F425307

General Info

Members Datasets Scaffolds Average Seq Length
370 188 740 185

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10707095|Ga0070681_107070951
Length 212
Sequence VAEQAGNRAAALKPLRVSEPTFSKGDLGMKRKSIGVIVFVGLFLSVLVALALAAQDKYTVKVPNGLSFSEFRGYEAWQVVSISQDGNLIAAILANPVMIQAYMAGVPGNGKPFPDGAKMAKIHWNPKKMDVFPAATVPGTQHDVDFMVKDTKRFADSGGWGYAVFEYDAPSDTFKPGTLAGKPPQGNDAKCGFACHTMVKTRDYVFTDYGHR

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 1.08
Rhizosphere 95.14
Stem 0
Stem Tuber 0
Unclassified 1.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10707095 3300005458 Bacteria 923
2 Ga0070658_10039379 3300005327 Bacteria 3813
3 Ga0070683_100008441 3300005329 Bacteria 8752
4 Ga0070690_100054884 3300005330 Bacteria 2551
5 Ga0070670_100092838 3300005331 Bacteria 2596
6 Ga0068869_100429118 3300005334 Bacteria 1092
7 Ga0070666_10004422 3300005335 Bacteria 8560
8 Ga0070666_10072034 3300005335 Bacteria 2352
9 Ga0068868_100007636 3300005338 Bacteria 7712
10 Ga0070660_100239418 3300005339 Bacteria 1478
11 Ga0070689_100054752 3300005340 Bacteria 3089
12 Ga0070661_100015904 3300005344 Bacteria 5309
13 Ga0070661_100125509 3300005344 Bacteria 1925
14 Ga0070668_100044699 3300005347 Bacteria 3397
15 Ga0070671_100020649 3300005355 Bacteria 5374
16 Ga0070674_100092161 3300005356 Bacteria 2190
17 Ga0070673_100025509 3300005364 Bacteria 4352
18 Ga0070673_100224093 3300005364 Bacteria 1628
19 Ga0070673_100285406 3300005364 Bacteria 1449
20 Ga0070659_100079243 3300005366 Bacteria 2622
21 Ga0070667_100021524 3300005367 Bacteria 5353
22 Ga0070667_100052460 3300005367 Bacteria 3441
23 Ga0070667_100058151 3300005367 Bacteria 3268
24 Ga0070667_100096457 3300005367 Bacteria 2550
25 Ga0070709_10141704 3300005434 Bacteria 1652
26 Ga0070714_100436290 3300005435 Bacteria 1242
27 Ga0070713_100001213 3300005436 Bacteria 16464
28 Ga0070711_100050877 3300005439 Bacteria 2843
29 Ga0070662_100020778 3300005457 Bacteria 4477
30 Ga0070681_10352561 3300005458 Bacteria 1382
31 Ga0068867_100026088 3300005459 Bacteria 4194
32 Ga0068867_100357988 3300005459 Bacteria 1220
33 Ga0070706_100279557 3300005467 Bacteria 1558
34 Ga0070679_100063312 3300005530 Bacteria 3687
35 Ga0070679_100714821 3300005530 Bacteria 945
36 Ga0070684_100312617 3300005535 Bacteria 1443
37 Ga0070684_100435635 3300005535 Bacteria 1211
38 Ga0068853_100116158 3300005539 Bacteria 2382
39 Ga0068853_100160485 3300005539 Bacteria 2028
40 Ga0068853_100483705 3300005539 Bacteria 1167
41 Ga0068853_100673618 3300005539 Bacteria 985
42 Ga0070695_100207089 3300005545 Bacteria 1405
43 Ga0070693_100208455 3300005547 Bacteria 1274
44 Ga0070665_100061055 3300005548 Bacteria 3778
45 Ga0070665_100075836 3300005548 Bacteria 3370
46 Ga0070665_100513158 3300005548 Bacteria 1210
47 Ga0070665_100623617 3300005548 Bacteria 1091
48 Ga0068855_100074846 3300005563 Bacteria 3932
49 Ga0068855_100172762 3300005563 Bacteria 2447
50 Ga0068855_100256745 3300005563 Bacteria 1948
51 Ga0068855_100354627 3300005563 Bacteria 1615
52 Ga0070664_100117555 3300005564 Bacteria 2325
53 Ga0070664_100243832 3300005564 Bacteria 1614
54 Ga0068857_100036636 3300005577 Bacteria 4347
55 Ga0068854_100017595 3300005578 Bacteria 4784
56 Ga0068854_100153603 3300005578 Bacteria 1777
57 Ga0068854_100182258 3300005578 Bacteria 1641
58 Ga0068856_100082384 3300005614 Bacteria 3193
59 Ga0068856_100223016 3300005614 Bacteria 1900
60 Ga0068856_100378906 3300005614 Bacteria 1434
61 Ga0068852_100094995 3300005616 Bacteria 2676
62 Ga0068859_100000750 3300005617 Bacteria 32728
