F424470

General Info

Members Datasets Scaffolds Average Seq Length
367 185 367 94

Family's Representative Sequence

Representative Sequence 3300046533|Ga0495640_0457807|Ga0495640_0457807_85_381
Length 98
Sequence VKEGSMAVGIRIKLAGITQEQFDTGHDHINPDRTPPKGLIFHSSGPIEGGWGIIDFWESREDFDAFAARIPEGFAAAGVEPQGPPDVKEFPVHEMIRA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
109 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
183 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.55
Metatranscriptomes 5.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 5.72
Rhizosphere 89.65
Stem 0
Stem Tuber 0
Unclassified 3.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10018595 3300005327 Bacteria 5564
2 Ga0070658_10096753 3300005327 Bacteria 2437
3 Ga0070658_10168290 3300005327 Bacteria 1841
4 Ga0070683_100011321 3300005329 Bacteria 7704
5 Ga0070683_100024322 3300005329 Bacteria 5424
6 Ga0070683_100128828 3300005329 Bacteria 2394
7 Ga0070683_100399506 3300005329 Unclassified 1311
8 Ga0070677_10000036 3300005333 Bacteria 40479
9 Ga0070680_100053084 3300005336 Bacteria 3308
10 Ga0070680_100167546 3300005336 Bacteria 1848
11 Ga0070680_100297109 3300005336 Unclassified 1369
12 Ga0070680_100440273 3300005336 Bacteria 1113
13 Ga0070680_100449297 3300005336 Bacteria 1101
14 Ga0070682_100000077 3300005337 Bacteria 89055
15 Ga0070682_100066733 3300005337 Bacteria 2290
16 Ga0070682_100682274 3300005337 Unclassified 821
17 Ga0070682_101873966 3300005337 Unclassified 525
18 Ga0068868_100675846 3300005338 Unclassified 921
19 Ga0070660_100010145 3300005339 Bacteria 6646
20 Ga0070660_100011845 3300005339 Bacteria 6215
21 Ga0070660_100043874 3300005339 Unclassified 3418
22 Ga0070660_100486726 3300005339 Bacteria 1025
23 Ga0070661_100052485 3300005344 Bacteria 2984
24 Ga0070661_100344035 3300005344 Bacteria 1169
25 Ga0070661_101015094 3300005344 Bacteria 689
26 Ga0070668_101229294 3300005347 Bacteria 679
27 Ga0070671_100590718 3300005355 Bacteria 959
28 Ga0070673_101199030 3300005364 Unclassified 711
29 Ga0070659_100264383 3300005366 Bacteria 1428
30 Ga0070659_100369971 3300005366 Bacteria 1206
31 Ga0070659_100675559 3300005366 Bacteria 892
32 Ga0070714_100180219 3300005435 Bacteria 1922
33 Ga0070713_101444873 3300005436 Bacteria 667
34 Ga0070711_101480552 3300005439 Unclassified 592
35 Ga0070663_100763631 3300005455 Bacteria 826
36 Ga0070681_10004539 3300005458 Bacteria 13251
37 Ga0070681_10082596 3300005458 Bacteria 3168
38 Ga0070681_10187168 3300005458 Bacteria 1990
39 Ga0070681_10271679 3300005458 Bacteria 1607
40 Ga0070681_10374349 3300005458 Bacteria 1335
41 Ga0070681_12046589 3300005458 Bacteria 501
42 Ga0070685_10705908 3300005466 Unclassified 736
43 Ga0070679_100024219 3300005530 Bacteria 5948
44 Ga0070679_100033225 3300005530 Bacteria 5108
45 Ga0070679_100173753 3300005530 Bacteria 2127
46 Ga0070679_100318172 3300005530 Bacteria 1505
47 Ga0070679_100331826 3300005530 Bacteria 1469
48 Ga0070679_101178392 3300005530 Bacteria 711
49 Ga0070684_100039552 3300005535 Bacteria 4057
50 Ga0070684_100049226 3300005535 Bacteria 3657
51 Ga0070684_100056147 3300005535 Bacteria 3435
52 Ga0070684_100685943 3300005535 Unclassified 954
53 Ga0068853_100395893 3300005539 Bacteria 1292
54 Ga0068853_101174802 3300005539 Unclassified 741
55 Ga0070693_100331529 3300005547 Unclassified 1036
56 Ga0070693_100622675 3300005547 Bacteria 782
57 Ga0070665_100000068 3300005548 Bacteria 204531
58 Ga0068855_100011027 3300005563 Bacteria 10909
59 Ga0068855_100029808 3300005563 Bacteria 6524
60 Ga0068855_100039683 3300005563 Bacteria 5589
61 Ga0068855_101186253 3300005563 Unclassified 794
62 Ga0070664_100275398 3300005564 Unclassified 1517
63 Ga0068857_101616396 3300005577 Bacteria 633
64 Ga0068856_100042376 3300005614 Bacteria 4477
65 Ga0068856_100155277 3300005614 Bacteria 2298
66 Ga0068856_102669511 3300005614 Bacteria 505
67 Ga0068852_100055263 3300005616 Bacteria 3426
68 Ga0068852_100073517 3300005616 Bacteria 3008
69 Ga0068852_100102373 3300005616 Bacteria 2587
70 Ga0068863_100000004 3300005841 Bacteria 272478
71 Ga0068858_100000012 3300005842 Bacteria 216931
72 Ga0097621_102197705 3300006237 Bacteria 528
73 Ga0068871_101092315 3300006358 Unclassified 746
74 Ga0075430_100597795 3300006846 Bacteria 910
75 Ga0068865_100363973 3300006881 Bacteria 1175
76 Ga0105240_10002982 3300009093 Bacteria 26627
77 Ga0105240_10007770 3300009093 Bacteria 15505
78 Ga0105240_10291895 3300009093 Bacteria 1869
79 Ga0105240_10328669 3300009093 Bacteria 1740
80 Ga0105240_10430839 3300009093 Unclassified 1480
81 Ga0105240_10696090 3300009093 Bacteria 1110
82 Ga0105240_11682491 3300009093 Unclassified 663
83 Ga0105245_10006036 3300009098 Bacteria 10649
84 Ga0105245_10242643 3300009098 Bacteria 1747
85 Ga0105243_11647156 3300009148 Unclassified 669
86 Ga0105241_10260509 3300009174 Bacteria 1473
87 Ga0105241_10762101 3300009174 Bacteria 888
88 Ga0105242_10889020 3300009176 Bacteria 890
89 Ga0105237_10202129 3300009545 Bacteria 1987
90 Ga0105237_10600451 3300009545 Bacteria 1108
91 Ga0105238_10000023 3300009551 Bacteria 196844
92 Ga0105238_10578425 3300009551 Bacteria 1129
93 Ga0105238_11392123 3300009551 Bacteria 728
94 Ga0105239_10359280 3300010375 Bacteria 1645
