F424470
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 367 | 185 | 367 | 94 |
Family's Representative Sequence
| Representative Sequence | 3300046533|Ga0495640_0457807|Ga0495640_0457807_85_381 |
| Length | 98 |
| Sequence | VKEGSMAVGIRIKLAGITQEQFDTGHDHINPDRTPPKGLIFHSSGPIEGGWGIIDFWESREDFDAFAARIPEGFAAAGVEPQGPPDVKEFPVHEMIRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 33 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 34 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 58 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 96 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 97 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 99 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 100 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 101 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 102 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 103 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 104 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 105 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 106 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 107 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 108 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 109 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 110 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 111 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 112 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 113 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 114 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 115 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 116 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 117 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 118 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 119 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 120 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 121 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 122 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 123 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 167 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 168 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 169 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 170 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 171 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 172 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 174 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 175 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 176 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 183 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 184 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 185 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.55 |
| Metatranscriptomes | 5.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.82 |
| Nodule | 0 |
| Rhizoplane | 5.72 |
| Rhizosphere | 89.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10018595 | 3300005327 | Bacteria | 5564 |
| 2 | Ga0070658_10096753 | 3300005327 | Bacteria | 2437 |
| 3 | Ga0070658_10168290 | 3300005327 | Bacteria | 1841 |
| 4 | Ga0070683_100011321 | 3300005329 | Bacteria | 7704 |
| 5 | Ga0070683_100024322 | 3300005329 | Bacteria | 5424 |
| 6 | Ga0070683_100128828 | 3300005329 | Bacteria | 2394 |
| 7 | Ga0070683_100399506 | 3300005329 | Unclassified | 1311 |
| 8 | Ga0070677_10000036 | 3300005333 | Bacteria | 40479 |
| 9 | Ga0070680_100053084 | 3300005336 | Bacteria | 3308 |
| 10 | Ga0070680_100167546 | 3300005336 | Bacteria | 1848 |
| 11 | Ga0070680_100297109 | 3300005336 | Unclassified | 1369 |
| 12 | Ga0070680_100440273 | 3300005336 | Bacteria | 1113 |
| 13 | Ga0070680_100449297 | 3300005336 | Bacteria | 1101 |
| 14 | Ga0070682_100000077 | 3300005337 | Bacteria | 89055 |
| 15 | Ga0070682_100066733 | 3300005337 | Bacteria | 2290 |
| 16 | Ga0070682_100682274 | 3300005337 | Unclassified | 821 |
| 17 | Ga0070682_101873966 | 3300005337 | Unclassified | 525 |
| 18 | Ga0068868_100675846 | 3300005338 | Unclassified | 921 |
| 19 | Ga0070660_100010145 | 3300005339 | Bacteria | 6646 |
| 20 | Ga0070660_100011845 | 3300005339 | Bacteria | 6215 |
| 21 | Ga0070660_100043874 | 3300005339 | Unclassified | 3418 |
| 22 | Ga0070660_100486726 | 3300005339 | Bacteria | 1025 |
| 23 | Ga0070661_100052485 | 3300005344 | Bacteria | 2984 |
| 24 | Ga0070661_100344035 | 3300005344 | Bacteria | 1169 |
| 25 | Ga0070661_101015094 | 3300005344 | Bacteria | 689 |
| 26 | Ga0070668_101229294 | 3300005347 | Bacteria | 679 |
| 27 | Ga0070671_100590718 | 3300005355 | Bacteria | 959 |
| 28 | Ga0070673_101199030 | 3300005364 | Unclassified | 711 |
| 29 | Ga0070659_100264383 | 3300005366 | Bacteria | 1428 |
| 30 | Ga0070659_100369971 | 3300005366 | Bacteria | 1206 |
| 31 | Ga0070659_100675559 | 3300005366 | Bacteria | 892 |
| 32 | Ga0070714_100180219 | 3300005435 | Bacteria | 1922 |
| 33 | Ga0070713_101444873 | 3300005436 | Bacteria | 667 |
| 34 | Ga0070711_101480552 | 3300005439 | Unclassified | 592 |
| 35 | Ga0070663_100763631 | 3300005455 | Bacteria | 826 |
| 36 | Ga0070681_10004539 | 3300005458 | Bacteria | 13251 |
| 37 | Ga0070681_10082596 | 3300005458 | Bacteria | 3168 |
| 38 | Ga0070681_10187168 | 3300005458 | Bacteria | 1990 |
| 39 | Ga0070681_10271679 | 3300005458 | Bacteria | 1607 |
| 40 | Ga0070681_10374349 | 3300005458 | Bacteria | 1335 |
| 41 | Ga0070681_12046589 | 3300005458 | Bacteria | 501 |
| 42 | Ga0070685_10705908 | 3300005466 | Unclassified | 736 |
| 43 | Ga0070679_100024219 | 3300005530 | Bacteria | 5948 |
| 44 | Ga0070679_100033225 | 3300005530 | Bacteria | 5108 |
| 45 | Ga0070679_100173753 | 3300005530 | Bacteria | 2127 |
| 46 | Ga0070679_100318172 | 3300005530 | Bacteria | 1505 |
| 47 | Ga0070679_100331826 | 3300005530 | Bacteria | 1469 |
| 48 | Ga0070679_101178392 | 3300005530 | Bacteria | 711 |
| 49 | Ga0070684_100039552 | 3300005535 | Bacteria | 4057 |
| 50 | Ga0070684_100049226 | 3300005535 | Bacteria | 3657 |
| 51 | Ga0070684_100056147 | 3300005535 | Bacteria | 3435 |
| 52 | Ga0070684_100685943 | 3300005535 | Unclassified | 954 |
| 53 | Ga0068853_100395893 | 3300005539 | Bacteria | 1292 |
| 54 | Ga0068853_101174802 | 3300005539 | Unclassified | 741 |
| 55 | Ga0070693_100331529 | 3300005547 | Unclassified | 1036 |
| 56 | Ga0070693_100622675 | 3300005547 | Bacteria | 782 |
| 57 | Ga0070665_100000068 | 3300005548 | Bacteria | 204531 |
| 58 | Ga0068855_100011027 | 3300005563 | Bacteria | 10909 |
| 59 | Ga0068855_100029808 | 3300005563 | Bacteria | 6524 |
| 60 | Ga0068855_100039683 | 3300005563 | Bacteria | 5589 |