63 Ga0068859_100997296 3300005617 Bacteria 920
64 Ga0068864_100117208 3300005618 Bacteria 2377
65 Ga0068864_100142356 3300005618 Bacteria 2164
66 Ga0068866_10337253 3300005718 Bacteria 954
67 Ga0068866_10570141 3300005718 Bacteria 760
68 Ga0068851_10114489 3300005834 Bacteria 1443
69 Ga0068863_100063387 3300005841 Bacteria 3496
70 Ga0068863_100098749 3300005841 Bacteria 2773
71 Ga0068863_100129677 3300005841 Unclassified 2407
72 Ga0068863_100134343 3300005841 Bacteria 2363
73 Ga0068863_101843495 3300005841 Bacteria 615
74 Ga0068858_100046916 3300005842 Bacteria 4005
75 Ga0068858_100377825 3300005842 Bacteria 1359
76 Ga0068858_100741076 3300005842 Bacteria 957
77 Ga0068860_100016517 3300005843 Bacteria 7199
78 Ga0068860_100116499 3300005843 Unclassified 2556
79 Ga0068860_100452998 3300005843 Bacteria 1276
80 Ga0068862_100002516 3300005844 Bacteria 16214
81 Ga0070712_100357354 3300006175 Bacteria 1197
82 Ga0070712_100405169 3300006175 Bacteria 1127
83 Ga0097621_100028334 3300006237 Bacteria 4414
84 Ga0097621_100030786 3300006237 Bacteria 4252
85 Ga0097621_100040446 3300006237 Bacteria 3748
86 Ga0097621_100047515 3300006237 Bacteria 3479
87 Ga0097621_100048102 3300006237 Bacteria 3459
88 Ga0097621_100049345 3300006237 Bacteria 3419
89 Ga0097621_100079269 3300006237 Bacteria 2730
90 Ga0097621_100113796 3300006237 Bacteria 2288
91 Ga0097621_100312128 3300006237 Bacteria 1391
92 Ga0068871_100020249 3300006358 Bacteria 5093
93 Ga0068871_100026270 3300006358 Bacteria 4541
94 Ga0068871_100029054 3300006358 Bacteria 4340
95 Ga0068871_100073793 3300006358 Bacteria 2813
96 Ga0068871_100146511 3300006358 Bacteria 2011
97 Ga0068871_100226395 3300006358 Bacteria 1622
98 Ga0068871_100383508 3300006358 Bacteria 1249
99 Ga0075433_10003229 3300006852 Bacteria 12584
100 Ga0068865_100030951 3300006881 Bacteria 3563
101 Ga0068865_100150797 3300006881 Bacteria 1763
102 Ga0075436_100005768 3300006914 Bacteria 8512
103 Ga0097620_100000750 3300006931 Bacteria 32728
104 Ga0097620_100997354 3300006931 Bacteria 920
105 Ga0097620_101787197 3300006931 Bacteria 679
106 Ga0105240_10237922 3300009093 Bacteria 2112
107 Ga0105240_10754159 3300009093 Bacteria 1058
108 Ga0105245_10013010 3300009098 Bacteria 7253
109 Ga0105245_10015440 3300009098 Bacteria 6658
110 Ga0105245_10243795 3300009098 Bacteria 1743
111 Ga0105245_10256690 3300009098 Bacteria 1700
112 Ga0105247_10046039 3300009101 Bacteria 2677
113 Ga0105247_10063411 3300009101 Bacteria 2294
114 Ga0105241_10235124 3300009174 Bacteria 1546
115 Ga0105241_10353299 3300009174 Bacteria 1277
116 Ga0105241_10594181 3300009174 Bacteria 999
117 Ga0105242_10007611 3300009176 Bacteria 8338
118 Ga0105242_10112704 3300009176 Bacteria 2322
119 Ga0105242_10216852 3300009176 Bacteria 1708
120 Ga0105242_10334651 3300009176 Bacteria 1393
121 Ga0105248_10004954 3300009177 Bacteria 14715
122 Ga0105248_10018766 3300009177 Bacteria 7648
123 Ga0105248_10046353 3300009177 Bacteria 4872
124 Ga0105248_10734774 3300009177 Bacteria 1114
125 Ga0105237_10031955 3300009545 Bacteria 5331
126 Ga0105237_10035580 3300009545 Bacteria 5039
127 Ga0105237_10167333 3300009545 Bacteria 2198
128 Ga0105237_10196831 3300009545 Bacteria 2015
129 Ga0105237_10300141 3300009545 Bacteria 1609
130 Ga0105237_10603133 3300009545 Bacteria 1105
131 Ga0105238_10030173 3300009551 Bacteria 5518
132 Ga0105238_10045130 3300009551 Bacteria 4452
133 Ga0105238_10256861 3300009551 Bacteria 1727
134 Ga0105238_10529797 3300009551 Bacteria 1181
135 Ga0105238_10883798 3300009551 Bacteria 912