95 Ga0105239_10976170 3300010375 Unclassified 974
96 Ga0105239_12178503 3300010375 Bacteria 644
97 Ga0105239_12347058 3300010375 Bacteria 621
98 Ga0157373_10055667 3300013100 Bacteria 2809
99 Ga0157373_10058098 3300013100 Bacteria 2743
100 Ga0157371_10048261 3300013102 Unclassified 3026
101 Ga0157371_10313675 3300013102 Bacteria 1137
102 Ga0157370_10026478 3300013104 Bacteria 5726
103 Ga0157370_10046263 3300013104 Bacteria 4172
104 Ga0157370_10121894 3300013104 Bacteria 2435
105 Ga0157370_10364884 3300013104 Bacteria 1331
106 Ga0157369_10059134 3300013105 Bacteria 4134
107 Ga0157369_10067585 3300013105 Bacteria 3842
108 Ga0157369_10074490 3300013105 Bacteria 3641
109 Ga0157369_10441280 3300013105 Unclassified 1348
110 Ga0157369_10496980 3300013105 Bacteria 1262
111 Ga0157369_10666704 3300013105 Bacteria 1072
112 Ga0157369_11373977 3300013105 Bacteria 719
113 Ga0157374_10085787 3300013296 Bacteria 2995
114 Ga0157378_12036256 3300013297 Unclassified 624
115 Ga0157378_13234670 3300013297 Bacteria 506
116 Ga0157372_10020035 3300013307 Bacteria 7212
117 Ga0157372_10409206 3300013307 Bacteria 1581
118 Ga0157372_10556516 3300013307 Bacteria 1337
119 Ga0157372_10906463 3300013307 Bacteria 1023
120 Ga0157372_11037763 3300013307 Bacteria 949
121 Ga0157375_10093950 3300013308 Bacteria 3066
122 Ga0157375_11123521 3300013308 Unclassified 920
123 Ga0157375_11729708 3300013308 Bacteria 741
124 Ga0157375_13221948 3300013308 Unclassified 544
125 Ga0163163_11768532 3300014325 Bacteria 678
126 Ga0157380_10632393 3300014326 Bacteria 1064
127 Ga0157377_11012907 3300014745 Unclassified 630
128 Ga0157379_11825326 3300014968 Unclassified 598
129 Ga0163161_10158314 3300017792 Bacteria 1725
130 Ga0163161_11212664 3300017792 Bacteria 653
131 Ga0197907_10032597 3300020069 Bacteria 1373
132 Ga0197907_11345511 3300020069 Unclassified 861
133 Ga0197907_11399183 3300020069 Bacteria 3626
134 Ga0206356_10596004 3300020070 Bacteria 2000
135 Ga0206356_10644984 3300020070 Bacteria 1196
136 Ga0206356_10938258 3300020070 Bacteria 2712
137 Ga0206356_11719383 3300020070 Bacteria 3220
138 Ga0206351_10582789 3300020077 Bacteria 568
139 Ga0206352_10703191 3300020078 Bacteria 555
140 Ga0206352_11051728 3300020078 Bacteria 958
141 Ga0206354_10731695 3300020081 Bacteria 1492
142 Ga0206354_11678193 3300020081 Bacteria 986
143 Ga0206353_10060218 3300020082 Bacteria 1008
144 Ga0206353_10259637 3300020082 Bacteria 1873
145 Ga0206353_11338531 3300020082 Bacteria 1205
146 Ga0206353_11366025 3300020082 Bacteria 2724
147 Ga0206353_11609755 3300020082 Unclassified 503
148 Ga0154015_1011781 3300020610 Unclassified 3150
149 Ga0224712_10024639 3300022467 Bacteria 2105
150 Ga0224712_10587496 3300022467 Unclassified 543
151 Ga0207705_10160323 3300025909 Bacteria 1689
152 Ga0207705_10186912 3300025909 Bacteria 1565
153 Ga0207705_11516427 3300025909 Unclassified 507
154 Ga0207654_11004136 3300025911 Unclassified 607
155 Ga0207707_10120369 3300025912 Unclassified 2295
156 Ga0207707_10155269 3300025912 Bacteria 2001
157 Ga0207707_10276379 3300025912 Bacteria 1455
158 Ga0207707_10391248 3300025912 Bacteria 1194
159 Ga0207707_11581695 3300025912 Unclassified 517
160 Ga0207695_10039475 3300025913 Bacteria 5074
161 Ga0207695_10103172 3300025913 Bacteria 2844
162 Ga0207695_10364292 3300025913 Bacteria 1332
163 Ga0207695_10613473 3300025913 Unclassified 969
164 Ga0207671_10282570 3300025914 Bacteria 1309
165 Ga0207671_10814669 3300025914 Unclassified 740
166 Ga0207663_11461859 3300025916 Unclassified 550
167 Ga0207660_10076125 3300025917 Bacteria 2453
168 Ga0207660_10390554 3300025917 Bacteria 1120
169 Ga0207660_10510048 3300025917 Bacteria 976
170 Ga0207657_10003156 3300025919 Bacteria 17625
171 Ga0207657_10006023 3300025919 Bacteria 12613
172 Ga0207657_10007923 3300025919 Bacteria 10833
173 Ga0207657_10051827 3300025919 Bacteria 3566
174 Ga0207649_10009900 3300025920 Bacteria 5225
175 Ga0207649_10218566 3300025920 Bacteria 1356
176 Ga0207649_11538558 3300025920 Unclassified 526
177 Ga0207652_10024104 3300025921 Bacteria 5046
178 Ga0207652_10149768 3300025921 Bacteria 2089
179 Ga0207652_10258953 3300025921 Unclassified 1569
180 Ga0207652_10793029 3300025921 Bacteria 841
181 Ga0207694_10000004 3300025924 Bacteria 967075
182 Ga0207694_10213709 3300025924 Unclassified 1572
183 Ga0207687_10001320 3300025927 Bacteria 16975
184 Ga0207687_10273674 3300025927 Unclassified 1351
185 Ga0207700_10779213 3300025928 Unclassified 855
186 Ga0207644_10528485 3300025931 Bacteria 975
187 Ga0207690_10508043 3300025932 Bacteria 975
188 Ga0207690_11007002 3300025932 Bacteria 693
189 Ga0207686_11548206 3300025934 Unclassified 547
190 Ga0207709_11357629 3300025935 Unclassified 588
191 Ga0207704_10395956 3300025938 Bacteria 1088
192 Ga0207661_10019004 3300025944 Bacteria 5114
193 Ga0207661_10492101 3300025944 Unclassified 1120
194 Ga0207661_10498536 3300025944 Bacteria 1112
195 Ga0207661_10981427 3300025944 Bacteria 778
196 Ga0207667_10027994 3300025949 Bacteria 6125
197 Ga0207667_10590615 3300025949 Unclassified 1120
198 Ga0207667_11983936 3300025949 Unclassified 542
199 Ga0207651_10619599 3300025960 Bacteria 948
200 Ga0207668_11279500 3300025972 Bacteria 660
201 Ga0207640_10004143 3300025981 Bacteria 7834