| 61 | Ga0068855_101186253 | 3300005563 | Unclassified | 794 |
| 62 | Ga0070664_100275398 | 3300005564 | Unclassified | 1517 |
| 63 | Ga0068857_101616396 | 3300005577 | Bacteria | 633 |
| 64 | Ga0068856_100042376 | 3300005614 | Bacteria | 4477 |
| 65 | Ga0068856_100155277 | 3300005614 | Bacteria | 2298 |
| 66 | Ga0068856_102669511 | 3300005614 | Bacteria | 505 |
| 67 | Ga0068852_100055263 | 3300005616 | Bacteria | 3426 |
| 68 | Ga0068852_100073517 | 3300005616 | Bacteria | 3008 |
| 69 | Ga0068852_100102373 | 3300005616 | Bacteria | 2587 |
| 70 | Ga0068863_100000004 | 3300005841 | Bacteria | 272478 |
| 71 | Ga0068858_100000012 | 3300005842 | Bacteria | 216931 |
| 72 | Ga0097621_102197705 | 3300006237 | Bacteria | 528 |
| 73 | Ga0068871_101092315 | 3300006358 | Unclassified | 746 |
| 74 | Ga0075430_100597795 | 3300006846 | Bacteria | 910 |
| 75 | Ga0068865_100363973 | 3300006881 | Bacteria | 1175 |
| 76 | Ga0105240_10002982 | 3300009093 | Bacteria | 26627 |
| 77 | Ga0105240_10007770 | 3300009093 | Bacteria | 15505 |
| 78 | Ga0105240_10291895 | 3300009093 | Bacteria | 1869 |
| 79 | Ga0105240_10328669 | 3300009093 | Bacteria | 1740 |
| 80 | Ga0105240_10430839 | 3300009093 | Unclassified | 1480 |
| 81 | Ga0105240_10696090 | 3300009093 | Bacteria | 1110 |
| 82 | Ga0105240_11682491 | 3300009093 | Unclassified | 663 |
| 83 | Ga0105245_10006036 | 3300009098 | Bacteria | 10649 |
| 84 | Ga0105245_10242643 | 3300009098 | Bacteria | 1747 |
| 85 | Ga0105243_11647156 | 3300009148 | Unclassified | 669 |
| 86 | Ga0105241_10260509 | 3300009174 | Bacteria | 1473 |
| 87 | Ga0105241_10762101 | 3300009174 | Bacteria | 888 |
| 88 | Ga0105242_10889020 | 3300009176 | Bacteria | 890 |
| 89 | Ga0105237_10202129 | 3300009545 | Bacteria | 1987 |
| 90 | Ga0105237_10600451 | 3300009545 | Bacteria | 1108 |
| 91 | Ga0105238_10000023 | 3300009551 | Bacteria | 196844 |
| 92 | Ga0105238_10578425 | 3300009551 | Bacteria | 1129 |
| 93 | Ga0105238_11392123 | 3300009551 | Bacteria | 728 |
| 94 | Ga0105239_10359280 | 3300010375 | Bacteria | 1645 |
| 95 | Ga0105239_10976170 | 3300010375 | Unclassified | 974 |
| 96 | Ga0105239_12178503 | 3300010375 | Bacteria | 644 |
| 97 | Ga0105239_12347058 | 3300010375 | Bacteria | 621 |
| 98 | Ga0157373_10055667 | 3300013100 | Bacteria | 2809 |
| 99 | Ga0157373_10058098 | 3300013100 | Bacteria | 2743 |
| 100 | Ga0157371_10048261 | 3300013102 | Unclassified | 3026 |
| 101 | Ga0157371_10313675 | 3300013102 | Bacteria | 1137 |
| 102 | Ga0157370_10026478 | 3300013104 | Bacteria | 5726 |
| 103 | Ga0157370_10046263 | 3300013104 | Bacteria | 4172 |
| 104 | Ga0157370_10121894 | 3300013104 | Bacteria | 2435 |
| 105 | Ga0157370_10364884 | 3300013104 | Bacteria | 1331 |
| 106 | Ga0157369_10059134 | 3300013105 | Bacteria | 4134 |
| 107 | Ga0157369_10067585 | 3300013105 | Bacteria | 3842 |
| 108 | Ga0157369_10074490 | 3300013105 | Bacteria | 3641 |
| 109 | Ga0157369_10441280 | 3300013105 | Unclassified | 1348 |
| 110 | Ga0157369_10496980 | 3300013105 | Bacteria | 1262 |
| 111 | Ga0157369_10666704 | 3300013105 | Bacteria | 1072 |
| 112 | Ga0157369_11373977 | 3300013105 | Bacteria | 719 |
| 113 | Ga0157374_10085787 | 3300013296 | Bacteria | 2995 |
| 114 | Ga0157378_12036256 | 3300013297 | Unclassified | 624 |
| 115 | Ga0157378_13234670 | 3300013297 | Bacteria | 506 |
| 116 | Ga0157372_10020035 | 3300013307 | Bacteria | 7212 |
| 117 | Ga0157372_10409206 | 3300013307 | Bacteria | 1581 |
| 118 | Ga0157372_10556516 | 3300013307 | Bacteria | 1337 |
| 119 | Ga0157372_10906463 | 3300013307 | Bacteria | 1023 |
| 120 | Ga0157372_11037763 | 3300013307 | Bacteria | 949 |
| 121 | Ga0157375_10093950 | 3300013308 | Bacteria | 3066 |
| 122 | Ga0157375_11123521 | 3300013308 | Unclassified | 920 |
| 123 | Ga0157375_11729708 | 3300013308 | Bacteria | 741 |
| 124 | Ga0157375_13221948 | 3300013308 | Unclassified | 544 |
| 125 | Ga0163163_11768532 | 3300014325 | Bacteria | 678 |
| 126 | Ga0157380_10632393 | 3300014326 | Bacteria | 1064 |
| 127 | Ga0157377_11012907 | 3300014745 | Unclassified | 630 |
| 128 | Ga0157379_11825326 | 3300014968 | Unclassified | 598 |
| 129 | Ga0163161_10158314 | 3300017792 | Bacteria | 1725 |
| 130 | Ga0163161_11212664 | 3300017792 | Bacteria | 653 |
| 131 | Ga0197907_10032597 | 3300020069 | Bacteria | 1373 |
| 132 | Ga0197907_11345511 | 3300020069 | Unclassified | 861 |
| 133 | Ga0197907_11399183 | 3300020069 | Bacteria | 3626 |
| 134 | Ga0206356_10596004 | 3300020070 | Bacteria | 2000 |
| 135 | Ga0206356_10644984 | 3300020070 | Bacteria | 1196 |
| 136 | Ga0206356_10938258 | 3300020070 | Bacteria | 2712 |
| 137 | Ga0206356_11719383 | 3300020070 | Bacteria | 3220 |
| 138 | Ga0206351_10582789 | 3300020077 | Bacteria | 568 |
| 139 | Ga0206352_10703191 | 3300020078 | Bacteria | 555 |
| 140 | Ga0206352_11051728 | 3300020078 | Bacteria | 958 |
| 141 | Ga0206354_10731695 | 3300020081 | Bacteria | 1492 |
| 142 | Ga0206354_11678193 | 3300020081 | Bacteria | 986 |
| 143 | Ga0206353_10060218 | 3300020082 | Bacteria | 1008 |
| 144 | Ga0206353_10259637 | 3300020082 | Bacteria | 1873 |
| 145 | Ga0206353_11338531 | 3300020082 | Bacteria | 1205 |
| 146 | Ga0206353_11366025 | 3300020082 | Bacteria | 2724 |
| 147 | Ga0206353_11609755 | 3300020082 | Unclassified | 503 |
| 148 | Ga0154015_1011781 | 3300020610 | Unclassified | 3150 |
| 149 | Ga0224712_10024639 | 3300022467 | Bacteria | 2105 |
| 150 | Ga0224712_10587496 | 3300022467 | Unclassified | 543 |
| 151 | Ga0207705_10160323 | 3300025909 | Bacteria | 1689 |
| 152 | Ga0207705_10186912 | 3300025909 | Bacteria | 1565 |
| 153 | Ga0207705_11516427 | 3300025909 | Unclassified | 507 |
| 154 | Ga0207654_11004136 | 3300025911 | Unclassified | 607 |
| 155 | Ga0207707_10120369 | 3300025912 | Unclassified | 2295 |
| 156 | Ga0207707_10155269 | 3300025912 | Bacteria | 2001 |
| 157 | Ga0207707_10276379 | 3300025912 | Bacteria | 1455 |
| 158 | Ga0207707_10391248 | 3300025912 | Bacteria | 1194 |
| 159 | Ga0207707_11581695 | 3300025912 | Unclassified | 517 |
| 160 | Ga0207695_10039475 | 3300025913 | Bacteria | 5074 |
| 161 | Ga0207695_10103172 | 3300025913 | Bacteria | 2844 |
| 162 | Ga0207695_10364292 | 3300025913 | Bacteria | 1332 |
| 163 | Ga0207695_10613473 | 3300025913 | Unclassified | 969 |
| 164 | Ga0207671_10282570 | 3300025914 | Bacteria | 1309 |
| 165 | Ga0207671_10814669 | 3300025914 | Unclassified | 740 |
| 166 | Ga0207663_11461859 | 3300025916 | Unclassified | 550 |
| 167 | Ga0207660_10076125 | 3300025917 | Bacteria | 2453 |
| 168 | Ga0207660_10390554 | 3300025917 | Bacteria | 1120 |
| 169 | Ga0207660_10510048 | 3300025917 | Bacteria | 976 |
| 170 | Ga0207657_10003156 | 3300025919 | Bacteria | 17625 |