136 Ga0105238_10990873 3300009551 Bacteria 861
137 Ga0105249_10016546 3300009553 Bacteria 6544
138 Ga0105239_10025296 3300010375 Bacteria 6537
139 Ga0105239_10042269 3300010375 Bacteria 4995
140 Ga0105239_10069013 3300010375 Bacteria 3884
141 Ga0105239_10097312 3300010375 Bacteria 3252
142 Ga0105239_10743010 3300010375 Bacteria 1123
143 Ga0105239_11432455 3300010375 Bacteria 798
144 Ga0105246_10394597 3300011119 Bacteria 1147
145 Ga0157369_10665099 3300013105 Bacteria 1073
146 Ga0157374_10003249 3300013296 Bacteria 13648
147 Ga0157374_10144784 3300013296 Bacteria 2308
148 Ga0157374_10353134 3300013296 Bacteria 1461
149 Ga0157378_10019368 3300013297 Bacteria 5983
150 Ga0157378_10928109 3300013297 Bacteria 902
151 Ga0163162_10029045 3300013306 Bacteria 5473
152 Ga0163162_10048926 3300013306 Bacteria 4237
153 Ga0163162_10070379 3300013306 Bacteria 3550
154 Ga0163162_10786245 3300013306 Bacteria 1070
155 Ga0157372_10041842 3300013307 Bacteria 5066
156 Ga0157372_11220844 3300013307 Bacteria 869
157 Ga0157375_10514090 3300013308 Bacteria 1361
158 Ga0157375_10800243 3300013308 Bacteria 1091
159 Ga0163163_10031009 3300014325 Bacteria 5156
160 Ga0163163_10041346 3300014325 Bacteria 4507
161 Ga0163163_10844460 3300014325 Bacteria 979
162 Ga0157379_10100137 3300014968 Bacteria 2602
163 Ga0157379_10118237 3300014968 Bacteria 2384
164 Ga0157379_10193610 3300014968 Bacteria 1837
165 Ga0157376_10003739 3300014969 Bacteria 10519
166 Ga0157376_10081749 3300014969 Bacteria 2774
167 Ga0157376_10177553 3300014969 Bacteria 1944
168 Ga0157376_10729514 3300014969 Bacteria 998
169 Ga0157376_11020647 3300014969 Bacteria 850
170 Ga0213873_10000471 3300021358 Bacteria 6472
171 Ga0213872_10016235 3300021361 Unclassified 3457
172 Ga0213874_10014207 3300021377 Unclassified 2077
173 Ga0213875_10082102 3300021388 Bacteria 1504
174 Ga0213871_10003523 3300021441 Bacteria 3028
175 Ga0213871_10013365 3300021441 Unclassified 1927
176 Ga0207656_10277196 3300025321 Bacteria 826
177 Ga0207692_10097479 3300025898 Bacteria 1607
178 Ga0207642_10457836 3300025899 Bacteria 774
179 Ga0207710_10150354 3300025900 Bacteria 1129
180 Ga0207680_10003135 3300025903 Bacteria 7762
181 Ga0207680_10130686 3300025903 Bacteria 1655
182 Ga0207680_10714878 3300025903 Bacteria 718
183 Ga0207647_10299344 3300025904 Bacteria 916
184 Ga0207684_10298989 3300025910 Bacteria 1388
185 Ga0207654_10371923 3300025911 Bacteria 988
186 Ga0207707_10135573 3300025912 Bacteria 2152
187 Ga0207707_10315573 3300025912 Bacteria 1350
188 Ga0207695_10011058 3300025913 Bacteria 10965
189 Ga0207671_10088234 3300025914 Bacteria 2333
190 Ga0207671_10188074 3300025914 Bacteria 1609
191 Ga0207671_10261250 3300025914 Bacteria 1363
192 Ga0207693_10155143 3300025915 Bacteria 1801
193 Ga0207693_10371924 3300025915 Bacteria 1118
194 Ga0207663_10031645 3300025916 Bacteria 3133
195 Ga0207660_10375168 3300025917 Bacteria 1143
196 Ga0207649_10183150 3300025920 Bacteria 1467
197 Ga0207649_10583666 3300025920 Bacteria 858
198 Ga0207652_10061432 3300025921 Bacteria 3244
199 Ga0207652_10580845 3300025921 Bacteria 1006
200 Ga0207694_10054460 3300025924 Bacteria 3103
201 Ga0207694_10411818 3300025924 Bacteria 1125
202 Ga0207650_10177902 3300025925 Bacteria 1694
203 Ga0207687_10003502 3300025927 Bacteria 10559
204 Ga0207687_10041837 3300025927 Bacteria 3149
205 Ga0207687_10193413 3300025927 Bacteria 1585
206 Ga0207687_10207341 3300025927 Bacteria 1536
207 Ga0207687_10629354 3300025927 Bacteria 906
208 Ga0207700_10001814 3300025928 Bacteria 12133