202 Ga0207703_10000550 3300026035 Bacteria 38556
203 Ga0207639_10137729 3300026041 Bacteria 2030
204 Ga0207639_10467192 3300026041 Bacteria 1148
205 Ga0207639_10613801 3300026041 Bacteria 1004
206 Ga0207678_10961517 3300026067 Unclassified 756
207 Ga0207702_10005801 3300026078 Bacteria 10739
208 Ga0207702_11112260 3300026078 Bacteria 784
209 Ga0207702_11440567 3300026078 Bacteria 682
210 Ga0207641_10000129 3300026088 Bacteria 110871
211 Ga0207674_12147418 3300026116 Unclassified 522
212 Ga0207698_10014084 3300026142 Bacteria 5302
213 Ga0207698_10113649 3300026142 Bacteria 2275
214 Ga0268266_10000020 3300028379 Bacteria 527065
215 Ga0265319_1268912 3300028563 Bacteria 519
216 Ga0373954_0258807 3300035118 Bacteria 857
217 Ga0373937_0111876 3300036401 Bacteria 2540
218 Ga0373925_0441689 3300037068 Bacteria 1065
219 Ga0395899_0147339 3300037312 Bacteria 1670
220 Ga0395900_0096429 3300037418 Bacteria 3038
221 Ga0395898_0033415 3300037466 Bacteria 5133
222 Ga0395905_0213073 3300037471 Bacteria 1809
223 Ga0436364_0032994 3300037853 Unclassified 554
224 Ga0395901_0006844 3300038443 Bacteria 11515
225 Ga0436365_0365653 3300039437 Bacteria 21300
226 Ga0436365_1547213 3300039437 Bacteria 645
227 Ga0436365_1765262 3300039437 Bacteria 941
228 Ga0436363_0089964 3300039450 Bacteria 22178
229 Ga0436363_0359788 3300039450 Bacteria 599
230 Ga0436363_1132971 3300039450 Bacteria 5546
231 Ga0436362_0517020 3300039453 Bacteria 636
232 Ga0451835_0916340 3300041492 Unclassified 573
233 Ga0451849_1193030 3300041505 Bacteria 1129
234 Ga0451853_0569307 3300041512 Bacteria 736
235 Ga0451853_0848126 3300041512 Unclassified 547
236 Ga0451853_1400461 3300041512 Unclassified 762
237 Ga0451853_1656563 3300041512 Bacteria 688
238 Ga0451853_3319123 3300041512 Bacteria 3674
239 Ga0466969_0451119 3300044656 Unclassified 585
240 Ga0466965_0769580 3300044683 Bacteria 556
241 Ga0466966_0018061 3300044684 Bacteria 4656
242 Ga0466961_0241261 3300044693 Bacteria 1111
243 Ga0466963_0213157 3300044694 Unclassified 1352
244 Ga0466964_0760115 3300044706 Unclassified 545
245 Ga0466968_0014460 3300044735 Bacteria 3120
246 Ga0466970_0084032 3300044765 Bacteria 1723
247 Ga0466970_0542189 3300044765 Bacteria 672
248 Ga0466957_0034219 3300044842 Unclassified 3049
249 Ga0466957_0440113 3300044842 Bacteria 897
250 Ga0466959_0163072 3300045049 Bacteria 1566
251 Ga0466958_0020684 3300045836 Bacteria 3840
252 Ga0466958_0139320 3300045836 Bacteria 1527
253 Ga0466958_0180238 3300045836 Bacteria 1340
254 Ga0466967_0327211 3300045976 Bacteria 1479
255 Ga0466967_0672769 3300045976 Unclassified 1024
256 Ga0495592_0111658 3300046454 Bacteria 1934
257 Ga0495592_0616442 3300046454 Bacteria 660
258 Ga0495603_0072232 3300046455 Bacteria 2027
259 Ga0495629_0068338 3300046459 Bacteria 2479
260 Ga0495641_0000020 3300046461 Bacteria 115404
261 Ga0495641_0134849 3300046461 Unclassified 1102
262 Ga0495641_0430984 3300046461 Bacteria 599
263 Ga0495651_0210877 3300046462 Bacteria 1352
264 Ga0495651_0271761 3300046462 Unclassified 1149
265 Ga0495653_0627309 3300046463 Unclassified 658
266 Ga0495582_0758244 3300046473 Bacteria 561
267 Ga0495664_0263208 3300046477 Unclassified 1042
268 Ga0495608_0343954 3300046511 Bacteria 919
269 Ga0495618_0250351 3300046514 Bacteria 1111
270 Ga0495618_0643913 3300046514 Unclassified 627
271 Ga0495628_0090383 3300046516 Bacteria 2371
272 Ga0495628_0092749 3300046516 Bacteria 2336
273 Ga0495628_0118839 3300046516 Bacteria 2029
274 Ga0495630_0058904 3300046517 Bacteria 2880
275 Ga0495630_0079743 3300046517 Bacteria 2469
276 Ga0495630_0126697 3300046517 Bacteria 1938
277 Ga0495630_0215951 3300046517 Bacteria 1464
278 Ga0495644_0001940 3300046523 Bacteria 8307
279 Ga0495666_0370646 3300046526 Unclassified 644
280 Ga0495652_0052238 3300046529 Bacteria 3487
281 Ga0495652_0411408 3300046529 Bacteria 955
282 Ga0495652_0802764 3300046529 Unclassified 626
283 Ga0495640_0017519 3300046533 Bacteria 5337
284 Ga0495640_0040026 3300046533 Bacteria 3285
285 Ga0495640_0113633 3300046533 Bacteria 1766
286 Ga0495640_0229610 3300046533 Bacteria 1168
287 Ga0495640_0457807 3300046533 Bacteria 779
288 Ga0495586_0000862 3300046535 Bacteria 17412
289 Ga0495587_0427281 3300046536 Unclassified 735
290 Ga0495645_0063704 3300046543 Bacteria 2669
291 Ga0495634_0049169 3300046642 Bacteria 2837
292 Ga0495634_0104830 3300046642 Bacteria 1823
293 Ga0495635_0000096 3300046663 Bacteria 52204
294 Ga0495635_0158081 3300046663 Bacteria 1542
295 Ga0495635_0736682 3300046663 Unclassified 638
296 Ga0495588_0075686 3300046674 Bacteria 1754
297 Ga0495657_0235242 3300046675 Bacteria 1107
298 Ga0495599_0011195 3300046678 Bacteria 5508
299 Ga0495599_0447296 3300046678 Unclassified 765
300 Ga0495646_0049014 3300046680 Bacteria 2564
301 Ga0495646_0218825 3300046680 Bacteria 1031
302 Ga0495646_0584438 3300046680 Unclassified 568
303 Ga0495647_0000015 3300046681 Bacteria 86790
304 Ga0495647_0009578 3300046681 Bacteria 3284
305 Ga0495669_0000103 3300046684 Bacteria 53749
306 Ga0495613_0284070 3300046689 Bacteria 1148
307 Ga0495624_0000012 3300046690 Bacteria 124128
308 Ga0495624_0004399 3300046690 Bacteria 10309
309 Ga0495624_0695875 3300046690 Unclassified 603
310 Ga0495624_0870774 3300046690 Unclassified 531