| 171 | Ga0207657_10006023 | 3300025919 | Bacteria | 12613 |
| 172 | Ga0207657_10007923 | 3300025919 | Bacteria | 10833 |
| 173 | Ga0207657_10051827 | 3300025919 | Bacteria | 3566 |
| 174 | Ga0207649_10009900 | 3300025920 | Bacteria | 5225 |
| 175 | Ga0207649_10218566 | 3300025920 | Bacteria | 1356 |
| 176 | Ga0207649_11538558 | 3300025920 | Unclassified | 526 |
| 177 | Ga0207652_10024104 | 3300025921 | Bacteria | 5046 |
| 178 | Ga0207652_10149768 | 3300025921 | Bacteria | 2089 |
| 179 | Ga0207652_10258953 | 3300025921 | Unclassified | 1569 |
| 180 | Ga0207652_10793029 | 3300025921 | Bacteria | 841 |
| 181 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 182 | Ga0207694_10213709 | 3300025924 | Unclassified | 1572 |
| 183 | Ga0207687_10001320 | 3300025927 | Bacteria | 16975 |
| 184 | Ga0207687_10273674 | 3300025927 | Unclassified | 1351 |
| 185 | Ga0207700_10779213 | 3300025928 | Unclassified | 855 |
| 186 | Ga0207644_10528485 | 3300025931 | Bacteria | 975 |
| 187 | Ga0207690_10508043 | 3300025932 | Bacteria | 975 |
| 188 | Ga0207690_11007002 | 3300025932 | Bacteria | 693 |
| 189 | Ga0207686_11548206 | 3300025934 | Unclassified | 547 |
| 190 | Ga0207709_11357629 | 3300025935 | Unclassified | 588 |
| 191 | Ga0207704_10395956 | 3300025938 | Bacteria | 1088 |
| 192 | Ga0207661_10019004 | 3300025944 | Bacteria | 5114 |
| 193 | Ga0207661_10492101 | 3300025944 | Unclassified | 1120 |
| 194 | Ga0207661_10498536 | 3300025944 | Bacteria | 1112 |
| 195 | Ga0207661_10981427 | 3300025944 | Bacteria | 778 |
| 196 | Ga0207667_10027994 | 3300025949 | Bacteria | 6125 |
| 197 | Ga0207667_10590615 | 3300025949 | Unclassified | 1120 |
| 198 | Ga0207667_11983936 | 3300025949 | Unclassified | 542 |
| 199 | Ga0207651_10619599 | 3300025960 | Bacteria | 948 |
| 200 | Ga0207668_11279500 | 3300025972 | Bacteria | 660 |
| 201 | Ga0207640_10004143 | 3300025981 | Bacteria | 7834 |
| 202 | Ga0207703_10000550 | 3300026035 | Bacteria | 38556 |
| 203 | Ga0207639_10137729 | 3300026041 | Bacteria | 2030 |
| 204 | Ga0207639_10467192 | 3300026041 | Bacteria | 1148 |
| 205 | Ga0207639_10613801 | 3300026041 | Bacteria | 1004 |
| 206 | Ga0207678_10961517 | 3300026067 | Unclassified | 756 |
| 207 | Ga0207702_10005801 | 3300026078 | Bacteria | 10739 |
| 208 | Ga0207702_11112260 | 3300026078 | Bacteria | 784 |
| 209 | Ga0207702_11440567 | 3300026078 | Bacteria | 682 |
| 210 | Ga0207641_10000129 | 3300026088 | Bacteria | 110871 |
| 211 | Ga0207674_12147418 | 3300026116 | Unclassified | 522 |
| 212 | Ga0207698_10014084 | 3300026142 | Bacteria | 5302 |
| 213 | Ga0207698_10113649 | 3300026142 | Bacteria | 2275 |
| 214 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 215 | Ga0265319_1268912 | 3300028563 | Bacteria | 519 |
| 216 | Ga0373954_0258807 | 3300035118 | Bacteria | 857 |
| 217 | Ga0373937_0111876 | 3300036401 | Bacteria | 2540 |
| 218 | Ga0373925_0441689 | 3300037068 | Bacteria | 1065 |
| 219 | Ga0395899_0147339 | 3300037312 | Bacteria | 1670 |
| 220 | Ga0395900_0096429 | 3300037418 | Bacteria | 3038 |
| 221 | Ga0395898_0033415 | 3300037466 | Bacteria | 5133 |
| 222 | Ga0395905_0213073 | 3300037471 | Bacteria | 1809 |
| 223 | Ga0436364_0032994 | 3300037853 | Unclassified | 554 |
| 224 | Ga0395901_0006844 | 3300038443 | Bacteria | 11515 |
| 225 | Ga0436365_0365653 | 3300039437 | Bacteria | 21300 |
| 226 | Ga0436365_1547213 | 3300039437 | Bacteria | 645 |
| 227 | Ga0436365_1765262 | 3300039437 | Bacteria | 941 |
| 228 | Ga0436363_0089964 | 3300039450 | Bacteria | 22178 |
| 229 | Ga0436363_0359788 | 3300039450 | Bacteria | 599 |
| 230 | Ga0436363_1132971 | 3300039450 | Bacteria | 5546 |
| 231 | Ga0436362_0517020 | 3300039453 | Bacteria | 636 |
| 232 | Ga0451835_0916340 | 3300041492 | Unclassified | 573 |
| 233 | Ga0451849_1193030 | 3300041505 | Bacteria | 1129 |
| 234 | Ga0451853_0569307 | 3300041512 | Bacteria | 736 |
| 235 | Ga0451853_0848126 | 3300041512 | Unclassified | 547 |
| 236 | Ga0451853_1400461 | 3300041512 | Unclassified | 762 |
| 237 | Ga0451853_1656563 | 3300041512 | Bacteria | 688 |
| 238 | Ga0451853_3319123 | 3300041512 | Bacteria | 3674 |
| 239 | Ga0466969_0451119 | 3300044656 | Unclassified | 585 |
| 240 | Ga0466965_0769580 | 3300044683 | Bacteria | 556 |
| 241 | Ga0466966_0018061 | 3300044684 | Bacteria | 4656 |
| 242 | Ga0466961_0241261 | 3300044693 | Bacteria | 1111 |
| 243 | Ga0466963_0213157 | 3300044694 | Unclassified | 1352 |
| 244 | Ga0466964_0760115 | 3300044706 | Unclassified | 545 |
| 245 | Ga0466968_0014460 | 3300044735 | Bacteria | 3120 |
| 246 | Ga0466970_0084032 | 3300044765 | Bacteria | 1723 |
| 247 | Ga0466970_0542189 | 3300044765 | Bacteria | 672 |
| 248 | Ga0466957_0034219 | 3300044842 | Unclassified | 3049 |
| 249 | Ga0466957_0440113 | 3300044842 | Bacteria | 897 |
| 250 | Ga0466959_0163072 | 3300045049 | Bacteria | 1566 |
| 251 | Ga0466958_0020684 | 3300045836 | Bacteria | 3840 |
| 252 | Ga0466958_0139320 | 3300045836 | Bacteria | 1527 |
| 253 | Ga0466958_0180238 | 3300045836 | Bacteria | 1340 |
| 254 | Ga0466967_0327211 | 3300045976 | Bacteria | 1479 |
| 255 | Ga0466967_0672769 | 3300045976 | Unclassified | 1024 |
| 256 | Ga0495592_0111658 | 3300046454 | Bacteria | 1934 |
| 257 | Ga0495592_0616442 | 3300046454 | Bacteria | 660 |
| 258 | Ga0495603_0072232 | 3300046455 | Bacteria | 2027 |
| 259 | Ga0495629_0068338 | 3300046459 | Bacteria | 2479 |
| 260 | Ga0495641_0000020 | 3300046461 | Bacteria | 115404 |
| 261 | Ga0495641_0134849 | 3300046461 | Unclassified | 1102 |
| 262 | Ga0495641_0430984 | 3300046461 | Bacteria | 599 |
| 263 | Ga0495651_0210877 | 3300046462 | Bacteria | 1352 |
| 264 | Ga0495651_0271761 | 3300046462 | Unclassified | 1149 |
| 265 | Ga0495653_0627309 | 3300046463 | Unclassified | 658 |
| 266 | Ga0495582_0758244 | 3300046473 | Bacteria | 561 |
| 267 | Ga0495664_0263208 | 3300046477 | Unclassified | 1042 |
| 268 | Ga0495608_0343954 | 3300046511 | Bacteria | 919 |
| 269 | Ga0495618_0250351 | 3300046514 | Bacteria | 1111 |
| 270 | Ga0495618_0643913 | 3300046514 | Unclassified | 627 |
| 271 | Ga0495628_0090383 | 3300046516 | Bacteria | 2371 |
| 272 | Ga0495628_0092749 | 3300046516 | Bacteria | 2336 |
| 273 | Ga0495628_0118839 | 3300046516 | Bacteria | 2029 |
| 274 | Ga0495630_0058904 | 3300046517 | Bacteria | 2880 |
| 275 | Ga0495630_0079743 | 3300046517 | Bacteria | 2469 |
| 276 | Ga0495630_0126697 | 3300046517 | Bacteria | 1938 |
| 277 | Ga0495630_0215951 | 3300046517 | Bacteria | 1464 |
| 278 | Ga0495644_0001940 | 3300046523 | Bacteria | 8307 |
| 279 | Ga0495666_0370646 | 3300046526 | Unclassified | 644 |
| 280 | Ga0495652_0052238 | 3300046529 | Bacteria | 3487 |
| 281 | Ga0495652_0411408 | 3300046529 | Bacteria | 955 |
