F425328

General Info

Members Datasets Scaffolds Average Seq Length
370 138 740 95

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100521694|Ga0068859_1005216942
Length 113
Sequence MAQGFARAAQEAAKRMSERTTPALNELDALLPMIKALPKSADAERLLDDTEALRRAVAAFHMEAIRFRMHSVDRYIKIVGDDAIMRSTFENLRHALETAGFHTRSHSAPEKKS

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
75 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
76 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
77 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
82 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 99.19
Stem 0
Stem Tuber 0
Unclassified 20.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100521694 3300005617 Bacteria 1283
2 Ga0065712_10284029 3300005290 Bacteria 888
3 Ga0065715_10688636 3300005293 Bacteria 659
4 Ga0070683_101931334 3300005329 Unclassified 567
5 Ga0068869_101121861 3300005334 Unclassified 689
6 Ga0070666_10421426 3300005335 Bacteria 961
7 Ga0070680_100945605 3300005336 Bacteria 744
8 Ga0068868_100220517 3300005338 Bacteria 1587
9 Ga0070689_100123751 3300005340 Bacteria 2068
10 Ga0070689_100240639 3300005340 Bacteria 1490
11 Ga0070689_100792648 3300005340 Bacteria 833
12 Ga0070669_100350431 3300005353 Bacteria 1198
13 Ga0070673_101897995 3300005364 Unclassified 565
14 Ga0070688_100185689 3300005365 Bacteria 1445
15 Ga0070688_100695327 3300005365 Bacteria 787
16 Ga0070688_100817394 3300005365 Bacteria 730
17 Ga0070701_10124662 3300005438 Bacteria 1456
18 Ga0070694_100092808 3300005444 Unclassified 2121
19 Ga0070694_100738361 3300005444 Bacteria 803
20 Ga0070694_101506653 3300005444 Unclassified 569
21 Ga0070662_101367021 3300005457 Bacteria 610
22 Ga0068867_100173171 3300005459 Bacteria 1711
23 Ga0068867_100250770 3300005459 Unclassified 1439
24 Ga0068867_101330991 3300005459 Bacteria 664
25 Ga0070684_100590257 3300005535 Unclassified 1032
26 Ga0070672_100663489 3300005543 Bacteria 911
27 Ga0070672_101698489 3300005543 Bacteria 567
28 Ga0070686_100262699 3300005544 Bacteria 1266
29 Ga0070704_102254491 3300005549 Bacteria 506
30 Ga0068857_100564517 3300005577 Bacteria 1073
31 Ga0068856_100914549 3300005614 Unclassified 896
32 Ga0068859_100030514 3300005617 Bacteria 5410
33 Ga0068859_101834052 3300005617 Unclassified 670
34 Ga0068864_100633139 3300005618 Unclassified 1040
35 Ga0068864_100741508 3300005618 Bacteria 962
36 Ga0068866_10378229 3300005718 Bacteria 907
37 Ga0068863_102097529 3300005841 Unclassified 575
38 Ga0068858_100578411 3300005842 Bacteria 1088
39 Ga0068858_100816909 3300005842 Bacteria 910
40 Ga0068860_100345580 3300005843 Bacteria 1463
41 Ga0068862_100352345 3300005844 Unclassified 1366
42 Ga0068862_101428776 3300005844 Bacteria 696
43 Ga0068862_102565568 3300005844 Unclassified 521
44 Ga0097621_100151063 3300006237 Unclassified 1992
45 Ga0097621_100837467 3300006237 Unclassified 854
46 Ga0097621_101103245 3300006237 Bacteria 745
47 Ga0068871_100044743 3300006358 Unclassified 3562
48 Ga0068871_100123301 3300006358 Bacteria 2191
49 Ga0068871_100596339 3300006358 Bacteria 1004
50 Ga0068871_101543132 3300006358 Unclassified 628
51 Ga0075428_100163070 3300006844 Bacteria 2419
52 Ga0075428_100504126 3300006844 Unclassified 1295
53 Ga0075428_100801983 3300006844 Unclassified 1001
54 Ga0075428_101806715 3300006844 Bacteria 636
55 Ga0075430_100161395 3300006846 Bacteria 1865
56 Ga0075433_10230471 3300006852 Bacteria 1645
57 Ga0075429_100143894 3300006880 Bacteria 2087
58 Ga0075429_100917912 3300006880 Unclassified 766
59 Ga0068865_100880614 3300006881 Bacteria 777
