Ga0496112_0006822 Ga0496112_0006822_795_1784 295
349 3300048915 Ga0496112_0030715 Ga0496112_0030715_2305_3192 295
350 3300048915 Ga0496112_0149986 Ga0496112_0149986_361_1344 295
351 3300048915 Ga0496112_0240215 Ga0496112_0240215_578_1561 295
352 3300048916 Ga0496113_0001212 Ga0496113_0001212_7716_8705 295
353 3300048916 Ga0496113_0001474 Ga0496113_0001474_11678_12565 295
354 3300048916 Ga0496113_0019535 Ga0496113_0019535_2825_3814 295
355 3300048916 Ga0496113_0100646 Ga0496113_0100646_578_1555 295
356 3300048916 Ga0496113_0191260 Ga0496113_0191260_223_1206 295
357 3300048917 Ga0496114_0037581 Ga0496114_0037581_2297_3184 295
358 3300050507 nmdc:mga05p37_13381_c1 nmdc:mga05p37_13381_c1_3754_4743 295
359 3300050507 nmdc:mga05p37_80621_c2 nmdc:mga05p37_80621_c2_592_1593 295
360 3300050507 nmdc:mga05p37_85573_c1 nmdc:mga05p37_85573_c1_1993_2964 295
361 3300050512 nmdc:mga0n895_536903_c1 nmdc:mga0n895_536903_c1_140_1114 295
362 3300050512 nmdc:mga0n895_546125_c1 nmdc:mga0n895_546125_c1_68_1051 295
363 3300050512 nmdc:mga0n895_98675_c1 nmdc:mga0n895_98675_c1_1727_2740 295
364 3300050515 nmdc:mga0a205_156480_c1 nmdc:mga0a205_156480_c1_259_1242 295
365 3300053077 Ga0495601_0001006 Ga0495601_0001006_13801_14775 295
366 3300053077 Ga0495601_0058879 Ga0495601_0058879_133_1107 295
367 3300053078 Ga0495612_0003506 Ga0495612_0003506_1643_2617 295
368 3300053084 Ga0495595_0018244 Ga0495595_0018244_950_1924 295
369 3300053085 Ga0495619_0002548 Ga0495619_0002548_7007_7987 295
370 3300053085 Ga0495619_0162028 Ga0495619_0162028_360_1334 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

77

365

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.905 2 293
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8935 2 293
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8834 2 294
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8771 1 294
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8743 1 294
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8711 120 294 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.871 120 293 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8609 2 263 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8543 120 294 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8486 120 293 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V6ZIS3-F1-model_v4 ABC transporter substrate-binding protein 0.9915 194 295
AF-A0A5D3KGV6-F1-model_v4 ABC transporter substrate-binding protein 0.9674 135 295
AF-A0A2V7I331-F1-model_v4 ABC transporter substrate-binding protein 0.9637 190 295
AF-A0A2V7D4C4-F1-model_v4 ABC transporter substrate-binding protein 0.9635 196 295
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9631 190 295

Feature Viewer

pLDDT pTM Quality
95.1 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map