| 282 | Ga0495652_0802764 | 3300046529 | Unclassified | 626 |
| 283 | Ga0495640_0017519 | 3300046533 | Bacteria | 5337 |
| 284 | Ga0495640_0040026 | 3300046533 | Bacteria | 3285 |
| 285 | Ga0495640_0113633 | 3300046533 | Bacteria | 1766 |
| 286 | Ga0495640_0229610 | 3300046533 | Bacteria | 1168 |
| 287 | Ga0495640_0457807 | 3300046533 | Bacteria | 779 |
| 288 | Ga0495586_0000862 | 3300046535 | Bacteria | 17412 |
| 289 | Ga0495587_0427281 | 3300046536 | Unclassified | 735 |
| 290 | Ga0495645_0063704 | 3300046543 | Bacteria | 2669 |
| 291 | Ga0495634_0049169 | 3300046642 | Bacteria | 2837 |
| 292 | Ga0495634_0104830 | 3300046642 | Bacteria | 1823 |
| 293 | Ga0495635_0000096 | 3300046663 | Bacteria | 52204 |
| 294 | Ga0495635_0158081 | 3300046663 | Bacteria | 1542 |
| 295 | Ga0495635_0736682 | 3300046663 | Unclassified | 638 |
| 296 | Ga0495588_0075686 | 3300046674 | Bacteria | 1754 |
| 297 | Ga0495657_0235242 | 3300046675 | Bacteria | 1107 |
| 298 | Ga0495599_0011195 | 3300046678 | Bacteria | 5508 |
| 299 | Ga0495599_0447296 | 3300046678 | Unclassified | 765 |
| 300 | Ga0495646_0049014 | 3300046680 | Bacteria | 2564 |
| 301 | Ga0495646_0218825 | 3300046680 | Bacteria | 1031 |
| 302 | Ga0495646_0584438 | 3300046680 | Unclassified | 568 |
| 303 | Ga0495647_0000015 | 3300046681 | Bacteria | 86790 |
| 304 | Ga0495647_0009578 | 3300046681 | Bacteria | 3284 |
| 305 | Ga0495669_0000103 | 3300046684 | Bacteria | 53749 |
| 306 | Ga0495613_0284070 | 3300046689 | Bacteria | 1148 |
| 307 | Ga0495624_0000012 | 3300046690 | Bacteria | 124128 |
| 308 | Ga0495624_0004399 | 3300046690 | Bacteria | 10309 |
| 309 | Ga0495624_0695875 | 3300046690 | Unclassified | 603 |
| 310 | Ga0495624_0870774 | 3300046690 | Unclassified | 531 |
| 311 | Ga0495649_0002521 | 3300046694 | Bacteria | 12845 |
| 312 | Ga0495600_0000884 | 3300046809 | Bacteria | 16029 |
| 313 | Ga0495600_0150814 | 3300046809 | Bacteria | 1505 |
| 314 | Ga0495581_0759628 | 3300047315 | Unclassified | 557 |
| 315 | Ga0495604_0000346 | 3300047317 | Bacteria | 41587 |
| 316 | Ga0495604_0102506 | 3300047317 | Bacteria | 2101 |
| 317 | Ga0495604_0104830 | 3300047317 | Bacteria | 2071 |
| 318 | Ga0495604_0556226 | 3300047317 | Unclassified | 739 |
| 319 | Ga0495674_0000019 | 3300047319 | Bacteria | 185107 |
| 320 | Ga0495674_0071519 | 3300047319 | Bacteria | 2994 |
| 321 | Ga0495674_0459253 | 3300047319 | Bacteria | 1022 |
| 322 | Ga0495676_0011083 | 3300047321 | Bacteria | 8146 |
| 323 | Ga0495676_0268296 | 3300047321 | Bacteria | 1159 |
| 324 | Ga0495680_0000952 | 3300047322 | Bacteria | 32176 |
| 325 | Ga0495680_0023505 | 3300047322 | Bacteria | 5122 |
| 326 | Ga0495680_0346101 | 3300047322 | Bacteria | 1036 |
| 327 | Ga0495680_0686173 | 3300047322 | Bacteria | 678 |
| 328 | Ga0495675_0076715 | 3300047444 | Bacteria | 2106 |
| 329 | Ga0495685_076956 | 3300047447 | Unclassified | 1113 |
| 330 | Ga0495684_0001796 | 3300047471 | Bacteria | 17236 |
| 331 | Ga0495684_0088319 | 3300047471 | Bacteria | 2349 |
| 332 | Ga0495684_0740544 | 3300047471 | Bacteria | 648 |
| 333 | Ga0495593_0152337 | 3300047673 | Bacteria | 1169 |
| 334 | Ga0495602_0750793 | 3300048088 | Unclassified | 658 |
| 335 | Ga0496100_0000007 | 3300048903 | Bacteria | 261266 |
| 336 | Ga0496100_0006520 | 3300048903 | Bacteria | 6367 |
| 337 | Ga0496101_0000013 | 3300048904 | Bacteria | 261266 |
| 338 | Ga0496102_0219597 | 3300048905 | Bacteria | 1792 |
| 339 | Ga0496103_0702333 | 3300048906 | Bacteria | 641 |
| 340 | Ga0496104_0000013 | 3300048907 | Bacteria | 397163 |
| 341 | Ga0496104_0017256 | 3300048907 | Bacteria | 6570 |
| 342 | Ga0496104_0219606 | 3300048907 | Bacteria | 1813 |
| 343 | Ga0496105_0000006 | 3300048908 | Bacteria | 393578 |
| 344 | Ga0496106_0000006 | 3300048909 | Bacteria | 251855 |
| 345 | Ga0496107_0000007 | 3300048910 | Bacteria | 257113 |
| 346 | Ga0496107_0153993 | 3300048910 | Unclassified | 1701 |
| 347 | Ga0496109_0461095 | 3300048912 | Bacteria | 1200 |
| 348 | Ga0496110_0115110 | 3300048913 | Bacteria | 2420 |
| 349 | Ga0496111_0307373 | 3300048914 | Bacteria | 1175 |
| 350 | Ga0496111_1340092 | 3300048914 | Bacteria | 503 |
| 351 | Ga0496112_0006613 | 3300048915 | Bacteria | 10205 |
| 352 | Ga0496112_0124746 | 3300048915 | Bacteria | 2546 |
| 353 | Ga0496114_0610529 | 3300048917 | Bacteria | 961 |
| 354 | Ga0496115_0000010 | 3300048918 | Bacteria | 227112 |
| 355 | Ga0496115_0003116 | 3300048918 | Bacteria | 11918 |
| 356 | Ga0501067_0008083 | 3300049583 | Bacteria | 5846 |
| 357 | nmdc:mga0qj67_762797_c1 | 3300050509 | Bacteria | 767 |
| 358 | Ga0495601_0001553 | 3300053077 | Bacteria | 12686 |
| 359 | Ga0495601_0078292 | 3300053077 | Bacteria | 2118 |
| 360 | Ga0495601_0108103 | 3300053077 | Bacteria | 1799 |
| 361 | Ga0495601_0312696 | 3300053077 | Unclassified | 1023 |
| 362 | Ga0495619_0375983 | 3300053085 | Bacteria | 982 |
| 363 | Ga0495619_0786591 | 3300053085 | Unclassified | 644 |
| 364 | Ga0500566_0109900 | 3300053094 | Bacteria | 1500 |
| 365 | Ga0500608_296117 | 3300053122 | Bacteria | 603 |
| 366 | Ga0500568_0068538 | 3300053139 | Bacteria | 1362 |
| 367 | Ga0530510_0543899 | 3300061734 | Bacteria | 882 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005336 | Ga0070680_100167546 | Ga0070680_1001675464 | 82 |
| 2 | 3300025935 | Ga0207709_11357629 | Ga0207709_113576291 | 87 |
| 3 | 3300009093 | Ga0105240_11682491 | Ga0105240_116824911 | 92 |
| 4 | 3300005327 | Ga0070658_10018595 | Ga0070658_100185953 | 93 |
| 5 | 3300005327 | Ga0070658_10096753 | Ga0070658_100967531 | 93 |
| 6 | 3300005327 | Ga0070658_10168290 | Ga0070658_101682901 | 93 |
| 7 | 3300005329 | Ga0070683_100011321 | Ga0070683_1000113216 | 93 |
| 8 | 3300005329 | Ga0070683_100024322 | Ga0070683_1000243223 | 93 |
| 9 | 3300005329 | Ga0070683_100128828 | Ga0070683_1001288282 | 93 |
| 10 | 3300005329 | Ga0070683_100399506 | Ga0070683_1003995062 | 93 |
| 11 | 3300005333 | Ga0070677_10000036 | Ga0070677_100000364 | 93 |
| 12 | 3300005336 | Ga0070680_100053084 | Ga0070680_1000530844 | 93 |
| 13 | 3300005336 | Ga0070680_100297109 | Ga0070680_1002971091 | 93 |
| 14 | 3300005336 | Ga0070680_100440273 | Ga0070680_1004402732 | 93 |
| 15 | 3300005336 | Ga0070680_100449297 | Ga0070680_1004492972 | 93 |
| 16 | 3300005337 | Ga0070682_100000077 | Ga0070682_10000007785 | 93 |
| 17 | 3300005337 | Ga0070682_100066733 | Ga0070682_1000667332 | 93 |
| 18 | 3300005337 | Ga0070682_100682274 | Ga0070682_1006822741 | 93 |
| 19 | 3300005337 | Ga0070682_101873966 | Ga0070682_1018739662 | 93 |
| 20 | 3300005338 | Ga0068868_100675846 | Ga0068868_1006758462 | 93 |
| 21 | 3300005339 | Ga0070660_100010145 | Ga0070660_1000101455 | 93 |