60 Ga0068865_101027835 3300006881 Bacteria 723
61 Ga0097620_100030514 3300006931 Bacteria 5410
62 Ga0097620_100521649 3300006931 Bacteria 1283
63 Ga0097620_101833893 3300006931 Unclassified 670
64 Ga0111539_10003334 3300009094 Bacteria 21208
65 Ga0111539_10029758 3300009094 Bacteria 6647
66 Ga0111539_10084118 3300009094 Bacteria 3741
67 Ga0111539_10132503 3300009094 Bacteria 2919
68 Ga0111539_10310208 3300009094 Bacteria 1836
69 Ga0111539_10429176 3300009094 Unclassified 1539
70 Ga0111539_11168605 3300009094 Unclassified 894
71 Ga0105245_11492130 3300009098 Bacteria 727
72 Ga0105245_11782582 3300009098 Bacteria 668
73 Ga0105247_11564862 3300009101 Unclassified 540
74 Ga0114129_10000513 3300009147 Bacteria 47473
75 Ga0114129_12061150 3300009147 Bacteria 689
76 Ga0105243_11593181 3300009148 Bacteria 679
77 Ga0105242_11010934 3300009176 Bacteria 840
78 Ga0105242_11269837 3300009176 Bacteria 759
79 Ga0105248_10020806 3300009177 Bacteria 7268
80 Ga0105248_10277643 3300009177 Bacteria 1886
81 Ga0105248_10693171 3300009177 Unclassified 1149
82 Ga0105248_11516485 3300009177 Bacteria 759
83 Ga0105249_11034044 3300009553 Unclassified 891
84 Ga0163162_11224650 3300013306 Bacteria 852
85 Ga0163162_12309505 3300013306 Bacteria 618
86 Ga0163163_10000103 3300014325 Bacteria 89756
87 Ga0157380_10776282 3300014326 Bacteria 973
88 Ga0157380_13037157 3300014326 Unclassified 535
89 Ga0157379_10490590 3300014968 Bacteria 1138
90 Ga0157376_10875192 3300014969 Bacteria 915
91 Ga0207643_10350753 3300025908 Bacteria 926
92 Ga0207660_10751164 3300025917 Bacteria 796
93 Ga0207681_10475137 3300025923 Bacteria 1020
94 Ga0207670_10058670 3300025936 Bacteria 2615
95 Ga0207670_10100026 3300025936 Bacteria 2070
96 Ga0207670_10724731 3300025936 Unclassified 824
97 Ga0207704_10617942 3300025938 Bacteria 889
98 Ga0207704_11357055 3300025938 Bacteria 609
99 Ga0207691_11759253 3300025940 Bacteria 500
100 Ga0207711_10329496 3300025941 Bacteria 1412
101 Ga0207711_10401070 3300025941 Bacteria 1274
102 Ga0207711_11058400 3300025941 Bacteria 751
103 Ga0207689_10462287 3300025942 Bacteria 1061
104 Ga0207651_11656331 3300025960 Unclassified 576
105 Ga0207712_11307865 3300025961 Bacteria 648
106 Ga0207703_10177574 3300026035 Bacteria 1877
107 Ga0207703_12332993 3300026035 Unclassified 511
108 Ga0207702_11734687 3300026078 Unclassified 617
109 Ga0207641_11777203 3300026088 Unclassified 618
110 Ga0207648_10137797 3300026089 Unclassified 2150
111 Ga0207648_10607559 3300026089 Bacteria 1008
112 Ga0207648_10963902 3300026089 Bacteria 798
113 Ga0207675_101123482 3300026118 Bacteria 806
114 Ga0209983_1084049 3300027665 Unclassified 714
115 Ga0207428_10042574 3300027907 Bacteria 3672
116 Ga0207428_10216709 3300027907 Unclassified 1436
117 Ga0207428_10589022 3300027907 Unclassified 802
118 Ga0207428_11083611 3300027907 Bacteria 560
119 Ga0268265_10297199 3300028380 Bacteria 1452
120 Ga0268265_11858722 3300028380 Bacteria 609
121 Ga0268264_10243451 3300028381 Bacteria 1667
122 Ga0307408_100103564 3300031548 Bacteria 2173
123 Ga0307413_10534695 3300031824 Bacteria 948
124 Ga0307410_10805708 3300031852 Bacteria 799
125 Ga0307416_102018267 3300032002 Bacteria 679
126 Ga0307415_102492960 3300032126 Unclassified 509
127 Ga0373934_0000386 3300035086 Bacteria 15435
128 Ga0373956_0004722 3300035119 Bacteria 5448
129 Ga0373957_0006864 3300035120 Bacteria 3610
130 Ga0316574_0873083 3300035398 Bacteria 545
131 Ga0373935_0548585 3300035692 Bacteria 842
132 Ga0373933_0027967 3300035724 Unclassified 3251