311 Ga0495649_0002521 3300046694 Bacteria 12845
312 Ga0495600_0000884 3300046809 Bacteria 16029
313 Ga0495600_0150814 3300046809 Bacteria 1505
314 Ga0495581_0759628 3300047315 Unclassified 557
315 Ga0495604_0000346 3300047317 Bacteria 41587
316 Ga0495604_0102506 3300047317 Bacteria 2101
317 Ga0495604_0104830 3300047317 Bacteria 2071
318 Ga0495604_0556226 3300047317 Unclassified 739
319 Ga0495674_0000019 3300047319 Bacteria 185107
320 Ga0495674_0071519 3300047319 Bacteria 2994
321 Ga0495674_0459253 3300047319 Bacteria 1022
322 Ga0495676_0011083 3300047321 Bacteria 8146
323 Ga0495676_0268296 3300047321 Bacteria 1159
324 Ga0495680_0000952 3300047322 Bacteria 32176
325 Ga0495680_0023505 3300047322 Bacteria 5122
326 Ga0495680_0346101 3300047322 Bacteria 1036
327 Ga0495680_0686173 3300047322 Bacteria 678
328 Ga0495675_0076715 3300047444 Bacteria 2106
329 Ga0495685_076956 3300047447 Unclassified 1113
330 Ga0495684_0001796 3300047471 Bacteria 17236
331 Ga0495684_0088319 3300047471 Bacteria 2349
332 Ga0495684_0740544 3300047471 Bacteria 648
333 Ga0495593_0152337 3300047673 Bacteria 1169
334 Ga0495602_0750793 3300048088 Unclassified 658
335 Ga0496100_0000007 3300048903 Bacteria 261266
336 Ga0496100_0006520 3300048903 Bacteria 6367
337 Ga0496101_0000013 3300048904 Bacteria 261266
338 Ga0496102_0219597 3300048905 Bacteria 1792
339 Ga0496103_0702333 3300048906 Bacteria 641
340 Ga0496104_0000013 3300048907 Bacteria 397163
341 Ga0496104_0017256 3300048907 Bacteria 6570
342 Ga0496104_0219606 3300048907 Bacteria 1813
343 Ga0496105_0000006 3300048908 Bacteria 393578
344 Ga0496106_0000006 3300048909 Bacteria 251855
345 Ga0496107_0000007 3300048910 Bacteria 257113
346 Ga0496107_0153993 3300048910 Unclassified 1701
347 Ga0496109_0461095 3300048912 Bacteria 1200
348 Ga0496110_0115110 3300048913 Bacteria 2420
349 Ga0496111_0307373 3300048914 Bacteria 1175
350 Ga0496111_1340092 3300048914 Bacteria 503
351 Ga0496112_0006613 3300048915 Bacteria 10205
352 Ga0496112_0124746 3300048915 Bacteria 2546
353 Ga0496114_0610529 3300048917 Bacteria 961
354 Ga0496115_0000010 3300048918 Bacteria 227112
355 Ga0496115_0003116 3300048918 Bacteria 11918
356 Ga0501067_0008083 3300049583 Bacteria 5846
357 nmdc:mga0qj67_762797_c1 3300050509 Bacteria 767
358 Ga0495601_0001553 3300053077 Bacteria 12686
359 Ga0495601_0078292 3300053077 Bacteria 2118
360 Ga0495601_0108103 3300053077 Bacteria 1799
361 Ga0495601_0312696 3300053077 Unclassified 1023
362 Ga0495619_0375983 3300053085 Bacteria 982
363 Ga0495619_0786591 3300053085 Unclassified 644
364 Ga0500566_0109900 3300053094 Bacteria 1500
365 Ga0500608_296117 3300053122 Bacteria 603
366 Ga0500568_0068538 3300053139 Bacteria 1362
367 Ga0530510_0543899 3300061734 Bacteria 882

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100167546 Ga0070680_1001675464 82
2 3300025935 Ga0207709_11357629 Ga0207709_113576291 87
3 3300009093 Ga0105240_11682491 Ga0105240_116824911 92
4 3300005327 Ga0070658_10018595 Ga0070658_100185953 93
5 3300005327 Ga0070658_10096753 Ga0070658_100967531 93
6 3300005327 Ga0070658_10168290 Ga0070658_101682901 93
7 3300005329 Ga0070683_100011321 Ga0070683_1000113216 93
8 3300005329 Ga0070683_100024322 Ga0070683_1000243223 93
9 3300005329 Ga0070683_100128828 Ga0070683_1001288282 93
10 3300005329 Ga0070683_100399506 Ga0070683_1003995062 93
11 3300005333 Ga0070677_10000036 Ga0070677_100000364 93
12 3300005336 Ga0070680_100053084 Ga0070680_1000530844 93
13 3300005336 Ga0070680_100297109 Ga0070680_1002971091 93
14 3300005336 Ga0070680_100440273 Ga0070680_1004402732 93
15 3300005336 Ga0070680_100449297 Ga0070680_1004492972 93
16 3300005337 Ga0070682_100000077 Ga0070682_10000007785 93
17 3300005337 Ga0070682_100066733 Ga0070682_1000667332 93
18 3300005337 Ga0070682_100682274 Ga0070682_1006822741 93
19 3300005337 Ga0070682_101873966 Ga0070682_1018739662 93
20 3300005338 Ga0068868_100675846 Ga0068868_1006758462 93
21 3300005339 Ga0070660_100010145 Ga0070660_1000101455 93
22 3300005339 Ga0070660_100011845 Ga0070660_1000118458 93
23 3300005339 Ga0070660_100043874 Ga0070660_1000438743 93
24 3300005339 Ga0070660_100486726 Ga0070660_1004867262 93
25 3300005344 Ga0070661_100052485 Ga0070661_1000524852 93
26 3300005344 Ga0070661_100344035 Ga0070661_1003440351 93
27 3300005344 Ga0070661_101015094 Ga0070661_1010150941 93
28 3300005347 Ga0070668_101229294 Ga0070668_1012292941 93
29 3300005355 Ga0070671_100590718 Ga0070671_1005907181 93
30 3300005364 Ga0070673_101199030 Ga0070673_1011990302 93
31 3300005366 Ga0070659_100264383 Ga0070659_1002643831 93
32 3300005366 Ga0070659_100369971 Ga0070659_1003699712 93
33 3300005366 Ga0070659_100675559 Ga0070659_1006755592 93
34 3300005435 Ga0070714_100180219 Ga0070714_1001802193 93
35 3300005436 Ga0070713_101444873 Ga0070713_1014448732 93
36 3300005439 Ga0070711_101480552 Ga0070711_1014805522 93
37 3300005455 Ga0070663_100763631 Ga0070663_1007636312 93
38 3300005458 Ga0070681_10004539 Ga0070681_100045398 93
39 3300005458 Ga0070681_10082596 Ga0070681_100825962 93
40 3300005458 Ga0070681_10187168 Ga0070681_101871682 93
41 3300005458 Ga0070681_10271679 Ga0070681_102716792 93
42 3300005458 Ga0070681_10374349 Ga0070681_103743492 93
43 3300005458 Ga0070681_12046589 Ga0070681_120465891 93