| 22 | 3300005339 | Ga0070660_100011845 | Ga0070660_1000118458 | 93 |
| 23 | 3300005339 | Ga0070660_100043874 | Ga0070660_1000438743 | 93 |
| 24 | 3300005339 | Ga0070660_100486726 | Ga0070660_1004867262 | 93 |
| 25 | 3300005344 | Ga0070661_100052485 | Ga0070661_1000524852 | 93 |
| 26 | 3300005344 | Ga0070661_100344035 | Ga0070661_1003440351 | 93 |
| 27 | 3300005344 | Ga0070661_101015094 | Ga0070661_1010150941 | 93 |
| 28 | 3300005347 | Ga0070668_101229294 | Ga0070668_1012292941 | 93 |
| 29 | 3300005355 | Ga0070671_100590718 | Ga0070671_1005907181 | 93 |
| 30 | 3300005364 | Ga0070673_101199030 | Ga0070673_1011990302 | 93 |
| 31 | 3300005366 | Ga0070659_100264383 | Ga0070659_1002643831 | 93 |
| 32 | 3300005366 | Ga0070659_100369971 | Ga0070659_1003699712 | 93 |
| 33 | 3300005366 | Ga0070659_100675559 | Ga0070659_1006755592 | 93 |
| 34 | 3300005435 | Ga0070714_100180219 | Ga0070714_1001802193 | 93 |
| 35 | 3300005436 | Ga0070713_101444873 | Ga0070713_1014448732 | 93 |
| 36 | 3300005439 | Ga0070711_101480552 | Ga0070711_1014805522 | 93 |
| 37 | 3300005455 | Ga0070663_100763631 | Ga0070663_1007636312 | 93 |
| 38 | 3300005458 | Ga0070681_10004539 | Ga0070681_100045398 | 93 |
| 39 | 3300005458 | Ga0070681_10082596 | Ga0070681_100825962 | 93 |
| 40 | 3300005458 | Ga0070681_10187168 | Ga0070681_101871682 | 93 |
| 41 | 3300005458 | Ga0070681_10271679 | Ga0070681_102716792 | 93 |
| 42 | 3300005458 | Ga0070681_10374349 | Ga0070681_103743492 | 93 |
| 43 | 3300005458 | Ga0070681_12046589 | Ga0070681_120465891 | 93 |
| 44 | 3300005466 | Ga0070685_10705908 | Ga0070685_107059082 | 93 |
| 45 | 3300005530 | Ga0070679_100024219 | Ga0070679_1000242198 | 93 |
| 46 | 3300005530 | Ga0070679_100033225 | Ga0070679_1000332255 | 93 |
| 47 | 3300005530 | Ga0070679_100173753 | Ga0070679_1001737532 | 93 |
| 48 | 3300005530 | Ga0070679_100318172 | Ga0070679_1003181722 | 93 |
| 49 | 3300005530 | Ga0070679_100331826 | Ga0070679_1003318261 | 93 |
| 50 | 3300005530 | Ga0070679_101178392 | Ga0070679_1011783922 | 93 |
| 51 | 3300005535 | Ga0070684_100039552 | Ga0070684_1000395525 | 93 |
| 52 | 3300005535 | Ga0070684_100049226 | Ga0070684_1000492265 | 93 |
| 53 | 3300005535 | Ga0070684_100056147 | Ga0070684_1000561473 | 93 |
| 54 | 3300005535 | Ga0070684_100685943 | Ga0070684_1006859432 | 93 |
| 55 | 3300005539 | Ga0068853_100395893 | Ga0068853_1003958931 | 93 |
| 56 | 3300005539 | Ga0068853_101174802 | Ga0068853_1011748022 | 93 |
| 57 | 3300005547 | Ga0070693_100331529 | Ga0070693_1003315292 | 93 |
| 58 | 3300005547 | Ga0070693_100622675 | Ga0070693_1006226751 | 93 |
| 59 | 3300005548 | Ga0070665_100000068 | Ga0070665_10000006850 | 93 |
| 60 | 3300005563 | Ga0068855_100011027 | Ga0068855_1000110276 | 93 |
| 61 | 3300005563 | Ga0068855_100029808 | Ga0068855_1000298084 | 93 |
| 62 | 3300005563 | Ga0068855_100039683 | Ga0068855_1000396834 | 93 |
| 63 | 3300005563 | Ga0068855_101186253 | Ga0068855_1011862532 | 93 |
| 64 | 3300005564 | Ga0070664_100275398 | Ga0070664_1002753982 | 93 |
| 65 | 3300005577 | Ga0068857_101616396 | Ga0068857_1016163961 | 93 |
| 66 | 3300005614 | Ga0068856_100042376 | Ga0068856_1000423762 | 93 |
| 67 | 3300005614 | Ga0068856_100155277 | Ga0068856_1001552773 | 93 |
| 68 | 3300005614 | Ga0068856_102669511 | Ga0068856_1026695111 | 93 |
| 69 | 3300005616 | Ga0068852_100055263 | Ga0068852_1000552632 | 93 |
| 70 | 3300005616 | Ga0068852_100073517 | Ga0068852_1000735175 | 93 |
| 71 | 3300005616 | Ga0068852_100102373 | Ga0068852_1001023732 | 93 |
| 72 | 3300005841 | Ga0068863_100000004 | Ga0068863_10000000421 | 93 |
| 73 | 3300005842 | Ga0068858_100000012 | Ga0068858_100000012197 | 93 |
| 74 | 3300006237 | Ga0097621_102197705 | Ga0097621_1021977051 | 93 |
| 75 | 3300006358 | Ga0068871_101092315 | Ga0068871_1010923152 | 93 |
| 76 | 3300006846 | Ga0075430_100597795 | Ga0075430_1005977952 | 93 |
| 77 | 3300006881 | Ga0068865_100363973 | Ga0068865_1003639732 | 93 |
| 78 | 3300009093 | Ga0105240_10002982 | Ga0105240_1000298225 | 93 |
| 79 | 3300009093 | Ga0105240_10007770 | Ga0105240_1000777018 | 93 |
| 80 | 3300009093 | Ga0105240_10291895 | Ga0105240_102918951 | 93 |
| 81 | 3300009093 | Ga0105240_10328669 | Ga0105240_103286693 | 93 |
| 82 | 3300009093 | Ga0105240_10430839 | Ga0105240_104308392 | 93 |
| 83 | 3300009093 | Ga0105240_10696090 | Ga0105240_106960901 | 93 |
| 84 | 3300009098 | Ga0105245_10006036 | Ga0105245_100060362 | 93 |
| 85 | 3300009098 | Ga0105245_10242643 | Ga0105245_102426431 | 93 |
| 86 | 3300009148 | Ga0105243_11647156 | Ga0105243_116471561 | 93 |
| 87 | 3300009174 | Ga0105241_10260509 | Ga0105241_102605091 | 93 |
| 88 | 3300009174 | Ga0105241_10762101 | Ga0105241_107621012 | 93 |
| 89 | 3300009176 | Ga0105242_10889020 | Ga0105242_108890202 | 93 |
| 90 | 3300009545 | Ga0105237_10202129 | Ga0105237_102021291 | 93 |
| 91 | 3300009545 | Ga0105237_10600451 | Ga0105237_106004511 | 93 |
| 92 | 3300009551 | Ga0105238_10000023 | Ga0105238_10000023186 | 93 |
| 93 | 3300009551 | Ga0105238_10578425 | Ga0105238_105784252 | 93 |
| 94 | 3300009551 | Ga0105238_11392123 | Ga0105238_113921231 | 93 |
| 95 | 3300010375 | Ga0105239_10359280 | Ga0105239_103592802 | 93 |
| 96 | 3300010375 | Ga0105239_10976170 | Ga0105239_109761702 | 93 |
| 97 | 3300010375 | Ga0105239_12178503 | Ga0105239_121785032 | 93 |
| 98 | 3300010375 | Ga0105239_12347058 | Ga0105239_123470581 | 93 |
| 99 | 3300013100 | Ga0157373_10055667 | Ga0157373_100556675 | 93 |
| 100 | 3300013100 | Ga0157373_10058098 | Ga0157373_100580984 | 93 |
| 101 | 3300013102 | Ga0157371_10048261 | Ga0157371_100482613 | 93 |
| 102 | 3300013102 | Ga0157371_10313675 | Ga0157371_103136752 | 93 |
| 103 | 3300013104 | Ga0157370_10026478 | Ga0157370_100264782 | 93 |
| 104 | 3300013104 | Ga0157370_10046263 | Ga0157370_100462636 | 93 |
| 105 | 3300013104 | Ga0157370_10121894 | Ga0157370_101218944 | 93 |
| 106 | 3300013104 | Ga0157370_10364884 | Ga0157370_103648842 | 93 |
| 107 | 3300013105 | Ga0157369_10059134 | Ga0157369_100591342 | 93 |
| 108 | 3300013105 | Ga0157369_10067585 | Ga0157369_100675855 | 93 |
| 109 | 3300013105 | Ga0157369_10074490 | Ga0157369_100744905 | 93 |
| 110 | 3300013105 | Ga0157369_10441280 | Ga0157369_104412803 | 93 |
| 111 | 3300013105 | Ga0157369_10496980 | Ga0157369_104969801 | 93 |
| 112 | 3300013105 | Ga0157369_10666704 | Ga0157369_106667041 | 93 |
| 113 | 3300013105 | Ga0157369_11373977 | Ga0157369_113739772 | 93 |
| 114 | 3300013296 | Ga0157374_10085787 | Ga0157374_100857873 | 93 |
| 115 | 3300013297 | Ga0157378_12036256 | Ga0157378_120362561 | 93 |
| 116 | 3300013297 | Ga0157378_13234670 | Ga0157378_132346701 | 93 |
| 117 | 3300013307 | Ga0157372_10020035 | Ga0157372_100200354 | 93 |