133 Ga0373933_0688866 3300035724 Unclassified 672
134 Ga0373937_0029108 3300036401 Bacteria 5001
135 Ga0373937_0183227 3300036401 Unclassified 1967
136 Ga0439462_0129641 3300042015 Bacteria 704
137 Ga0439462_0239578 3300042015 Unclassified 521
138 Ga0439434_0120592 3300042435 Bacteria 855
139 Ga0451576_0012636 3300045051 Bacteria 9481
140 Ga0495592_0322441 3300046454 Unclassified 998
141 Ga0495651_0123051 3300046462 Unclassified 1903
142 Ga0495651_0232797 3300046462 Bacteria 1268
143 Ga0495653_0424596 3300046463 Bacteria 841
144 Ga0495664_0708025 3300046477 Bacteria 595
145 Ga0495628_0322355 3300046516 Bacteria 1140
146 Ga0495635_0690558 3300046663 Unclassified 662
147 Ga0495599_0088618 3300046678 Bacteria 1932
148 Ga0495599_0392717 3300046678 Unclassified 827
149 Ga0495674_0940154 3300047319 Unclassified 665
150 Ga0495680_0167972 3300047322 Unclassified 1589
151 Ga0495684_0626121 3300047471 Bacteria 723
152 Ga0496102_1165177 3300048905 Unclassified 690
153 Ga0496106_1312356 3300048909 Unclassified 561
154 Ga0496109_2019905 3300048912 Unclassified 508
155 Ga0501031_0037567 3300049568 Bacteria 3160
156 Ga0501031_0113758 3300049568 Bacteria 1767
157 Ga0501031_0120718 3300049568 Bacteria 1712
158 Ga0501031_0282608 3300049568 Bacteria 1076
159 Ga0501031_0653568 3300049568 Unclassified 676
160 Ga0501032_0005473 3300049569 Bacteria 9421
161 Ga0501032_0008193 3300049569 Bacteria 7616
162 Ga0501032_0018400 3300049569 Bacteria 4896
163 Ga0501032_0048344 3300049569 Bacteria 2872
164 Ga0501032_0107316 3300049569 Bacteria 1849
165 Ga0501032_0158117 3300049569 Bacteria 1488
166 Ga0501032_0467765 3300049569 Bacteria 807
167 Ga0501033_0001106 3300049570 Bacteria 24460
168 Ga0501033_0005808 3300049570 Bacteria 9710
169 Ga0501033_0011256 3300049570 Bacteria 6848
170 Ga0501033_0014179 3300049570 Bacteria 6060
171 Ga0501034_0006984 3300049571 Bacteria 12056
172 Ga0501034_0015188 3300049571 Bacteria 7915
173 Ga0501034_0044800 3300049571 Bacteria 4472
174 Ga0501034_0051415 3300049571 Bacteria 4154
175 Ga0501034_0080146 3300049571 Bacteria 3268
176 Ga0501034_0113120 3300049571 Bacteria 2704
177 Ga0501034_0146521 3300049571 Unclassified 2338
178 Ga0501034_0198260 3300049571 Unclassified 1966
179 Ga0501034_0209925 3300049571 Bacteria 1902
180 Ga0501034_0260080 3300049571 Bacteria 1678
181 Ga0501036_0004552 3300049572 Bacteria 11197
182 Ga0501036_0011426 3300049572 Bacteria 7350
183 Ga0501036_0017704 3300049572 Bacteria 5963
184 Ga0501036_0035050 3300049572 Bacteria 4245
185 Ga0501036_0048468 3300049572 Bacteria 3596
186 Ga0501036_0159343 3300049572 Bacteria 1903
187 Ga0501037_0001478 3300049573 Bacteria 17194
188 Ga0501037_0035169 3300049573 Bacteria 3695
189 Ga0501037_0049036 3300049573 Bacteria 3092
190 Ga0501037_0171918 3300049573 Bacteria 1539
191 Ga0501037_0338445 3300049573 Bacteria 1040
192 Ga0501037_0508704 3300049573 Bacteria 816
193 Ga0501038_0003264 3300049574 Bacteria 15128
194 Ga0501038_0006915 3300049574 Bacteria 10475
195 Ga0501038_0026221 3300049574 Bacteria 5191
196 Ga0501038_0026679 3300049574 Bacteria 5143
197 Ga0501038_0034516 3300049574 Bacteria 4446
198 Ga0501038_0259341 3300049574 Bacteria 1374
199 Ga0501038_1093663 3300049574 Bacteria 582
200 Ga0501039_0003783 3300049575 Bacteria 11369
201 Ga0501039_0032788 3300049575 Bacteria 4006
202 Ga0501039_0033027 3300049575 Bacteria 3992
203 Ga0501039_0346392 3300049575 Bacteria 1167
204 Ga0501039_0561729 3300049575 Bacteria 895
205 Ga0501039_0849519 3300049575 Unclassified 711
206 Ga0501040_0426504 3300049576 Bacteria 953