44 3300005466 Ga0070685_10705908 Ga0070685_107059082 93
45 3300005530 Ga0070679_100024219 Ga0070679_1000242198 93
46 3300005530 Ga0070679_100033225 Ga0070679_1000332255 93
47 3300005530 Ga0070679_100173753 Ga0070679_1001737532 93
48 3300005530 Ga0070679_100318172 Ga0070679_1003181722 93
49 3300005530 Ga0070679_100331826 Ga0070679_1003318261 93
50 3300005530 Ga0070679_101178392 Ga0070679_1011783922 93
51 3300005535 Ga0070684_100039552 Ga0070684_1000395525 93
52 3300005535 Ga0070684_100049226 Ga0070684_1000492265 93
53 3300005535 Ga0070684_100056147 Ga0070684_1000561473 93
54 3300005535 Ga0070684_100685943 Ga0070684_1006859432 93
55 3300005539 Ga0068853_100395893 Ga0068853_1003958931 93
56 3300005539 Ga0068853_101174802 Ga0068853_1011748022 93
57 3300005547 Ga0070693_100331529 Ga0070693_1003315292 93
58 3300005547 Ga0070693_100622675 Ga0070693_1006226751 93
59 3300005548 Ga0070665_100000068 Ga0070665_10000006850 93
60 3300005563 Ga0068855_100011027 Ga0068855_1000110276 93
61 3300005563 Ga0068855_100029808 Ga0068855_1000298084 93
62 3300005563 Ga0068855_100039683 Ga0068855_1000396834 93
63 3300005563 Ga0068855_101186253 Ga0068855_1011862532 93
64 3300005564 Ga0070664_100275398 Ga0070664_1002753982 93
65 3300005577 Ga0068857_101616396 Ga0068857_1016163961 93
66 3300005614 Ga0068856_100042376 Ga0068856_1000423762 93
67 3300005614 Ga0068856_100155277 Ga0068856_1001552773 93
68 3300005614 Ga0068856_102669511 Ga0068856_1026695111 93
69 3300005616 Ga0068852_100055263 Ga0068852_1000552632 93
70 3300005616 Ga0068852_100073517 Ga0068852_1000735175 93
71 3300005616 Ga0068852_100102373 Ga0068852_1001023732 93
72 3300005841 Ga0068863_100000004 Ga0068863_10000000421 93
73 3300005842 Ga0068858_100000012 Ga0068858_100000012197 93
74 3300006237 Ga0097621_102197705 Ga0097621_1021977051 93
75 3300006358 Ga0068871_101092315 Ga0068871_1010923152 93
76 3300006846 Ga0075430_100597795 Ga0075430_1005977952 93
77 3300006881 Ga0068865_100363973 Ga0068865_1003639732 93
78 3300009093 Ga0105240_10002982 Ga0105240_1000298225 93
79 3300009093 Ga0105240_10007770 Ga0105240_1000777018 93
80 3300009093 Ga0105240_10291895 Ga0105240_102918951 93
81 3300009093 Ga0105240_10328669 Ga0105240_103286693 93
82 3300009093 Ga0105240_10430839 Ga0105240_104308392 93
83 3300009093 Ga0105240_10696090 Ga0105240_106960901 93
84 3300009098 Ga0105245_10006036 Ga0105245_100060362 93
85 3300009098 Ga0105245_10242643 Ga0105245_102426431 93
86 3300009148 Ga0105243_11647156 Ga0105243_116471561 93
87 3300009174 Ga0105241_10260509 Ga0105241_102605091 93
88 3300009174 Ga0105241_10762101 Ga0105241_107621012 93
89 3300009176 Ga0105242_10889020 Ga0105242_108890202 93
90 3300009545 Ga0105237_10202129 Ga0105237_102021291 93
91 3300009545 Ga0105237_10600451 Ga0105237_106004511 93
92 3300009551 Ga0105238_10000023 Ga0105238_10000023186 93
93 3300009551 Ga0105238_10578425 Ga0105238_105784252 93
94 3300009551 Ga0105238_11392123 Ga0105238_113921231 93
95 3300010375 Ga0105239_10359280 Ga0105239_103592802 93
96 3300010375 Ga0105239_10976170 Ga0105239_109761702 93
97 3300010375 Ga0105239_12178503 Ga0105239_121785032 93
98 3300010375 Ga0105239_12347058 Ga0105239_123470581 93
99 3300013100 Ga0157373_10055667 Ga0157373_100556675 93
100 3300013100 Ga0157373_10058098 Ga0157373_100580984 93
101 3300013102 Ga0157371_10048261 Ga0157371_100482613 93
102 3300013102 Ga0157371_10313675 Ga0157371_103136752 93
103 3300013104 Ga0157370_10026478 Ga0157370_100264782 93
104 3300013104 Ga0157370_10046263 Ga0157370_100462636 93
105 3300013104 Ga0157370_10121894 Ga0157370_101218944 93
106 3300013104 Ga0157370_10364884 Ga0157370_103648842 93
107 3300013105 Ga0157369_10059134 Ga0157369_100591342 93
108 3300013105 Ga0157369_10067585 Ga0157369_100675855 93
109 3300013105 Ga0157369_10074490 Ga0157369_100744905 93
110 3300013105 Ga0157369_10441280 Ga0157369_104412803 93
111 3300013105 Ga0157369_10496980 Ga0157369_104969801 93
112 3300013105 Ga0157369_10666704 Ga0157369_106667041 93
113 3300013105 Ga0157369_11373977 Ga0157369_113739772 93
114 3300013296 Ga0157374_10085787 Ga0157374_100857873 93
115 3300013297 Ga0157378_12036256 Ga0157378_120362561 93
116 3300013297 Ga0157378_13234670 Ga0157378_132346701 93
117 3300013307 Ga0157372_10020035 Ga0157372_100200354 93
118 3300013307 Ga0157372_10409206 Ga0157372_104092063 93
119 3300013307 Ga0157372_10556516 Ga0157372_105565162 93
120 3300013307 Ga0157372_10906463 Ga0157372_109064632 93
121 3300013307 Ga0157372_11037763 Ga0157372_110377631 93
122 3300013308 Ga0157375_10093950 Ga0157375_100939502 93
123 3300013308 Ga0157375_11123521 Ga0157375_111235213 93
124 3300013308 Ga0157375_11729708 Ga0157375_117297082 93
125 3300013308 Ga0157375_13221948 Ga0157375_132219481 93
126 3300014325 Ga0163163_11768532 Ga0163163_117685322 93
127 3300014326 Ga0157380_10632393 Ga0157380_106323932 93
128 3300014745 Ga0157377_11012907 Ga0157377_110129071 93
129 3300014968 Ga0157379_11825326 Ga0157379_118253261 93
130 3300017792 Ga0163161_10158314 Ga0163161_101583142 93
131 3300017792 Ga0163161_11212664 Ga0163161_112126642 93
132 3300020069 Ga0197907_10032597 Ga0197907_100325972 93
133 3300020069 Ga0197907_11345511 Ga0197907_113455111 93
134 3300020069 Ga0197907_11399183 Ga0197907_113991833 93