| 118 | 3300013307 | Ga0157372_10409206 | Ga0157372_104092063 | 93 |
| 119 | 3300013307 | Ga0157372_10556516 | Ga0157372_105565162 | 93 |
| 120 | 3300013307 | Ga0157372_10906463 | Ga0157372_109064632 | 93 |
| 121 | 3300013307 | Ga0157372_11037763 | Ga0157372_110377631 | 93 |
| 122 | 3300013308 | Ga0157375_10093950 | Ga0157375_100939502 | 93 |
| 123 | 3300013308 | Ga0157375_11123521 | Ga0157375_111235213 | 93 |
| 124 | 3300013308 | Ga0157375_11729708 | Ga0157375_117297082 | 93 |
| 125 | 3300013308 | Ga0157375_13221948 | Ga0157375_132219481 | 93 |
| 126 | 3300014325 | Ga0163163_11768532 | Ga0163163_117685322 | 93 |
| 127 | 3300014326 | Ga0157380_10632393 | Ga0157380_106323932 | 93 |
| 128 | 3300014745 | Ga0157377_11012907 | Ga0157377_110129071 | 93 |
| 129 | 3300014968 | Ga0157379_11825326 | Ga0157379_118253261 | 93 |
| 130 | 3300017792 | Ga0163161_10158314 | Ga0163161_101583142 | 93 |
| 131 | 3300017792 | Ga0163161_11212664 | Ga0163161_112126642 | 93 |
| 132 | 3300020069 | Ga0197907_10032597 | Ga0197907_100325972 | 93 |
| 133 | 3300020069 | Ga0197907_11345511 | Ga0197907_113455111 | 93 |
| 134 | 3300020069 | Ga0197907_11399183 | Ga0197907_113991833 | 93 |
| 135 | 3300020070 | Ga0206356_10596004 | Ga0206356_105960043 | 93 |
| 136 | 3300020070 | Ga0206356_10644984 | Ga0206356_106449842 | 93 |
| 137 | 3300020070 | Ga0206356_10938258 | Ga0206356_109382585 | 93 |
| 138 | 3300020070 | Ga0206356_11719383 | Ga0206356_117193832 | 93 |
| 139 | 3300020077 | Ga0206351_10582789 | Ga0206351_105827891 | 93 |
| 140 | 3300020078 | Ga0206352_10703191 | Ga0206352_107031912 | 93 |
| 141 | 3300020078 | Ga0206352_11051728 | Ga0206352_110517282 | 93 |
| 142 | 3300020081 | Ga0206354_10731695 | Ga0206354_107316952 | 93 |
| 143 | 3300020081 | Ga0206354_11678193 | Ga0206354_116781932 | 93 |
| 144 | 3300020082 | Ga0206353_10060218 | Ga0206353_100602182 | 93 |
| 145 | 3300020082 | Ga0206353_10259637 | Ga0206353_102596372 | 93 |
| 146 | 3300020082 | Ga0206353_11338531 | Ga0206353_113385312 | 93 |
| 147 | 3300020082 | Ga0206353_11366025 | Ga0206353_113660252 | 93 |
| 148 | 3300020082 | Ga0206353_11609755 | Ga0206353_116097552 | 93 |
| 149 | 3300020610 | Ga0154015_1011781 | Ga0154015_10117814 | 93 |
| 150 | 3300022467 | Ga0224712_10024639 | Ga0224712_100246393 | 93 |
| 151 | 3300022467 | Ga0224712_10587496 | Ga0224712_105874961 | 93 |
| 152 | 3300025909 | Ga0207705_10160323 | Ga0207705_101603235 | 93 |
| 153 | 3300025909 | Ga0207705_10186912 | Ga0207705_101869121 | 93 |
| 154 | 3300025909 | Ga0207705_11516427 | Ga0207705_115164271 | 93 |
| 155 | 3300025911 | Ga0207654_11004136 | Ga0207654_110041361 | 93 |
| 156 | 3300025912 | Ga0207707_10120369 | Ga0207707_101203692 | 93 |
| 157 | 3300025912 | Ga0207707_10155269 | Ga0207707_101552691 | 93 |
| 158 | 3300025912 | Ga0207707_10276379 | Ga0207707_102763792 | 93 |
| 159 | 3300025912 | Ga0207707_10391248 | Ga0207707_103912481 | 93 |
| 160 | 3300025912 | Ga0207707_11581695 | Ga0207707_115816951 | 93 |
| 161 | 3300025913 | Ga0207695_10039475 | Ga0207695_100394752 | 93 |
| 162 | 3300025913 | Ga0207695_10103172 | Ga0207695_101031722 | 93 |
| 163 | 3300025913 | Ga0207695_10364292 | Ga0207695_103642922 | 93 |
| 164 | 3300025913 | Ga0207695_10613473 | Ga0207695_106134732 | 93 |
| 165 | 3300025914 | Ga0207671_10282570 | Ga0207671_102825704 | 93 |
| 166 | 3300025914 | Ga0207671_10814669 | Ga0207671_108146691 | 93 |
| 167 | 3300025916 | Ga0207663_11461859 | Ga0207663_114618591 | 93 |
| 168 | 3300025917 | Ga0207660_10076125 | Ga0207660_100761252 | 93 |
| 169 | 3300025917 | Ga0207660_10390554 | Ga0207660_103905542 | 93 |
| 170 | 3300025917 | Ga0207660_10510048 | Ga0207660_105100482 | 93 |
| 171 | 3300025919 | Ga0207657_10003156 | Ga0207657_100031563 | 93 |
| 172 | 3300025919 | Ga0207657_10006023 | Ga0207657_1000602312 | 93 |
| 173 | 3300025919 | Ga0207657_10007923 | Ga0207657_100079234 | 93 |
| 174 | 3300025919 | Ga0207657_10051827 | Ga0207657_100518272 | 93 |
| 175 | 3300025920 | Ga0207649_10009900 | Ga0207649_100099002 | 93 |
| 176 | 3300025920 | Ga0207649_10218566 | Ga0207649_102185661 | 93 |
| 177 | 3300025920 | Ga0207649_11538558 | Ga0207649_115385581 | 93 |
| 178 | 3300025921 | Ga0207652_10024104 | Ga0207652_100241046 | 93 |
| 179 | 3300025921 | Ga0207652_10149768 | Ga0207652_101497682 | 93 |
| 180 | 3300025921 | Ga0207652_10258953 | Ga0207652_102589531 | 93 |
| 181 | 3300025921 | Ga0207652_10793029 | Ga0207652_107930292 | 93 |
| 182 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004874 | 93 |
| 183 | 3300025924 | Ga0207694_10213709 | Ga0207694_102137092 | 93 |
| 184 | 3300025927 | Ga0207687_10001320 | Ga0207687_1000132012 | 93 |
| 185 | 3300025927 | Ga0207687_10273674 | Ga0207687_102736742 | 93 |
| 186 | 3300025928 | Ga0207700_10779213 | Ga0207700_107792132 | 93 |
| 187 | 3300025931 | Ga0207644_10528485 | Ga0207644_105284852 | 93 |
| 188 | 3300025932 | Ga0207690_10508043 | Ga0207690_105080432 | 93 |
| 189 | 3300025932 | Ga0207690_11007002 | Ga0207690_110070021 | 93 |
| 190 | 3300025934 | Ga0207686_11548206 | Ga0207686_115482062 | 93 |
| 191 | 3300025938 | Ga0207704_10395956 | Ga0207704_103959562 | 93 |
| 192 | 3300025944 | Ga0207661_10019004 | Ga0207661_100190047 | 93 |
| 193 | 3300025944 | Ga0207661_10492101 | Ga0207661_104921013 | 93 |
| 194 | 3300025944 | Ga0207661_10498536 | Ga0207661_104985361 | 93 |
| 195 | 3300025944 | Ga0207661_10981427 | Ga0207661_109814271 | 93 |
| 196 | 3300025949 | Ga0207667_10027994 | Ga0207667_100279943 | 93 |
| 197 | 3300025949 | Ga0207667_10590615 | Ga0207667_105906152 | 93 |
| 198 | 3300025949 | Ga0207667_11983936 | Ga0207667_119839361 | 93 |
| 199 | 3300025960 | Ga0207651_10619599 | Ga0207651_106195991 | 93 |
| 200 | 3300025972 | Ga0207668_11279500 | Ga0207668_112795001 | 93 |
| 201 | 3300025981 | Ga0207640_10004143 | Ga0207640_1000414310 | 93 |
| 202 | 3300026035 | Ga0207703_10000550 | Ga0207703_1000055021 | 93 |
| 203 | 3300026041 | Ga0207639_10137729 | Ga0207639_101377292 | 93 |
| 204 | 3300026041 | Ga0207639_10467192 | Ga0207639_104671921 | 93 |
| 205 | 3300026041 | Ga0207639_10613801 | Ga0207639_106138011 | 93 |
| 206 | 3300026067 | Ga0207678_10961517 | Ga0207678_109615171 | 93 |
| 207 | 3300026078 | Ga0207702_10005801 | Ga0207702_100058015 | 93 |
| 208 | 3300026078 | Ga0207702_11112260 | Ga0207702_111122602 | 93 |
| 209 | 3300026078 | Ga0207702_11440567 | Ga0207702_114405671 | 93 |
| 210 | 3300026088 | Ga0207641_10000129 | Ga0207641_1000012919 | 93 |
| 211 | 3300026116 | Ga0207674_12147418 | Ga0207674_121474181 | 93 |
| 212 | 3300026142 | Ga0207698_10014084 | Ga0207698_100140843 | 93 |
| 213 | 3300026142 | Ga0207698_10113649 | Ga0207698_101136492 | 93 |