207 Ga0501040_0669917 3300049576 Unclassified 750
208 Ga0501042_0051748 3300049578 Bacteria 2929
209 Ga0501042_0259259 3300049578 Bacteria 1255
210 Ga0501042_0265121 3300049578 Bacteria 1240
211 Ga0501043_0000691 3300049579 Bacteria 29813
212 Ga0501043_0015539 3300049579 Bacteria 5964
213 Ga0501043_0020707 3300049579 Bacteria 5159
214 Ga0501043_0083062 3300049579 Bacteria 2518
215 Ga0501043_0097631 3300049579 Unclassified 2309
216 Ga0501043_0131837 3300049579 Bacteria 1958
217 Ga0501043_0432181 3300049579 Bacteria 991
218 Ga0501043_0502684 3300049579 Bacteria 905
219 Ga0501046_0010895 3300049580 Bacteria 7792
220 Ga0501046_0025995 3300049580 Bacteria 4784
221 Ga0501046_0049921 3300049580 Bacteria 3307
222 Ga0501046_0050011 3300049580 Bacteria 3303
223 Ga0501046_0131460 3300049580 Unclassified 1898
224 Ga0501046_0135894 3300049580 Bacteria 1862
225 Ga0501046_0475097 3300049580 Bacteria 897
226 Ga0501046_1059057 3300049580 Unclassified 561
227 Ga0501047_0003265 3300049581 Bacteria 15382
228 Ga0501047_0021445 3300049581 Bacteria 6203
229 Ga0501047_0028949 3300049581 Bacteria 5342
230 Ga0501047_0033957 3300049581 Bacteria 4924
231 Ga0501047_0221837 3300049581 Unclassified 1746
232 Ga0501047_0415171 3300049581 Bacteria 1177
233 Ga0501047_0532929 3300049581 Bacteria 999
234 Ga0501047_0534198 3300049581 Unclassified 998
235 Ga0501047_0547932 3300049581 Bacteria 981
236 Ga0501047_0967675 3300049581 Bacteria 664
237 Ga0501047_1409077 3300049581 Bacteria 512
238 Ga0501048_0000550 3300049582 Bacteria 26481
239 Ga0501048_0023306 3300049582 Bacteria 4526
240 Ga0501048_0026483 3300049582 Bacteria 4222
241 Ga0501048_0124253 3300049582 Bacteria 1824
242 Ga0501048_0341110 3300049582 Bacteria 1068
243 Ga0501048_0877179 3300049582 Bacteria 645
244 Ga0501067_0001655 3300049583 Bacteria 12246
245 Ga0501067_0002652 3300049583 Bacteria 9905
246 Ga0501067_0010574 3300049583 Bacteria 5107
247 Ga0501067_0018637 3300049583 Bacteria 3843
248 Ga0501067_0188277 3300049583 Bacteria 1149
249 Ga0501067_0189258 3300049583 Bacteria 1146
250 Ga0501068_0001775 3300049584 Bacteria 11471
251 Ga0501068_0010237 3300049584 Bacteria 5264
252 Ga0501068_0010882 3300049584 Bacteria 5119
253 Ga0501068_0376523 3300049584 Unclassified 914
254 Ga0501068_0564176 3300049584 Unclassified 741
255 Ga0501068_1152127 3300049584 Bacteria 513
256 Ga0501069_0001019 3300049585 Bacteria 13361
257 Ga0501069_0005018 3300049585 Bacteria 6867
258 Ga0501069_0051268 3300049585 Bacteria 2296
259 Ga0501069_0056187 3300049585 Bacteria 2192
260 Ga0501069_0061412 3300049585 Unclassified 2098
261 Ga0501070_0039979 3300049586 Bacteria 3911
262 Ga0501070_0053394 3300049586 Bacteria 3352
263 Ga0501070_0234197 3300049586 Bacteria 1504
264 Ga0501070_0240730 3300049586 Unclassified 1481
265 Ga0501070_0555949 3300049586 Bacteria 918
266 Ga0501070_0608479 3300049586 Bacteria 870
267 Ga0501070_1141457 3300049586 Unclassified 600
268 Ga0501071_0004290 3300049587 Bacteria 9034
269 Ga0501071_0568919 3300049587 Bacteria 871
270 Ga0501072_0155536 3300049588 Bacteria 1823
271 Ga0501072_0778580 3300049588 Bacteria 750
272 Ga0501073_0005755 3300049589 Bacteria 9268
273 Ga0501073_0008873 3300049589 Bacteria 7432
274 Ga0501073_0031810 3300049589 Unclassified 3763
275 Ga0501073_0035237 3300049589 Bacteria 3558
276 Ga0501073_0072792 3300049589 Bacteria 2393
277 Ga0501073_0089778 3300049589 Bacteria 2136
278 Ga0501073_0103555 3300049589 Unclassified 1976
279 Ga0501073_0110203 3300049589 Bacteria 1909
280 Ga0501073_0198004 3300049589 Bacteria 1389