135 3300020070 Ga0206356_10596004 Ga0206356_105960043 93
136 3300020070 Ga0206356_10644984 Ga0206356_106449842 93
137 3300020070 Ga0206356_10938258 Ga0206356_109382585 93
138 3300020070 Ga0206356_11719383 Ga0206356_117193832 93
139 3300020077 Ga0206351_10582789 Ga0206351_105827891 93
140 3300020078 Ga0206352_10703191 Ga0206352_107031912 93
141 3300020078 Ga0206352_11051728 Ga0206352_110517282 93
142 3300020081 Ga0206354_10731695 Ga0206354_107316952 93
143 3300020081 Ga0206354_11678193 Ga0206354_116781932 93
144 3300020082 Ga0206353_10060218 Ga0206353_100602182 93
145 3300020082 Ga0206353_10259637 Ga0206353_102596372 93
146 3300020082 Ga0206353_11338531 Ga0206353_113385312 93
147 3300020082 Ga0206353_11366025 Ga0206353_113660252 93
148 3300020082 Ga0206353_11609755 Ga0206353_116097552 93
149 3300020610 Ga0154015_1011781 Ga0154015_10117814 93
150 3300022467 Ga0224712_10024639 Ga0224712_100246393 93
151 3300022467 Ga0224712_10587496 Ga0224712_105874961 93
152 3300025909 Ga0207705_10160323 Ga0207705_101603235 93
153 3300025909 Ga0207705_10186912 Ga0207705_101869121 93
154 3300025909 Ga0207705_11516427 Ga0207705_115164271 93
155 3300025911 Ga0207654_11004136 Ga0207654_110041361 93
156 3300025912 Ga0207707_10120369 Ga0207707_101203692 93
157 3300025912 Ga0207707_10155269 Ga0207707_101552691 93
158 3300025912 Ga0207707_10276379 Ga0207707_102763792 93
159 3300025912 Ga0207707_10391248 Ga0207707_103912481 93
160 3300025912 Ga0207707_11581695 Ga0207707_115816951 93
161 3300025913 Ga0207695_10039475 Ga0207695_100394752 93
162 3300025913 Ga0207695_10103172 Ga0207695_101031722 93
163 3300025913 Ga0207695_10364292 Ga0207695_103642922 93
164 3300025913 Ga0207695_10613473 Ga0207695_106134732 93
165 3300025914 Ga0207671_10282570 Ga0207671_102825704 93
166 3300025914 Ga0207671_10814669 Ga0207671_108146691 93
167 3300025916 Ga0207663_11461859 Ga0207663_114618591 93
168 3300025917 Ga0207660_10076125 Ga0207660_100761252 93
169 3300025917 Ga0207660_10390554 Ga0207660_103905542 93
170 3300025917 Ga0207660_10510048 Ga0207660_105100482 93
171 3300025919 Ga0207657_10003156 Ga0207657_100031563 93
172 3300025919 Ga0207657_10006023 Ga0207657_1000602312 93
173 3300025919 Ga0207657_10007923 Ga0207657_100079234 93
174 3300025919 Ga0207657_10051827 Ga0207657_100518272 93
175 3300025920 Ga0207649_10009900 Ga0207649_100099002 93
176 3300025920 Ga0207649_10218566 Ga0207649_102185661 93
177 3300025920 Ga0207649_11538558 Ga0207649_115385581 93
178 3300025921 Ga0207652_10024104 Ga0207652_100241046 93
179 3300025921 Ga0207652_10149768 Ga0207652_101497682 93
180 3300025921 Ga0207652_10258953 Ga0207652_102589531 93
181 3300025921 Ga0207652_10793029 Ga0207652_107930292 93
182 3300025924 Ga0207694_10000004 Ga0207694_10000004874 93
183 3300025924 Ga0207694_10213709 Ga0207694_102137092 93
184 3300025927 Ga0207687_10001320 Ga0207687_1000132012 93
185 3300025927 Ga0207687_10273674 Ga0207687_102736742 93
186 3300025928 Ga0207700_10779213 Ga0207700_107792132 93
187 3300025931 Ga0207644_10528485 Ga0207644_105284852 93
188 3300025932 Ga0207690_10508043 Ga0207690_105080432 93
189 3300025932 Ga0207690_11007002 Ga0207690_110070021 93
190 3300025934 Ga0207686_11548206 Ga0207686_115482062 93
191 3300025938 Ga0207704_10395956 Ga0207704_103959562 93
192 3300025944 Ga0207661_10019004 Ga0207661_100190047 93
193 3300025944 Ga0207661_10492101 Ga0207661_104921013 93
194 3300025944 Ga0207661_10498536 Ga0207661_104985361 93
195 3300025944 Ga0207661_10981427 Ga0207661_109814271 93
196 3300025949 Ga0207667_10027994 Ga0207667_100279943 93
197 3300025949 Ga0207667_10590615 Ga0207667_105906152 93
198 3300025949 Ga0207667_11983936 Ga0207667_119839361 93
199 3300025960 Ga0207651_10619599 Ga0207651_106195991 93
200 3300025972 Ga0207668_11279500 Ga0207668_112795001 93
201 3300025981 Ga0207640_10004143 Ga0207640_1000414310 93
202 3300026035 Ga0207703_10000550 Ga0207703_1000055021 93
203 3300026041 Ga0207639_10137729 Ga0207639_101377292 93
204 3300026041 Ga0207639_10467192 Ga0207639_104671921 93
205 3300026041 Ga0207639_10613801 Ga0207639_106138011 93
206 3300026067 Ga0207678_10961517 Ga0207678_109615171 93
207 3300026078 Ga0207702_10005801 Ga0207702_100058015 93
208 3300026078 Ga0207702_11112260 Ga0207702_111122602 93
209 3300026078 Ga0207702_11440567 Ga0207702_114405671 93
210 3300026088 Ga0207641_10000129 Ga0207641_1000012919 93
211 3300026116 Ga0207674_12147418 Ga0207674_121474181 93
212 3300026142 Ga0207698_10014084 Ga0207698_100140843 93
213 3300026142 Ga0207698_10113649 Ga0207698_101136492 93
214 3300028379 Ga0268266_10000020 Ga0268266_10000020352 93
215 3300028563 Ga0265319_1268912 Ga0265319_12689121 93
216 3300035118 Ga0373954_0258807 Ga0373954_0258807_185_541 93
217 3300036401 Ga0373937_0111876 Ga0373937_0111876_322_678 93
218 3300037068 Ga0373925_0441689 Ga0373925_0441689_636_923 93
219 3300037312 Ga0395899_0147339 Ga0395899_0147339_1325_1606 93
220 3300037418 Ga0395900_0096429 Ga0395900_0096429_820_1101 93
221 3300037466 Ga0395898_0033415 Ga0395898_0033415_3950_4231 93
222 3300037471 Ga0395905_0213073 Ga0395905_0213073_758_1039 93
223 3300037853 Ga0436364_0032994 Ga0436364_0032994_216_536 93
224 3300038443 Ga0395901_0006844 Ga0395901_0006844_6711_6992 93
225 3300039437 Ga0436365_0365653 Ga0436365_0365653_2231_2518 93
226 3300039437 Ga0436365_1547213 Ga0436365_1547213_195_476 93
227 3300039437 Ga0436365_1765262 Ga0436365_1765262_190_477 93
228 3300039450 Ga0436363_0089964 Ga0436363_0089964_19183_19470 93
229 3300039450 Ga0436363_0359788 Ga0436363_0359788_156_437 93
230 3300039450 Ga0436363_1132971 Ga0436363_1132971_4846_5133 93
231 3300039453 Ga0436362_0517020 Ga0436362_0517020_56_343 93
232 3300041492 Ga0451835_0916340 Ga0451835_0916340_69_350 93
233 3300041505 Ga0451849_1193030 Ga0451849_1193030_110_391 93
234 3300041512 Ga0451853_0569307 Ga0451853_0569307_284_565 93
235 3300041512 Ga0451853_0848126 Ga0451853_0848126_122_409 93
236 3300041512 Ga0451853_1400461 Ga0451853_1400461_389_670 93
237 3300041512 Ga0451853_1656563 Ga0451853_1656563_161_448 93
238 3300041512 Ga0451853_3319123 Ga0451853_3319123_1118_1405 93
239 3300044656 Ga0466969_0451119 Ga0466969_0451119_114_401 93
240 3300044683 Ga0466965_0769580 Ga0466965_0769580_179_460 93
241 3300044684 Ga0466966_0018061 Ga0466966_0018061_1354_1635 93
242 3300044693 Ga0466961_0241261 Ga0466961_0241261_167_454 93
243 3300044694 Ga0466963_0213157 Ga0466963_0213157_23_304 93
244 3300044706 Ga0466964_0760115 Ga0466964_0760115_81_362 93
245 3300044735 Ga0466968_0014460 Ga0466968_0014460_503_784 93
246 3300044765 Ga0466970_0084032 Ga0466970_0084032_441_728 93
247 3300044765 Ga0466970_0542189 Ga0466970_0542189_34_315 93
248 3300044842 Ga0466957_0034219 Ga0466957_0034219_1528_1809 93
249 3300044842 Ga0466957_0440113 Ga0466957_0440113_45_326 93
250 3300045049 Ga0466959_0163072 Ga0466959_0163072_518_799 93
251 3300045836 Ga0466958_0020684 Ga0466958_0020684_1920_2201 93
252 3300045836 Ga0466958_0139320 Ga0466958_0139320_729_1016 93
253 3300045836 Ga0466958_0180238 Ga0466958_0180238_576_857 93
254 3300045976 Ga0466967_0327211 Ga0466967_0327211_1150_1437 93
255 3300045976 Ga0466967_0672769 Ga0466967_0672769_94_381 93
256 3300046454 Ga0495592_0111658 Ga0495592_0111658_1490_1777 93
257 3300046454 Ga0495592_0616442 Ga0495592_0616442_257_544 93
258 3300046455 Ga0495603_0072232 Ga0495603_0072232_121_408 93
259 3300046459 Ga0495629_0068338 Ga0495629_0068338_1311_1592 93
260 3300046461 Ga0495641_0000020 Ga0495641_0000020_61996_62283 93
261 3300046461 Ga0495641_0134849 Ga0495641_0134849_168_455 93
262 3300046461 Ga0495641_0430984 Ga0495641_0430984_275_556 93
263 3300046462 Ga0495651_0210877 Ga0495651_0210877_876_1163 93
264 3300046462 Ga0495651_0271761 Ga0495651_0271761_509_790 93
265 3300046463 Ga0495653_0627309 Ga0495653_0627309_272_553 93
266 3300046473 Ga0495582_0758244 Ga0495582_0758244_241_522 93
267 3300046477 Ga0495664_0263208 Ga0495664_0263208_496_777 93
268 3300046511 Ga0495608_0343954 Ga0495608_0343954_391_672 93
269 3300046514 Ga0495618_0250351 Ga0495618_0250351_763_1044 93
270 3300046514 Ga0495618_0643913 Ga0495618_0643913_32_319 93
271 3300046516 Ga0495628_0090383 Ga0495628_0090383_991_1278 93
272 3300046516 Ga0495628_0092749 Ga0495628_0092749_47_334 93
273 3300046516 Ga0495628_0118839 Ga0495628_0118839_10_291 93
274 3300046517 Ga0495630_0058904 Ga0495630_0058904_1424_1705 93
275 3300046517 Ga0495630_0079743 Ga0495630_0079743_1371_1652 93
276 3300046517 Ga0495630_0126697 Ga0495630_0126697_357_644 93
277 3300046517 Ga0495630_0215951 Ga0495630_0215951_1082_1363 93
278 3300046523 Ga0495644_0001940 Ga0495644_0001940_4627_4914 93
279 3300046526 Ga0495666_0370646 Ga0495666_0370646_192_479 93
280 3300046529 Ga0495652_0052238 Ga0495652_0052238_1518_1799 93
281 3300046529 Ga0495652_0411408 Ga0495652_0411408_334_621 93
282 3300046529 Ga0495652_0802764 Ga0495652_0802764_163_444 93
283 3300046533 Ga0495640_0017519 Ga0495640_0017519_1027_1314 93
284 3300046533 Ga0495640_0040026 Ga0495640_0040026_1952_2239 93
285 3300046533 Ga0495640_0113633 Ga0495640_0113633_931_1212 93
286 3300046533 Ga0495640_0229610 Ga0495640_0229610_621_902 93
287 3300046533 Ga0495640_0457807 Ga0495640_0457807_85_381 93
288 3300046535 Ga0495586_0000862 Ga0495586_0000862_1564_1851 93
289 3300046536 Ga0495587_0427281 Ga0495587_0427281_192_479 93
290 3300046543 Ga0495645_0063704 Ga0495645_0063704_960_1247 93
291 3300046642 Ga0495634_0049169 Ga0495634_0049169_1405_1692 93
292 3300046642 Ga0495634_0104830 Ga0495634_0104830_1215_1496 93
293 3300046663 Ga0495635_0000096 Ga0495635_0000096_36934_37221 93
294 3300046663 Ga0495635_0158081 Ga0495635_0158081_711_992 93
295 3300046663 Ga0495635_0736682 Ga0495635_0736682_134_415 93
296 3300046674 Ga0495588_0075686 Ga0495588_0075686_985_1272 93
297 3300046675 Ga0495657_0235242 Ga0495657_0235242_508_789 93
298 3300046678 Ga0495599_0011195 Ga0495599_0011195_3018_3299 93
299 3300046678 Ga0495599_0447296 Ga0495599_0447296_235_516 93
300 3300046680 Ga0495646_0049014 Ga0495646_0049014_129_410 93
301 3300046680 Ga0495646_0218825 Ga0495646_0218825_438_725 93
302 3300046680 Ga0495646_0584438 Ga0495646_0584438_25_306 93
303 3300046681 Ga0495647_0000015 Ga0495647_0000015_2949_3236 93
304 3300046681 Ga0495647_0009578 Ga0495647_0009578_1394_1681 93
305 3300046684 Ga0495669_0000103 Ga0495669_0000103_11431_11718 93
306 3300046689 Ga0495613_0284070 Ga0495613_0284070_565_846 93
307 3300046690 Ga0495624_0000012 Ga0495624_0000012_63715_64002 93
308 3300046690 Ga0495624_0004399 Ga0495624_0004399_3341_3628 93
309 3300046690 Ga0495624_0695875 Ga0495624_0695875_198_479 93
310 3300046690 Ga0495624_0870774 Ga0495624_0870774_220_501 93
311 3300046694 Ga0495649_0002521 Ga0495649_0002521_1757_2086 93
312 3300046809 Ga0495600_0000884 Ga0495600_0000884_8490_8777 93
313 3300046809 Ga0495600_0150814 Ga0495600_0150814_894_1181 93
314 3300047315 Ga0495581_0759628 Ga0495581_0759628_181_462 93
315 3300047317 Ga0495604_0000346 Ga0495604_0000346_27747_28034 93
316 3300047317 Ga0495604_0102506 Ga0495604_0102506_85_366 93
317 3300047317 Ga0495604_0104830 Ga0495604_0104830_617_904 93
318 3300047317 Ga0495604_0556226 Ga0495604_0556226_409_690 93
319 3300047319 Ga0495674_0000019 Ga0495674_0000019_97904_98191 93
320 3300047319 Ga0495674_0071519 Ga0495674_0071519_1255_1536 93
321 3300047319 Ga0495674_0459253 Ga0495674_0459253_468_749 93
322 3300047321 Ga0495676_0011083 Ga0495676_0011083_4923_5210 93
323 3300047321 Ga0495676_0268296 Ga0495676_0268296_193_480 93
324 3300047322 Ga0495680_0000952 Ga0495680_0000952_5217_5504 93
325 3300047322 Ga0495680_0023505 Ga0495680_0023505_3250_3579 93
326 3300047322 Ga0495680_0346101 Ga0495680_0346101_396_677 93
327 3300047322 Ga0495680_0686173 Ga0495680_0686173_90_371 93
328 3300047444 Ga0495675_0076715 Ga0495675_0076715_233_520 93
329 3300047447 Ga0495685_076956 Ga0495685_076956_77_364 93
330 3300047471 Ga0495684_0001796 Ga0495684_0001796_13832_14119 93
331 3300047471 Ga0495684_0088319 Ga0495684_0088319_1475_1756 93
332 3300047471 Ga0495684_0740544 Ga0495684_0740544_332_619 93
333 3300047673 Ga0495593_0152337 Ga0495593_0152337_380_667 93
334 3300048088 Ga0495602_0750793 Ga0495602_0750793_33_314 93
335 3300048903 Ga0496100_0000007 Ga0496100_0000007_172684_172971 93
336 3300048903 Ga0496100_0006520 Ga0496100_0006520_3252_3539 93
337 3300048904 Ga0496101_0000013 Ga0496101_0000013_172684_172971 93
338 3300048905 Ga0496102_0219597 Ga0496102_0219597_85_366 93
339 3300048906 Ga0496103_0702333 Ga0496103_0702333_313_594 93
340 3300048907 Ga0496104_0000013 Ga0496104_0000013_128006_128293 93
341 3300048907 Ga0496104_0017256 Ga0496104_0017256_6015_6296 93
342 3300048907 Ga0496104_0219606 Ga0496104_0219606_704_985 93
343 3300048908 Ga0496105_0000006 Ga0496105_0000006_268871_269158 93
344 3300048909 Ga0496106_0000006 Ga0496106_0000006_166823_167110 93
345 3300048910 Ga0496107_0000007 Ga0496107_0000007_166825_167112 93
346 3300048910 Ga0496107_0153993 Ga0496107_0153993_398_679 93
347 3300048912 Ga0496109_0461095 Ga0496109_0461095_275_556 93
348 3300048913 Ga0496110_0115110 Ga0496110_0115110_389_676 93
349 3300048914 Ga0496111_0307373 Ga0496111_0307373_563_844 93
350 3300048914 Ga0496111_1340092 Ga0496111_1340092_28_315 93
351 3300048915 Ga0496112_0006613 Ga0496112_0006613_9727_10008 93
352 3300048915 Ga0496112_0124746 Ga0496112_0124746_2050_2331 93
353 3300048917 Ga0496114_0610529 Ga0496114_0610529_666_947 93
354 3300048918 Ga0496115_0000010 Ga0496115_0000010_110436_110723 93
355 3300048918 Ga0496115_0003116 Ga0496115_0003116_8544_8831 93
356 3300049583 Ga0501067_0008083 Ga0501067_0008083_5548_5829 93
357 3300050509 nmdc:mga0qj67_762797_c1 nmdc:mga0qj67_762797_c1_279_566 93
358 3300053077 Ga0495601_0001553 Ga0495601_0001553_3125_3412 93
359 3300053077 Ga0495601_0078292 Ga0495601_0078292_1690_1971 93
360 3300053077 Ga0495601_0108103 Ga0495601_0108103_1313_1594 93
361 3300053077 Ga0495601_0312696 Ga0495601_0312696_262_558 93
362 3300053085 Ga0495619_0375983 Ga0495619_0375983_662_949 93
363 3300053085 Ga0495619_0786591 Ga0495619_0786591_290_571 93
364 3300053094 Ga0500566_0109900 Ga0500566_0109900_696_977 93
365 3300053122 Ga0500608_296117 Ga0500608_296117_48_335 93
366 3300053139 Ga0500568_0068538 Ga0500568_0068538_30_317 93
367 3300061734 Ga0530510_0543899 Ga0530510_0543899_416_697 93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.7317 2 93
6wxo-assembly1.cif.gz_B de novo tim barrel-ferredoxin fold fusion homodimer with 2-histidine 2-glutamate centre tfd-he 0.7241 4 77
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.7192 2 93
1y0h-assembly1.cif.gz_B structure of rv0793 from mycobacterium tuberculosis 0.7107 1 92
7nmm-assembly2.cif.gz_B complex of rice blast (magnaporthe oryzae) effector protein apikl2f with the host target shma94 from setaria italica 0.708 2 89
ID Description Score Start End Superfamily
1y0hB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7107 1 92 3.30.70.100
af_A0A1D6H675_50_147_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7101 34 65 3.30.70.330
af_Q8BG18_205_343_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7058 2 85 3.30.70.100
af_Q6EPT4_1_76_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7015 1 89 3.30.70.100
3bm7A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6987 1 89 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7W1N275-F1-model_v4 ABM domain-containing protein 0.9919 1 93
AF-A0A538FCT8-F1-model_v4 ABM domain-containing protein 0.9611 1 93
AF-A0A538FCT8-F1-model_v4 ABM domain-containing protein 0.9512 1 93
AF-A0A6I3L364-F1-model_v4 ABM domain-containing protein 0.9057 1 93
AF-A0A1F4RDW6-F1-model_v4 ABM domain-containing protein 0.9053 1 92

Feature Viewer

pLDDT pTM Quality
94.38 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map