| 214 | 3300028379 | Ga0268266_10000020 | Ga0268266_10000020352 | 93 |
| 215 | 3300028563 | Ga0265319_1268912 | Ga0265319_12689121 | 93 |
| 216 | 3300035118 | Ga0373954_0258807 | Ga0373954_0258807_185_541 | 93 |
| 217 | 3300036401 | Ga0373937_0111876 | Ga0373937_0111876_322_678 | 93 |
| 218 | 3300037068 | Ga0373925_0441689 | Ga0373925_0441689_636_923 | 93 |
| 219 | 3300037312 | Ga0395899_0147339 | Ga0395899_0147339_1325_1606 | 93 |
| 220 | 3300037418 | Ga0395900_0096429 | Ga0395900_0096429_820_1101 | 93 |
| 221 | 3300037466 | Ga0395898_0033415 | Ga0395898_0033415_3950_4231 | 93 |
| 222 | 3300037471 | Ga0395905_0213073 | Ga0395905_0213073_758_1039 | 93 |
| 223 | 3300037853 | Ga0436364_0032994 | Ga0436364_0032994_216_536 | 93 |
| 224 | 3300038443 | Ga0395901_0006844 | Ga0395901_0006844_6711_6992 | 93 |
| 225 | 3300039437 | Ga0436365_0365653 | Ga0436365_0365653_2231_2518 | 93 |
| 226 | 3300039437 | Ga0436365_1547213 | Ga0436365_1547213_195_476 | 93 |
| 227 | 3300039437 | Ga0436365_1765262 | Ga0436365_1765262_190_477 | 93 |
| 228 | 3300039450 | Ga0436363_0089964 | Ga0436363_0089964_19183_19470 | 93 |
| 229 | 3300039450 | Ga0436363_0359788 | Ga0436363_0359788_156_437 | 93 |
| 230 | 3300039450 | Ga0436363_1132971 | Ga0436363_1132971_4846_5133 | 93 |
| 231 | 3300039453 | Ga0436362_0517020 | Ga0436362_0517020_56_343 | 93 |
| 232 | 3300041492 | Ga0451835_0916340 | Ga0451835_0916340_69_350 | 93 |
| 233 | 3300041505 | Ga0451849_1193030 | Ga0451849_1193030_110_391 | 93 |
| 234 | 3300041512 | Ga0451853_0569307 | Ga0451853_0569307_284_565 | 93 |
| 235 | 3300041512 | Ga0451853_0848126 | Ga0451853_0848126_122_409 | 93 |
| 236 | 3300041512 | Ga0451853_1400461 | Ga0451853_1400461_389_670 | 93 |
| 237 | 3300041512 | Ga0451853_1656563 | Ga0451853_1656563_161_448 | 93 |
| 238 | 3300041512 | Ga0451853_3319123 | Ga0451853_3319123_1118_1405 | 93 |
| 239 | 3300044656 | Ga0466969_0451119 | Ga0466969_0451119_114_401 | 93 |
| 240 | 3300044683 | Ga0466965_0769580 | Ga0466965_0769580_179_460 | 93 |
| 241 | 3300044684 | Ga0466966_0018061 | Ga0466966_0018061_1354_1635 | 93 |
| 242 | 3300044693 | Ga0466961_0241261 | Ga0466961_0241261_167_454 | 93 |
| 243 | 3300044694 | Ga0466963_0213157 | Ga0466963_0213157_23_304 | 93 |
| 244 | 3300044706 | Ga0466964_0760115 | Ga0466964_0760115_81_362 | 93 |
| 245 | 3300044735 | Ga0466968_0014460 | Ga0466968_0014460_503_784 | 93 |
| 246 | 3300044765 | Ga0466970_0084032 | Ga0466970_0084032_441_728 | 93 |
| 247 | 3300044765 | Ga0466970_0542189 | Ga0466970_0542189_34_315 | 93 |
| 248 | 3300044842 | Ga0466957_0034219 | Ga0466957_0034219_1528_1809 | 93 |
| 249 | 3300044842 | Ga0466957_0440113 | Ga0466957_0440113_45_326 | 93 |
| 250 | 3300045049 | Ga0466959_0163072 | Ga0466959_0163072_518_799 | 93 |
| 251 | 3300045836 | Ga0466958_0020684 | Ga0466958_0020684_1920_2201 | 93 |
| 252 | 3300045836 | Ga0466958_0139320 | Ga0466958_0139320_729_1016 | 93 |
| 253 | 3300045836 | Ga0466958_0180238 | Ga0466958_0180238_576_857 | 93 |
| 254 | 3300045976 | Ga0466967_0327211 | Ga0466967_0327211_1150_1437 | 93 |
| 255 | 3300045976 | Ga0466967_0672769 | Ga0466967_0672769_94_381 | 93 |
| 256 | 3300046454 | Ga0495592_0111658 | Ga0495592_0111658_1490_1777 | 93 |
| 257 | 3300046454 | Ga0495592_0616442 | Ga0495592_0616442_257_544 | 93 |
| 258 | 3300046455 | Ga0495603_0072232 | Ga0495603_0072232_121_408 | 93 |
| 259 | 3300046459 | Ga0495629_0068338 | Ga0495629_0068338_1311_1592 | 93 |
| 260 | 3300046461 | Ga0495641_0000020 | Ga0495641_0000020_61996_62283 | 93 |
| 261 | 3300046461 | Ga0495641_0134849 | Ga0495641_0134849_168_455 | 93 |
| 262 | 3300046461 | Ga0495641_0430984 | Ga0495641_0430984_275_556 | 93 |
| 263 | 3300046462 | Ga0495651_0210877 | Ga0495651_0210877_876_1163 | 93 |
| 264 | 3300046462 | Ga0495651_0271761 | Ga0495651_0271761_509_790 | 93 |
| 265 | 3300046463 | Ga0495653_0627309 | Ga0495653_0627309_272_553 | 93 |
| 266 | 3300046473 | Ga0495582_0758244 | Ga0495582_0758244_241_522 | 93 |
| 267 | 3300046477 | Ga0495664_0263208 | Ga0495664_0263208_496_777 | 93 |
| 268 | 3300046511 | Ga0495608_0343954 | Ga0495608_0343954_391_672 | 93 |
| 269 | 3300046514 | Ga0495618_0250351 | Ga0495618_0250351_763_1044 | 93 |
| 270 | 3300046514 | Ga0495618_0643913 | Ga0495618_0643913_32_319 | 93 |
| 271 | 3300046516 | Ga0495628_0090383 | Ga0495628_0090383_991_1278 | 93 |
| 272 | 3300046516 | Ga0495628_0092749 | Ga0495628_0092749_47_334 | 93 |
| 273 | 3300046516 | Ga0495628_0118839 | Ga0495628_0118839_10_291 | 93 |
| 274 | 3300046517 | Ga0495630_0058904 | Ga0495630_0058904_1424_1705 | 93 |
| 275 | 3300046517 | Ga0495630_0079743 | Ga0495630_0079743_1371_1652 | 93 |
| 276 | 3300046517 | Ga0495630_0126697 | Ga0495630_0126697_357_644 | 93 |
| 277 | 3300046517 | Ga0495630_0215951 | Ga0495630_0215951_1082_1363 | 93 |
| 278 | 3300046523 | Ga0495644_0001940 | Ga0495644_0001940_4627_4914 | 93 |
| 279 | 3300046526 | Ga0495666_0370646 | Ga0495666_0370646_192_479 | 93 |
| 280 | 3300046529 | Ga0495652_0052238 | Ga0495652_0052238_1518_1799 | 93 |
| 281 | 3300046529 | Ga0495652_0411408 | Ga0495652_0411408_334_621 | 93 |
| 282 | 3300046529 | Ga0495652_0802764 | Ga0495652_0802764_163_444 | 93 |
| 283 | 3300046533 | Ga0495640_0017519 | Ga0495640_0017519_1027_1314 | 93 |
| 284 | 3300046533 | Ga0495640_0040026 | Ga0495640_0040026_1952_2239 | 93 |
| 285 | 3300046533 | Ga0495640_0113633 | Ga0495640_0113633_931_1212 | 93 |
| 286 | 3300046533 | Ga0495640_0229610 | Ga0495640_0229610_621_902 | 93 |
| 287 | 3300046533 | Ga0495640_0457807 | Ga0495640_0457807_85_381 | 93 |
| 288 | 3300046535 | Ga0495586_0000862 | Ga0495586_0000862_1564_1851 | 93 |
| 289 | 3300046536 | Ga0495587_0427281 | Ga0495587_0427281_192_479 | 93 |
| 290 | 3300046543 | Ga0495645_0063704 | Ga0495645_0063704_960_1247 | 93 |
| 291 | 3300046642 | Ga0495634_0049169 | Ga0495634_0049169_1405_1692 | 93 |
| 292 | 3300046642 | Ga0495634_0104830 | Ga0495634_0104830_1215_1496 | 93 |
| 293 | 3300046663 | Ga0495635_0000096 | Ga0495635_0000096_36934_37221 | 93 |
| 294 | 3300046663 | Ga0495635_0158081 | Ga0495635_0158081_711_992 | 93 |
| 295 | 3300046663 | Ga0495635_0736682 | Ga0495635_0736682_134_415 | 93 |
| 296 | 3300046674 | Ga0495588_0075686 | Ga0495588_0075686_985_1272 | 93 |
| 297 | 3300046675 | Ga0495657_0235242 | Ga0495657_0235242_508_789 | 93 |
| 298 | 3300046678 | Ga0495599_0011195 | Ga0495599_0011195_3018_3299 | 93 |
| 299 | 3300046678 | Ga0495599_0447296 | Ga0495599_0447296_235_516 | 93 |
| 300 | 3300046680 | Ga0495646_0049014 | Ga0495646_0049014_129_410 | 93 |
| 301 | 3300046680 | Ga0495646_0218825 | Ga0495646_0218825_438_725 | 93 |
| 302 | 3300046680 | Ga0495646_0584438 | Ga0495646_0584438_25_306 | 93 |