281 Ga0501074_0001424 3300049590 Bacteria 15947
282 Ga0501074_0005221 3300049590 Bacteria 9338
283 Ga0501074_0055641 3300049590 Bacteria 2851
284 Ga0501074_0248415 3300049590 Bacteria 1265
285 Ga0501075_0087374 3300049591 Bacteria 2363
286 Ga0501075_0308785 3300049591 Bacteria 1205
287 Ga0501076_0180322 3300049592 Bacteria 1722
288 Ga0501076_0244773 3300049592 Bacteria 1467
289 Ga0501076_0589620 3300049592 Bacteria 917
290 Ga0501076_1662100 3300049592 Bacteria 524
291 Ga0501077_0042922 3300049593 Bacteria 2874
292 Ga0501077_0357207 3300049593 Bacteria 933
293 Ga0501077_0606053 3300049593 Bacteria 703
294 Ga0501079_0003667 3300049741 Bacteria 11314
295 Ga0501079_0012559 3300049741 Bacteria 6467
296 Ga0501079_0077170 3300049741 Bacteria 2577
297 Ga0501079_0189801 3300049741 Bacteria 1603
298 Ga0501079_0190374 3300049741 Bacteria 1601
299 Ga0501079_0205101 3300049741 Bacteria 1540
300 Ga0501079_1112535 3300049741 Bacteria 622
301 Ga0501080_0017391 3300049742 Bacteria 6649
302 Ga0501080_0046391 3300049742 Bacteria 4045
303 Ga0501080_0055853 3300049742 Bacteria 3677
304 Ga0501080_0062099 3300049742 Bacteria 3477
305 Ga0501080_0094676 3300049742 Bacteria 2773
306 Ga0501080_0108520 3300049742 Bacteria 2572
307 Ga0501080_0183347 3300049742 Unclassified 1925
308 Ga0501081_0190802 3300049743 Bacteria 1484
309 Ga0501083_0020155 3300049744 Bacteria 4640
310 Ga0501083_0042074 3300049744 Bacteria 3098
311 Ga0501083_0101446 3300049744 Bacteria 1897
312 Ga0501083_0209323 3300049744 Bacteria 1272
313 Ga0501083_0333459 3300049744 Unclassified 986
314 Ga0501083_1049149 3300049744 Bacteria 530
315 Ga0501035_0029767 3300049822 Bacteria 4979
316 Ga0501035_0045970 3300049822 Bacteria 3927
317 Ga0501035_0052826 3300049822 Bacteria 3635
318 Ga0501035_0053504 3300049822 Bacteria 3609
319 Ga0501035_0112983 3300049822 Bacteria 2379
320 Ga0501035_0456159 3300049822 Bacteria 1057
321 Ga0501035_0568387 3300049822 Bacteria 927
322 Ga0501044_0002430 3300049823 Bacteria 21250
323 Ga0501044_0006408 3300049823 Bacteria 13009
324 Ga0501044_0031761 3300049823 Bacteria 5554
325 Ga0501044_0199691 3300049823 Unclassified 1958
326 Ga0501044_0220955 3300049823 Bacteria 1845
327 Ga0501044_0236185 3300049823 Bacteria 1773
328 Ga0501044_0416358 3300049823 Unclassified 1254
329 Ga0501044_0760463 3300049823 Bacteria 850
330 Ga0501044_0787991 3300049823 Bacteria 830
331 Ga0501044_1372292 3300049823 Unclassified 572
332 Ga0501045_0000936 3300049824 Bacteria 19073
333 Ga0501045_0363296 3300049824 Bacteria 1077
334 Ga0501045_1012000 3300049824 Bacteria 609
335 Ga0501045_1100390 3300049824 Bacteria 581
336 Ga0501045_1122989 3300049824 Bacteria 575
337 nmdc:mga05p37_1678013_c1 3300050507 Bacteria 621
338 nmdc:mga05p37_388_c1 3300050507 Bacteria 39947
339 nmdc:mga0qj67_150490_c1 3300050509 Bacteria 1888
340 nmdc:mga06r32_421243_c1 3300050510 Unclassified 1316
341 nmdc:mga08y16_142177_c1 3300050511 Unclassified 2495
342 nmdc:mga08y16_324935_c1 3300050511 Bacteria 1583
343 nmdc:mga08y16_402972_c1 3300050511 Unclassified 1400
344 nmdc:mga08y16_553836_c1 3300050511 Bacteria 1163
345 nmdc:mga08y16_559222_c1 3300050511 Bacteria 1157
346 nmdc:mga08y16_644941_c1 3300050511 Unclassified 1064
347 nmdc:mga08y16_7588_c1 3300050511 Bacteria 11356
348 Ga0495601_0330529 3300053077 Bacteria 992
349 Ga0495601_0568210 3300053077 Bacteria 729
350 Ga0495595_0373428 3300053084 Bacteria 721
351 Ga0495619_0162274 3300053085 Bacteria 1544
352 Ga0501084_0035426 3300054114 Bacteria 4172
353 Ga0501084_0105205 3300054114 Bacteria 2370
354 Ga0501084_0115669 3300054114 Bacteria 2254
355 Ga0501084_0216900 3300054114 Bacteria 1614
356 Ga0501084_0366626 3300054114 Bacteria 1217
357 Ga0501084_0587850 3300054114 Bacteria 941
358 Ga0501082_0002547 3300060353 Bacteria 15968
359 Ga0501082_0006399 3300060353 Bacteria 10217
360 Ga0501082_0013030 3300060353 Bacteria 7146
361 Ga0501082_0075945 3300060353 Bacteria 2895
362 Ga0501082_0157777 3300060353 Bacteria 1971
363 Ga0501082_0167172 3300060353 Bacteria 1911
364 Ga0501082_0413739 3300060353 Bacteria 1177
365 Ga0501082_0612272 3300060353 Bacteria 953
366 Ga0501082_1115273 3300060353 Bacteria 690
367 Ga0501082_1870577 3300060353 Unclassified 523
368 Ga0530510_0240444 3300061734 Bacteria 1348
369 Ga0530510_0806191 3300061734 Bacteria 716
370 Ga0530510_1318938 3300061734 Bacteria 554
371 Ga0068859_100521694
372 Ga0065712_10284029
373 Ga0065715_10688636
374 Ga0070683_101931334
375 Ga0068869_101121861
376 Ga0070666_10421426
377 Ga0070680_100945605
378 Ga0068868_100220517
379 Ga0070689_100123751
380 Ga0070689_100240639
381 Ga0070689_100792648
382 Ga0070669_100350431
383 Ga0070673_101897995
384 Ga0070688_100185689
385 Ga0070688_100695327
386 Ga0070688_100817394
387 Ga0070701_10124662
388 Ga0070694_100092808
389 Ga0070694_100738361
390 Ga0070694_101506653
391 Ga0070662_101367021
392 Ga0068867_100173171
393 Ga0068867_100250770
394 Ga0068867_101330991
395 Ga0070684_100590257
396 Ga0070672_100663489
397 Ga0070672_101698489
398 Ga0070686_100262699
399 Ga0070704_102254491
400 Ga0068857_100564517
401 Ga0068856_100914549
402 Ga0068859_100030514
403 Ga0068859_101834052
404 Ga0068864_100633139
405 Ga0068864_100741508
406 Ga0068866_10378229
407 Ga0068863_102097529
408 Ga0068858_100578411
409 Ga0068858_100816909
410 Ga0068860_100345580
411 Ga0068862_100352345
412 Ga0068862_101428776
413 Ga0068862_102565568
414 Ga0097621_100151063
415 Ga0097621_100837467
416 Ga0097621_101103245
417 Ga0068871_100044743
418 Ga0068871_100123301
419 Ga0068871_100596339
420 Ga0068871_101543132
421 Ga0075428_100163070
422 Ga0075428_100504126
423 Ga0075428_100801983
424 Ga0075428_101806715
425 Ga0075430_100161395
426 Ga0075433_10230471
427 Ga0075429_100143894
428 Ga0075429_100917912
429 Ga0068865_100880614
430 Ga0068865_101027835
431 Ga0097620_100030514
432 Ga0097620_100521649
433 Ga0097620_101833893
434 Ga0111539_10003334
435 Ga0111539_10029758
436 Ga0111539_10084118
437 Ga0111539_10132503
438 Ga0111539_10310208
439 Ga0111539_10429176
440 Ga0111539_11168605
441 Ga0105245_11492130
442 Ga0105245_11782582
443 Ga0105247_11564862
444 Ga0114129_10000513
445 Ga0114129_12061150
446 Ga0105243_11593181
447 Ga0105242_11010934
448 Ga0105242_11269837
449 Ga0105248_10020806
450 Ga0105248_10277643
451 Ga0105248_10693171
452 Ga0105248_11516485
453 Ga0105249_11034044
454 Ga0163162_11224650
455 Ga0163162_12309505
456 Ga0163163_10000103
457 Ga0157380_10776282
458 Ga0157380_13037157
459 Ga0157379_10490590
460 Ga0157376_10875192
461 Ga0207643_10350753
462 Ga0207660_10751164
463 Ga0207681_10475137
464 Ga0207670_10058670
465 Ga0207670_10100026
466 Ga0207670_10724731
467 Ga0207704_10617942
468 Ga0207704_11357055
469 Ga0207691_11759253
470 Ga0207711_10329496
471 Ga0207711_10401070
472 Ga0207711_11058400
473 Ga0207689_10462287
474 Ga0207651_11656331
475 Ga0207712_11307865
476 Ga0207703_10177574
477 Ga0207703_12332993
478 Ga0207702_11734687
479 Ga0207641_11777203
480 Ga0207648_10137797
481 Ga0207648_10607559
482 Ga0207648_10963902
483 Ga0207675_101123482
484 Ga0209983_1084049
485 Ga0207428_10042574
486 Ga0207428_10216709
487 Ga0207428_10589022
488 Ga0207428_11083611
489 Ga0268265_10297199
490 Ga0268265_11858722
491 Ga0268264_10243451
492 Ga0307408_100103564
493 Ga0307413_10534695
494 Ga0307410_10805708
495 Ga0307416_102018267
496 Ga0307415_102492960
497 Ga0373934_0000386
498 Ga0373956_0004722
499 Ga0373957_0006864
500 Ga0316574_0873083
501 Ga0373935_0548585
502 Ga0373933_0027967
503 Ga0373933_0688866
504 Ga0373937_0029108
505 Ga0373937_0183227
506 Ga0439462_0129641
507 Ga0439462_0239578
508 Ga0439434_0120592
509 Ga0451576_0012636
510 Ga0495592_0322441
511 Ga0495651_0123051
512 Ga0495651_0232797
513 Ga0495653_0424596
514 Ga0495664_0708025
515 Ga0495628_0322355
516 Ga0495635_0690558
517 Ga0495599_0088618
518 Ga0495599_0392717
519 Ga0495674_0940154
520 Ga0495680_0167972
521 Ga0495684_0626121
522 Ga0496102_1165177
523 Ga0496106_1312356
524 Ga0496109_2019905
525 Ga0501031_0037567
526 Ga0501031_0113758
527 Ga0501031_0120718
528 Ga0501031_0282608
529 Ga0501031_0653568
530 Ga0501032_0005473
531 Ga0501032_0008193
532 Ga0501032_0018400
533 Ga0501032_0048344
534 Ga0501032_0107316
535 Ga0501032_0158117
536 Ga0501032_0467765
537 Ga0501033_0001106
538 Ga0501033_0005808
539 Ga0501033_0011256
540 Ga0501033_0014179
541 Ga0501034_0006984
542 Ga0501034_0015188
543 Ga0501034_0044800
544 Ga0501034_0051415
545 Ga0501034_0080146
546 Ga0501034_0113120
547 Ga0501034_0146521
548 Ga0501034_0198260
549 Ga0501034_0209925
550 Ga0501034_0260080
551 Ga0501036_0004552
552 Ga0501036_0011426
553 Ga0501036_0017704
554 Ga0501036_0035050
555 Ga0501036_0048468
556 Ga0501036_0159343
557 Ga0501037_0001478
558 Ga0501037_0035169
559 Ga0501037_0049036
560 Ga0501037_0171918
561 Ga0501037_0338445
562 Ga0501037_0508704
563 Ga0501038_0003264
564 Ga0501038_0006915
565 Ga0501038_0026221
566 Ga0501038_0026679
567 Ga0501038_0034516
568 Ga0501038_0259341
569 Ga0501038_1093663
570 Ga0501039_0003783
571 Ga0501039_0032788
572 Ga0501039_0033027
573 Ga0501039_0346392
574 Ga0501039_0561729
575 Ga0501039_0849519
576 Ga0501040_0426504
577 Ga0501040_0669917
578 Ga0501042_0051748
579 Ga0501042_0259259
580 Ga0501042_0265121
581 Ga0501043_0000691
582 Ga0501043_0015539
583 Ga0501043_0020707
584 Ga0501043_0083062
585 Ga0501043_0097631
586 Ga0501043_0131837
587 Ga0501043_0432181
588 Ga0501043_0502684
589 Ga0501046_0010895
590 Ga0501046_0025995
591 Ga0501046_0049921
592 Ga0501046_0050011
593 Ga0501046_0131460
594 Ga0501046_0135894
595 Ga0501046_0475097
596 Ga0501046_1059057
597 Ga0501047_0003265
598 Ga0501047_0021445
599 Ga0501047_0028949
600 Ga0501047_0033957
601 Ga0501047_0221837
602 Ga0501047_0415171
603 Ga0501047_0532929
604 Ga0501047_0534198
605 Ga0501047_0547932
606 Ga0501047_0967675
607 Ga0501047_1409077
608 Ga0501048_0000550
609 Ga0501048_0023306
610 Ga0501048_0026483
611 Ga0501048_0124253
612 Ga0501048_0341110
613 Ga0501048_0877179
614 Ga0501067_0001655
615 Ga0501067_0002652
616 Ga0501067_0010574
617 Ga0501067_0018637
618 Ga0501067_0188277
619 Ga0501067_0189258
620 Ga0501068_0001775
621 Ga0501068_0010237
622 Ga0501068_0010882
623 Ga0501068_0376523
624 Ga0501068_0564176
625 Ga0501068_1152127
626 Ga0501069_0001019
627 Ga0501069_0005018
628 Ga0501069_0051268
629 Ga0501069_0056187
630 Ga0501069_0061412
631 Ga0501070_0039979
632 Ga0501070_0053394
633 Ga0501070_0234197
634 Ga0501070_0240730
635 Ga0501070_0555949
636 Ga0501070_0608479
637 Ga0501070_1141457
638 Ga0501071_0004290
639 Ga0501071_0568919
640 Ga0501072_0155536
641 Ga0501072_0778580
642 Ga0501073_0005755
643 Ga0501073_0008873
644 Ga0501073_0031810
645 Ga0501073_0035237
646 Ga0501073_0072792
647 Ga0501073_0089778
648 Ga0501073_0103555
649 Ga0501073_0110203
650 Ga0501073_0198004
651 Ga0501074_0001424
652 Ga0501074_0005221
653 Ga0501074_0055641
654 Ga0501074_0248415
655 Ga0501075_0087374
656 Ga0501075_0308785
657 Ga0501076_0180322
658 Ga0501076_0244773
659 Ga0501076_0589620
660 Ga0501076_1662100
661 Ga0501077_0042922
662 Ga0501077_0357207
663 Ga0501077_0606053
664 Ga0501079_0003667
665 Ga0501079_0012559
666 Ga0501079_0077170
667 Ga0501079_0189801
668 Ga0501079_0190374
669 Ga0501079_0205101
670 Ga0501079_1112535
671 Ga0501080_0017391
672 Ga0501080_0046391
673 Ga0501080_0055853
674 Ga0501080_0062099
675 Ga0501080_0094676
676 Ga0501080_0108520
677 Ga0501080_0183347
678 Ga0501081_0190802
679 Ga0501083_0020155
680 Ga0501083_0042074
681 Ga0501083_0101446
682 Ga0501083_0209323
683 Ga0501083_0333459
684 Ga0501083_1049149
685 Ga0501035_0029767
686 Ga0501035_0045970
687 Ga0501035_0052826
688 Ga0501035_0053504
689 Ga0501035_0112983
690 Ga0501035_0456159
691 Ga0501035_0568387
692 Ga0501044_0002430
693 Ga0501044_0006408
694 Ga0501044_0031761
695 Ga0501044_0199691
696 Ga0501044_0220955
697 Ga0501044_0236185
698 Ga0501044_0416358
699 Ga0501044_0760463
700 Ga0501044_0787991
701 Ga0501044_1372292
702 Ga0501045_0000936
703 Ga0501045_0363296
704 Ga0501045_1012000
705 Ga0501045_1100390
706 Ga0501045_1122989
707 nmdc:mga05p37_1678013_c1
708 nmdc:mga05p37_388_c1
709 nmdc:mga0qj67_150490_c1
710 nmdc:mga06r32_421243_c1
711 nmdc:mga08y16_142177_c1
712 nmdc:mga08y16_324935_c1
713 nmdc:mga08y16_402972_c1
714 nmdc:mga08y16_553836_c1
715 nmdc:mga08y16_559222_c1
716 nmdc:mga08y16_644941_c1
717 nmdc:mga08y16_7588_c1
718 Ga0495601_0330529
719 Ga0495601_0568210
720 Ga0495595_0373428
721 Ga0495619_0162274
722 Ga0501084_0035426
723 Ga0501084_0105205
724 Ga0501084_0115669
725 Ga0501084_0216900
726 Ga0501084_0366626
727 Ga0501084_0587850
728 Ga0501082_0002547
729 Ga0501082_0006399
730 Ga0501082_0013030
731 Ga0501082_0075945
732 Ga0501082_0157777
733 Ga0501082_0167172
734 Ga0501082_0413739
735 Ga0501082_0612272
736 Ga0501082_1115273
737 Ga0501082_1870577
738 Ga0530510_0240444
739 Ga0530510_0806191
740 Ga0530510_1318938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bbh-assembly1.cif.gz_A atomic structure of a cytochrome c' with an unusual ligand-controlled dimer dissociation at 1.8 angstroms resolution 0.886 31 67
2ip6-assembly1.cif.gz_A crystal structure of pedb 0.7752 8 85
2gsc-assembly1.cif.gz_C crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.7526 12 88
2w2u-assembly1.cif.gz_A structural insight into the interaction between archaeal escrt-iii and aaa-atpase 0.746 28 88
2rld-assembly1.cif.gz_D crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.7372 6 87
ID Description Score Start End Superfamily
1bbhA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.886 31 67 1.20.120.10
af_F4JCN4_107_270_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.845 5 87 1.20.140.40
af_A0A096MJU8_302_365_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8092 30 85 1.25.40.10
af_Q10T67_23_176_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.8086 5 87 1.20.140.40
af_Q96AY4_908_1032_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7999 29 88 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2W4S7L2-F1-model_v4 Uncharacterized protein 0.9572 8 97
AF-A0A2W4S7L2-F1-model_v4 Uncharacterized protein 0.9171 8 97
AF-A0A3N5H987-F1-model_v4 Uncharacterized protein 0.9069 8 89
AF-A0A3N5NTR3-F1-model_v4 Uncharacterized protein 0.8979 5 89
AF-A0A7Z9W0L2-F1-model_v4 Uncharacterized protein 0.8843 3 92

Map