209 Ga0207700_10231324 3300025928 Bacteria 1572
210 Ga0207664_10170156 3300025929 Bacteria 1864
211 Ga0207644_10819840 3300025931 Bacteria 778
212 Ga0207706_10046138 3300025933 Bacteria 3858
213 Ga0207686_10036308 3300025934 Bacteria 2966
214 Ga0207686_10050008 3300025934 Bacteria 2598
215 Ga0207686_10050068 3300025934 Bacteria 2596
216 Ga0207709_10190900 3300025935 Bacteria 1455
217 Ga0207670_10058182 3300025936 Bacteria 2625
218 Ga0207670_10582950 3300025936 Bacteria 917
219 Ga0207669_10119381 3300025937 Bacteria 1786
220 Ga0207704_10043542 3300025938 Bacteria 2652
221 Ga0207704_10084571 3300025938 Bacteria 2062
222 Ga0207704_10252358 3300025938 Bacteria 1325
223 Ga0207691_10558868 3300025940 Bacteria 970
224 Ga0207711_10010830 3300025941 Bacteria 7579
225 Ga0207711_10035466 3300025941 Bacteria 4228
226 Ga0207711_10494172 3300025941 Bacteria 1140
227 Ga0207689_10619168 3300025942 Bacteria 911
228 Ga0207689_10881881 3300025942 Bacteria 755
229 Ga0207661_10053278 3300025944 Bacteria 3237
230 Ga0207661_10473258 3300025944 Bacteria 1143
231 Ga0207679_10047160 3300025945 Bacteria 3128
232 Ga0207679_10461449 3300025945 Bacteria 1128
233 Ga0207667_10326690 3300025949 Bacteria 1566
234 Ga0207651_10066949 3300025960 Bacteria 2526
235 Ga0207651_10181508 3300025960 Bacteria 1670
236 Ga0207651_10318485 3300025960 Bacteria 1299
237 Ga0207651_10527870 3300025960 Bacteria 1024
238 Ga0207712_10024359 3300025961 Bacteria 4006
239 Ga0207668_10131031 3300025972 Bacteria 1914
240 Ga0207640_10482085 3300025981 Bacteria 1029
241 Ga0207640_10695572 3300025981 Bacteria 871
242 Ga0207658_10120578 3300025986 Bacteria 2090
243 Ga0207658_10133154 3300025986 Unclassified 2000
244 Ga0207658_10850426 3300025986 Bacteria 829
245 Ga0207677_10249840 3300026023 Bacteria 1440
246 Ga0207703_10035598 3300026035 Bacteria 3956
247 Ga0207703_10348793 3300026035 Bacteria 1362
248 Ga0207639_10137414 3300026041 Bacteria 2032
249 Ga0207639_10466051 3300026041 Bacteria 1149
250 Ga0207678_10090339 3300026067 Bacteria 2618
251 Ga0207702_10053188 3300026078 Bacteria 3427
252 Ga0207702_10447841 3300026078 Bacteria 1252
253 Ga0207641_10014957 3300026088 Bacteria 6362
254 Ga0207641_10063988 3300026088 Bacteria 3143
255 Ga0207641_10353231 3300026088 Bacteria 1401
256 Ga0207641_10368840 3300026088 Bacteria 1372
257 Ga0207648_10020658 3300026089 Bacteria 5927
258 Ga0207648_10048962 3300026089 Bacteria 3700
259 Ga0207676_10212301 3300026095 Bacteria 1718
260 Ga0207674_10040490 3300026116 Bacteria 4826
261 Ga0207675_100243399 3300026118 Bacteria 1739
262 Ga0207698_10286542 3300026142 Bacteria 1526
263 Ga0207698_10660879 3300026142 Bacteria 1036
264 Ga0207698_11265953 3300026142 Bacteria 752
265 Ga0268266_10000072 3300028379 Bacteria 232245
266 Ga0268266_10056712 3300028379 Bacteria 3370
267 Ga0268266_10121310 3300028379 Bacteria 2327
268 Ga0268266_10805902 3300028379 Bacteria 907
269 Ga0268266_11153460 3300028379 Bacteria 749
270 Ga0268265_10000351 3300028380 Bacteria 49884
271 Ga0268264_10006943 3300028381 Bacteria 9500
272 Ga0268264_10010463 3300028381 Bacteria 7669
273 Ga0268264_10813272 3300028381 Bacteria 934
274 Ga0268264_10902838 3300028381 Bacteria 887
275 Ga0265338_10295646 3300028800 Bacteria 1179
276 Ga0265330_10080455 3300031235 Bacteria 1404
277 Ga0265325_10184215 3300031241 Bacteria 971
278 Ga0265331_10199661 3300031250 Bacteria 901
279 Ga0265313_10102343 3300031595 Bacteria 1270
280 Ga0265314_10012479 3300031711 Bacteria 6930
281 Ga0265314_10014757 3300031711 Bacteria 6231
282 Ga0373934_0069487 3300035086 Bacteria 1407
283 Ga0373923_0206456 3300035111 Bacteria 909
284 Ga0373954_0153079 3300035118 Bacteria 1127
285 Ga0373956_0026793 3300035119 Bacteria 2498
286 Ga0373956_0053013 3300035119 Bacteria 1825
287 Ga0373943_0144768 3300035170 Bacteria 1283
288 Ga0373946_0094877 3300035171 Bacteria 1328
289 Ga0373946_0228158 3300035171 Bacteria 901
290 Ga0373955_0012186 3300035172 Bacteria 4128
291 Ga0373955_0056278 3300035172 Bacteria 2157
292 Ga0373955_0078376 3300035172 Bacteria 1862
293 Ga0373935_0100764 3300035692 Bacteria 1904
294 Ga0373935_0118176 3300035692 Bacteria 1768
295 Ga0373927_0003189 3300035695 Bacteria 11820
296 Ga0373927_0258324 3300035695 Bacteria 1145
297 Ga0373933_0002784 3300035724 Bacteria 9759
298 Ga0373933_0155001 3300035724 Bacteria 1452
299 Ga0373933_0156016 3300035724 Bacteria 1448
300 Ga0373933_0361658 3300035724 Bacteria 944
301 Ga0373947_0081553 3300035725 Bacteria 2003
302 Ga0373937_0000015 3300036401 Bacteria 148228
303 Ga0373937_0006101 3300036401 Bacteria 10372
304 Ga0373937_0026284 3300036401 Bacteria 5260
305 Ga0373937_0104444 3300036401 Bacteria 2632
306 Ga0373937_0303840 3300036401 Bacteria 1508
307 Ga0373937_0343594 3300036401 Bacteria 1413
308 Ga0373937_0495835 3300036401 Bacteria 1160
309 Ga0373925_0072853 3300037068 Bacteria 2599
310 Ga0373925_0177331 3300037068 Bacteria 1685
311 Ga0373925_0539136 3300037068 Bacteria 959
312 Ga0436364_0872169 3300037853 Bacteria 3374
313 Ga0436364_1158525 3300037853 Bacteria 1717
314 Ga0436365_0208922 3300039437 Bacteria 715
315 Ga0436365_0875459 3300039437 Bacteria 1220
316 Ga0436365_0981587 3300039437 Bacteria 1209
317 Ga0436365_1507061 3300039437 Bacteria 1910
318 Ga0436360_0668250 3300039438 Bacteria 823
319 Ga0436360_0789144 3300039438 Bacteria 3607
320 Ga0436360_0851767 3300039438 Bacteria 5049
321 Ga0436360_1037982 3300039438 Bacteria 2380
322 Ga0436361_0607397 3300039447 Bacteria 7180
323 Ga0436363_0211820 3300039450 Unclassified 3751
324 Ga0436363_1331510 3300039450 Bacteria 705
325 Ga0436363_1544230 3300039450 Bacteria 1294
326 Ga0436363_1603563 3300039450 Bacteria 1057
327 Ga0436362_0141308 3300039453 Bacteria 1991
328 Ga0436362_0390427 3300039453 Bacteria 9812
329 Ga0436362_1101245 3300039453 Bacteria 1251
330 Ga0495592_0582262 3300046454 Bacteria 684
331 Ga0495629_0327013 3300046459 Bacteria 1048
332 Ga0495651_0026872 3300046462 Bacteria 4482
333 Ga0495653_0051926 3300046463 Bacteria 3145
334 Ga0495580_0046934 3300046472 Bacteria 3063
335 Ga0495664_0062371 3300046477 Bacteria 2220
336 Ga0495594_0413455 3300046499 Bacteria 767
337 Ga0495630_0421167 3300046517 Bacteria 1023
338 Ga0495665_0143459 3300046531 Bacteria 1247
339 Ga0495586_0306983 3300046535 Bacteria 909
340 Ga0495587_0000219 3300046536 Bacteria 42459
341 Ga0495587_0005988 3300046536 Bacteria 7928
342 Ga0495587_0264666 3300046536 Bacteria 965
343 Ga0495645_0080592 3300046543 Bacteria 2336
344 Ga0495645_0373769 3300046543 Bacteria 913
345 Ga0495667_0337968 3300046559 Bacteria 952
346 Ga0495635_0285445 3300046663 Bacteria 1108
347 Ga0495588_0362971 3300046674 Bacteria 761
348 Ga0495623_0017841 3300046679 Bacteria 4584
349 Ga0495623_0487902 3300046679 Bacteria 652
350 Ga0495646_0400156 3300046680 Bacteria 714
351 Ga0495613_0011389 3300046689 Bacteria 6609
352 Ga0495581_0275884 3300047315 Bacteria 983
353 Ga0495604_0048369 3300047317 Bacteria 3308
354 Ga0495674_0154318 3300047319 Bacteria 1924
355 Ga0495674_0656817 3300047319 Bacteria 826
356 Ga0495675_0001097 3300047444 Bacteria 16431
357 Ga0495684_0539198 3300047471 Bacteria 796
358 Ga0495684_0575394 3300047471 Bacteria 763
359 Ga0495602_0000206 3300048088 Bacteria 54913
360 Ga0495602_0004017 3300048088 Bacteria 15324
361 Ga0496105_0494425 3300048908 Bacteria 961
362 Ga0496112_1162282 3300048915 Bacteria 689
363 Ga0496114_0501869 3300048917 Bacteria 1073
364 Ga0496115_0000113 3300048918 Bacteria 74536
365 Ga0496126_0000226 3300048929 Bacteria 122150
366 Ga0501043_0506507 3300049579 Bacteria 901
367 nmdc:mga08x19_28163_c1 3300050514 Bacteria 3517
368 nmdc:mga0a205_24469_c1 3300050515 Bacteria 5744
369 Ga0495619_0127432 3300053085 Bacteria 1748
370 Ga0500636_0065059 3300053177 Bacteria 2123
371 Ga0070681_10707095
372 Ga0070658_10039379
373 Ga0070683_100008441
374 Ga0070690_100054884
375 Ga0070670_100092838
376 Ga0068869_100429118
377 Ga0070666_10004422
378 Ga0070666_10072034
379 Ga0068868_100007636
380 Ga0070660_100239418
381 Ga0070689_100054752
382 Ga0070661_100015904
383 Ga0070661_100125509
384 Ga0070668_100044699
385 Ga0070671_100020649
386 Ga0070674_100092161
387 Ga0070673_100025509
388 Ga0070673_100224093
389 Ga0070673_100285406
390 Ga0070659_100079243
391 Ga0070667_100021524
392 Ga0070667_100052460
393 Ga0070667_100058151
394 Ga0070667_100096457
395 Ga0070709_10141704
396 Ga0070714_100436290
397 Ga0070713_100001213
398 Ga0070711_100050877
399 Ga0070662_100020778
400 Ga0070681_10352561
401 Ga0068867_100026088
402 Ga0068867_100357988
403 Ga0070706_100279557
404 Ga0070679_100063312
405 Ga0070679_100714821
406 Ga0070684_100312617
407 Ga0070684_100435635
408 Ga0068853_100116158
409 Ga0068853_100160485
410 Ga0068853_100483705
411 Ga0068853_100673618
412 Ga0070695_100207089
413 Ga0070693_100208455
414 Ga0070665_100061055
415 Ga0070665_100075836
416 Ga0070665_100513158
417 Ga0070665_100623617
418 Ga0068855_100074846
419 Ga0068855_100172762
420 Ga0068855_100256745
421 Ga0068855_100354627
422 Ga0070664_100117555
423 Ga0070664_100243832
424 Ga0068857_100036636
425 Ga0068854_100017595
426 Ga0068854_100153603
427 Ga0068854_100182258
428 Ga0068856_100082384
429 Ga0068856_100223016
430 Ga0068856_100378906
431 Ga0068852_100094995
432 Ga0068859_100000750
433 Ga0068859_100997296
434 Ga0068864_100117208
435 Ga0068864_100142356
436 Ga0068866_10337253
437 Ga0068866_10570141
438 Ga0068851_10114489
439 Ga0068863_100063387
440 Ga0068863_100098749
441 Ga0068863_100129677
442 Ga0068863_100134343
443 Ga0068863_101843495
444 Ga0068858_100046916
445 Ga0068858_100377825
446 Ga0068858_100741076
447 Ga0068860_100016517
448 Ga0068860_100116499
449 Ga0068860_100452998
450 Ga0068862_100002516
451 Ga0070712_100357354
452 Ga0070712_100405169
453 Ga0097621_100028334
454 Ga0097621_100030786
455 Ga0097621_100040446
456 Ga0097621_100047515
457 Ga0097621_100048102
458 Ga0097621_100049345
459 Ga0097621_100079269
460 Ga0097621_100113796
461 Ga0097621_100312128
462 Ga0068871_100020249
463 Ga0068871_100026270
464 Ga0068871_100029054
465 Ga0068871_100073793
466 Ga0068871_100146511
467 Ga0068871_100226395
468 Ga0068871_100383508
469 Ga0075433_10003229
470 Ga0068865_100030951
471 Ga0068865_100150797
472 Ga0075436_100005768
473 Ga0097620_100000750
474 Ga0097620_100997354
475 Ga0097620_101787197
476 Ga0105240_10237922
477 Ga0105240_10754159
478 Ga0105245_10013010
479 Ga0105245_10015440
480 Ga0105245_10243795
481 Ga0105245_10256690
482 Ga0105247_10046039
483 Ga0105247_10063411
484 Ga0105241_10235124
485 Ga0105241_10353299
486 Ga0105241_10594181
487 Ga0105242_10007611
488 Ga0105242_10112704
489 Ga0105242_10216852
490 Ga0105242_10334651
491 Ga0105248_10004954
492 Ga0105248_10018766
493 Ga0105248_10046353
494 Ga0105248_10734774
495 Ga0105237_10031955
496 Ga0105237_10035580
497 Ga0105237_10167333
498 Ga0105237_10196831
499 Ga0105237_10300141
500 Ga0105237_10603133
501 Ga0105238_10030173
502 Ga0105238_10045130
503 Ga0105238_10256861
504 Ga0105238_10529797
505 Ga0105238_10883798
506 Ga0105238_10990873
507 Ga0105249_10016546
508 Ga0105239_10025296
509 Ga0105239_10042269
510 Ga0105239_10069013
511 Ga0105239_10097312
512 Ga0105239_10743010
513 Ga0105239_11432455
514 Ga0105246_10394597
515 Ga0157369_10665099
516 Ga0157374_10003249
517 Ga0157374_10144784
518 Ga0157374_10353134
519 Ga0157378_10019368
520 Ga0157378_10928109
521 Ga0163162_10029045
522 Ga0163162_10048926
523 Ga0163162_10070379
524 Ga0163162_10786245
525 Ga0157372_10041842
526 Ga0157372_11220844
527 Ga0157375_10514090
528 Ga0157375_10800243
529 Ga0163163_10031009
530 Ga0163163_10041346
531 Ga0163163_10844460
532 Ga0157379_10100137
533 Ga0157379_10118237
534 Ga0157379_10193610
535 Ga0157376_10003739
536 Ga0157376_10081749
537 Ga0157376_10177553
538 Ga0157376_10729514
539 Ga0157376_11020647
540 Ga0213873_10000471
541 Ga0213872_10016235
542 Ga0213874_10014207
543 Ga0213875_10082102
544 Ga0213871_10003523
545 Ga0213871_10013365
546 Ga0207656_10277196
547 Ga0207692_10097479
548 Ga0207642_10457836
549 Ga0207710_10150354
550 Ga0207680_10003135
551 Ga0207680_10130686
552 Ga0207680_10714878
553 Ga0207647_10299344
554 Ga0207684_10298989
555 Ga0207654_10371923
556 Ga0207707_10135573
557 Ga0207707_10315573
558 Ga0207695_10011058
559 Ga0207671_10088234
560 Ga0207671_10188074
561 Ga0207671_10261250
562 Ga0207693_10155143
563 Ga0207693_10371924
564 Ga0207663_10031645
565 Ga0207660_10375168
566 Ga0207649_10183150
567 Ga0207649_10583666
568 Ga0207652_10061432
569 Ga0207652_10580845
570 Ga0207694_10054460
571 Ga0207694_10411818
572 Ga0207650_10177902
573 Ga0207687_10003502
574 Ga0207687_10041837
575 Ga0207687_10193413
576 Ga0207687_10207341
577 Ga0207687_10629354
578 Ga0207700_10001814
579 Ga0207700_10231324
580 Ga0207664_10170156
581 Ga0207644_10819840
582 Ga0207706_10046138
583 Ga0207686_10036308
584 Ga0207686_10050008
585 Ga0207686_10050068
586 Ga0207709_10190900
587 Ga0207670_10058182
588 Ga0207670_10582950
589 Ga0207669_10119381
590 Ga0207704_10043542
591 Ga0207704_10084571
592 Ga0207704_10252358
593 Ga0207691_10558868
594 Ga0207711_10010830
595 Ga0207711_10035466
596 Ga0207711_10494172
597 Ga0207689_10619168
598 Ga0207689_10881881
599 Ga0207661_10053278
600 Ga0207661_10473258
601 Ga0207679_10047160
602 Ga0207679_10461449
603 Ga0207667_10326690
604 Ga0207651_10066949
605 Ga0207651_10181508
606 Ga0207651_10318485
607 Ga0207651_10527870
608 Ga0207712_10024359
609 Ga0207668_10131031
610 Ga0207640_10482085
611 Ga0207640_10695572
612 Ga0207658_10120578
613 Ga0207658_10133154
614 Ga0207658_10850426
615 Ga0207677_10249840
616 Ga0207703_10035598
617 Ga0207703_10348793
618 Ga0207639_10137414
619 Ga0207639_10466051
620 Ga0207678_10090339
621 Ga0207702_10053188
622 Ga0207702_10447841
623 Ga0207641_10014957
624 Ga0207641_10063988
625 Ga0207641_10353231
626 Ga0207641_10368840
627 Ga0207648_10020658
628 Ga0207648_10048962
629 Ga0207676_10212301
630 Ga0207674_10040490
631 Ga0207675_100243399
632 Ga0207698_10286542
633 Ga0207698_10660879
634 Ga0207698_11265953
635 Ga0268266_10000072
636 Ga0268266_10056712
637 Ga0268266_10121310
638 Ga0268266_10805902
639 Ga0268266_11153460
640 Ga0268265_10000351
641 Ga0268264_10006943
642 Ga0268264_10010463
643 Ga0268264_10813272
644 Ga0268264_10902838
645 Ga0265338_10295646
646 Ga0265330_10080455
647 Ga0265325_10184215
648 Ga0265331_10199661
649 Ga0265313_10102343
650 Ga0265314_10012479
651 Ga0265314_10014757
652 Ga0373934_0069487
653 Ga0373923_0206456
654 Ga0373954_0153079
655 Ga0373956_0026793
656 Ga0373956_0053013
657 Ga0373943_0144768
658 Ga0373946_0094877
659 Ga0373946_0228158
660 Ga0373955_0012186
661 Ga0373955_0056278
662 Ga0373955_0078376
663 Ga0373935_0100764
664 Ga0373935_0118176
665 Ga0373927_0003189
666 Ga0373927_0258324
667 Ga0373933_0002784
668 Ga0373933_0155001
669 Ga0373933_0156016
670 Ga0373933_0361658
671 Ga0373947_0081553
672 Ga0373937_0000015
673 Ga0373937_0006101
674 Ga0373937_0026284
675 Ga0373937_0104444
676 Ga0373937_0303840
677 Ga0373937_0343594
678 Ga0373937_0495835
679 Ga0373925_0072853
680 Ga0373925_0177331
681 Ga0373925_0539136
682 Ga0436364_0872169
683 Ga0436364_1158525
684 Ga0436365_0208922
685 Ga0436365_0875459
686 Ga0436365_0981587
687 Ga0436365_1507061
688 Ga0436360_0668250
689 Ga0436360_0789144
690 Ga0436360_0851767
691 Ga0436360_1037982
692 Ga0436361_0607397
693 Ga0436363_0211820
694 Ga0436363_1331510
695 Ga0436363_1544230
696 Ga0436363_1603563
697 Ga0436362_0141308
698 Ga0436362_0390427
699 Ga0436362_1101245
700 Ga0495592_0582262
701 Ga0495629_0327013
702 Ga0495651_0026872
703 Ga0495653_0051926
704 Ga0495580_0046934
705 Ga0495664_0062371
706 Ga0495594_0413455
707 Ga0495630_0421167
708 Ga0495665_0143459
709 Ga0495586_0306983
710 Ga0495587_0000219
711 Ga0495587_0005988
712 Ga0495587_0264666
713 Ga0495645_0080592
714 Ga0495645_0373769
715 Ga0495667_0337968
716 Ga0495635_0285445
717 Ga0495588_0362971
718 Ga0495623_0017841
719 Ga0495623_0487902
720 Ga0495646_0400156
721 Ga0495613_0011389
722 Ga0495581_0275884
723 Ga0495604_0048369
724 Ga0495674_0154318
725 Ga0495674_0656817
726 Ga0495675_0001097
727 Ga0495684_0539198
728 Ga0495684_0575394
729 Ga0495602_0000206
730 Ga0495602_0004017
731 Ga0496105_0494425
732 Ga0496112_1162282
733 Ga0496114_0501869
734 Ga0496115_0000113
735 Ga0496126_0000226
736 Ga0501043_0506507
737 nmdc:mga08x19_28163_c1
738 nmdc:mga0a205_24469_c1
739 Ga0495619_0127432
740 Ga0500636_0065059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16694

Cytochrome_P460

Cytochrome P460

71

207

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.7829 32 179
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.7457 32 179
2je2-assembly1.cif.gz_A cytochrome p460 from nitrosomonas europaea - probable nonphysiological oxidized form 0.7229 44 171
7zs4-assembly1.cif.gz_A f32v cytochrome c prime beta from methylococcus capsulatus (bath) 0.7178 42 179
7zrw-assembly1.cif.gz_B f61v cytochrome c prime beta from methylococcus capsulatus (bath) 0.7169 44 179
ID Description Score Start End Superfamily
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.7141 44 178 3.50.70.20
af_Q4CZF5_1_150_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.6995 49 96 3.30.450.30
af_P91300_14_131_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.6742 50 97 2.60.210.10
af_Q8I3I6_808_922_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.6661 50 100 3.30.310.10
af_P9WKF7_3_423_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6391 49 67 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2U0XWL8-F1-model_v4 deleted 0.9407 94 141
AF-A0A1Q7VEB2-F1-model_v4 Cytochrome P460 0.9339 27 133
AF-A0A2V7CPU1-F1-model_v4 Cytochrome P460 0.9035 24 105
AF-A0A239XYN6-F1-model_v4 deleted 0.8496 44 141
AF-A0A1F9CK70-F1-model_v4 Cytochrome P460 domain-containing protein 0.8288 23 184

Map