| 303 | 3300046681 | Ga0495647_0000015 | Ga0495647_0000015_2949_3236 | 93 |
| 304 | 3300046681 | Ga0495647_0009578 | Ga0495647_0009578_1394_1681 | 93 |
| 305 | 3300046684 | Ga0495669_0000103 | Ga0495669_0000103_11431_11718 | 93 |
| 306 | 3300046689 | Ga0495613_0284070 | Ga0495613_0284070_565_846 | 93 |
| 307 | 3300046690 | Ga0495624_0000012 | Ga0495624_0000012_63715_64002 | 93 |
| 308 | 3300046690 | Ga0495624_0004399 | Ga0495624_0004399_3341_3628 | 93 |
| 309 | 3300046690 | Ga0495624_0695875 | Ga0495624_0695875_198_479 | 93 |
| 310 | 3300046690 | Ga0495624_0870774 | Ga0495624_0870774_220_501 | 93 |
| 311 | 3300046694 | Ga0495649_0002521 | Ga0495649_0002521_1757_2086 | 93 |
| 312 | 3300046809 | Ga0495600_0000884 | Ga0495600_0000884_8490_8777 | 93 |
| 313 | 3300046809 | Ga0495600_0150814 | Ga0495600_0150814_894_1181 | 93 |
| 314 | 3300047315 | Ga0495581_0759628 | Ga0495581_0759628_181_462 | 93 |
| 315 | 3300047317 | Ga0495604_0000346 | Ga0495604_0000346_27747_28034 | 93 |
| 316 | 3300047317 | Ga0495604_0102506 | Ga0495604_0102506_85_366 | 93 |
| 317 | 3300047317 | Ga0495604_0104830 | Ga0495604_0104830_617_904 | 93 |
| 318 | 3300047317 | Ga0495604_0556226 | Ga0495604_0556226_409_690 | 93 |
| 319 | 3300047319 | Ga0495674_0000019 | Ga0495674_0000019_97904_98191 | 93 |
| 320 | 3300047319 | Ga0495674_0071519 | Ga0495674_0071519_1255_1536 | 93 |
| 321 | 3300047319 | Ga0495674_0459253 | Ga0495674_0459253_468_749 | 93 |
| 322 | 3300047321 | Ga0495676_0011083 | Ga0495676_0011083_4923_5210 | 93 |
| 323 | 3300047321 | Ga0495676_0268296 | Ga0495676_0268296_193_480 | 93 |
| 324 | 3300047322 | Ga0495680_0000952 | Ga0495680_0000952_5217_5504 | 93 |
| 325 | 3300047322 | Ga0495680_0023505 | Ga0495680_0023505_3250_3579 | 93 |
| 326 | 3300047322 | Ga0495680_0346101 | Ga0495680_0346101_396_677 | 93 |
| 327 | 3300047322 | Ga0495680_0686173 | Ga0495680_0686173_90_371 | 93 |
| 328 | 3300047444 | Ga0495675_0076715 | Ga0495675_0076715_233_520 | 93 |
| 329 | 3300047447 | Ga0495685_076956 | Ga0495685_076956_77_364 | 93 |
| 330 | 3300047471 | Ga0495684_0001796 | Ga0495684_0001796_13832_14119 | 93 |
| 331 | 3300047471 | Ga0495684_0088319 | Ga0495684_0088319_1475_1756 | 93 |
| 332 | 3300047471 | Ga0495684_0740544 | Ga0495684_0740544_332_619 | 93 |
| 333 | 3300047673 | Ga0495593_0152337 | Ga0495593_0152337_380_667 | 93 |
| 334 | 3300048088 | Ga0495602_0750793 | Ga0495602_0750793_33_314 | 93 |
| 335 | 3300048903 | Ga0496100_0000007 | Ga0496100_0000007_172684_172971 | 93 |
| 336 | 3300048903 | Ga0496100_0006520 | Ga0496100_0006520_3252_3539 | 93 |
| 337 | 3300048904 | Ga0496101_0000013 | Ga0496101_0000013_172684_172971 | 93 |
| 338 | 3300048905 | Ga0496102_0219597 | Ga0496102_0219597_85_366 | 93 |
| 339 | 3300048906 | Ga0496103_0702333 | Ga0496103_0702333_313_594 | 93 |
| 340 | 3300048907 | Ga0496104_0000013 | Ga0496104_0000013_128006_128293 | 93 |
| 341 | 3300048907 | Ga0496104_0017256 | Ga0496104_0017256_6015_6296 | 93 |
| 342 | 3300048907 | Ga0496104_0219606 | Ga0496104_0219606_704_985 | 93 |
| 343 | 3300048908 | Ga0496105_0000006 | Ga0496105_0000006_268871_269158 | 93 |
| 344 | 3300048909 | Ga0496106_0000006 | Ga0496106_0000006_166823_167110 | 93 |
| 345 | 3300048910 | Ga0496107_0000007 | Ga0496107_0000007_166825_167112 | 93 |
| 346 | 3300048910 | Ga0496107_0153993 | Ga0496107_0153993_398_679 | 93 |
| 347 | 3300048912 | Ga0496109_0461095 | Ga0496109_0461095_275_556 | 93 |
| 348 | 3300048913 | Ga0496110_0115110 | Ga0496110_0115110_389_676 | 93 |
| 349 | 3300048914 | Ga0496111_0307373 | Ga0496111_0307373_563_844 | 93 |
| 350 | 3300048914 | Ga0496111_1340092 | Ga0496111_1340092_28_315 | 93 |
| 351 | 3300048915 | Ga0496112_0006613 | Ga0496112_0006613_9727_10008 | 93 |
| 352 | 3300048915 | Ga0496112_0124746 | Ga0496112_0124746_2050_2331 | 93 |
| 353 | 3300048917 | Ga0496114_0610529 | Ga0496114_0610529_666_947 | 93 |
| 354 | 3300048918 | Ga0496115_0000010 | Ga0496115_0000010_110436_110723 | 93 |
| 355 | 3300048918 | Ga0496115_0003116 | Ga0496115_0003116_8544_8831 | 93 |
| 356 | 3300049583 | Ga0501067_0008083 | Ga0501067_0008083_5548_5829 | 93 |
| 357 | 3300050509 | nmdc:mga0qj67_762797_c1 | nmdc:mga0qj67_762797_c1_279_566 | 93 |
| 358 | 3300053077 | Ga0495601_0001553 | Ga0495601_0001553_3125_3412 | 93 |
| 359 | 3300053077 | Ga0495601_0078292 | Ga0495601_0078292_1690_1971 | 93 |
| 360 | 3300053077 | Ga0495601_0108103 | Ga0495601_0108103_1313_1594 | 93 |
| 361 | 3300053077 | Ga0495601_0312696 | Ga0495601_0312696_262_558 | 93 |
| 362 | 3300053085 | Ga0495619_0375983 | Ga0495619_0375983_662_949 | 93 |
| 363 | 3300053085 | Ga0495619_0786591 | Ga0495619_0786591_290_571 | 93 |
| 364 | 3300053094 | Ga0500566_0109900 | Ga0500566_0109900_696_977 | 93 |
| 365 | 3300053122 | Ga0500608_296117 | Ga0500608_296117_48_335 | 93 |
| 366 | 3300053139 | Ga0500568_0068538 | Ga0500568_0068538_30_317 | 93 |
| 367 | 3300061734 | Ga0530510_0543899 | Ga0530510_0543899_416_697 | 93 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pd1-assembly1.cif.gz_A | crystal structure of ne2512 protein of unknown function from nitrosomonas europaea | 0.7317 | 2 | 93 |
| 6wxo-assembly1.cif.gz_B | de novo tim barrel-ferredoxin fold fusion homodimer with 2-histidine 2-glutamate centre tfd-he | 0.7241 | 4 | 77 |
| 2pd1-assembly1.cif.gz_A | crystal structure of ne2512 protein of unknown function from nitrosomonas europaea | 0.7192 | 2 | 93 |
| 1y0h-assembly1.cif.gz_B | structure of rv0793 from mycobacterium tuberculosis | 0.7107 | 1 | 92 |
| 7nmm-assembly2.cif.gz_B | complex of rice blast (magnaporthe oryzae) effector protein apikl2f with the host target shma94 from setaria italica | 0.708 | 2 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1y0hB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7107 | 1 | 92 | 3.30.70.100 |
| af_A0A1D6H675_50_147_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.7101 | 34 | 65 | 3.30.70.330 |
| af_Q8BG18_205_343_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7058 | 2 | 85 | 3.30.70.100 |
| af_Q6EPT4_1_76_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7015 | 1 | 89 | 3.30.70.100 |
| 3bm7A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6987 | 1 | 89 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1N275-F1-model_v4 | ABM domain-containing protein | 0.9919 | 1 | 93 |
|
| AF-A0A538FCT8-F1-model_v4 | ABM domain-containing protein | 0.9611 | 1 | 93 |
|
| AF-A0A538FCT8-F1-model_v4 | ABM domain-containing protein | 0.9512 | 1 | 93 |
|
| AF-A0A6I3L364-F1-model_v4 | ABM domain-containing protein | 0.9057 | 1 | 93 |
|
| AF-A0A1F4RDW6-F1-model_v4 | ABM domain-containing protein | 0.9053 | 1 | 92 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar