F424168

General Info

Members Datasets Scaffolds Average Seq Length
366 292 209 213

Family's Representative Sequence

Representative Sequence 3300053094|Ga0500566_0071336|Ga0500566_0071336_809_1543
Length 244
Sequence VLANFAVYSASCEVIKLTASFTLSSRQGNFMNIALIGATGFIGTPVLSELLSRGHKVTVLARNPGKLTPQPGLTVVAADALDATQVAKAAAGHDAVISAYNPGWGEPKIHDLHLQASKAIVDGVKQSGVKRLLVVGGAGSLFVAPGLQLVDTPQFPAEYKQAALAAREALNQIKLETSLDWSFVSPPIGLAPGERTGKYRVGADELLPGQGDKPAGISVADLAVAIVDEIENARHVRRRFTVAN

Samples

Sample ID Description Type Environment
1 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
4 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
5 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
6 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
7 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
8 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
9 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
10 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
11 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
12 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
13 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
14 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
15 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
16 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
17 2643221557 Ensifer sp. Root558 Isolate Unclassified
18 2643221591 Devosia sp. Root685 Isolate Unclassified
19 2643221610 Ensifer sp. Root74 Isolate Unclassified
20 2643221618 Ensifer sp. Root231 Isolate Unclassified
21 2643221626 Ensifer sp. Root31 Isolate Unclassified
22 2643221655 Ensifer sp. Root1252 Isolate Unclassified
23 2643221659 Ensifer sp. Root127 Isolate Unclassified
24 2643221668 Ensifer sp. Root423 Isolate Unclassified
25 2643221675 Ensifer sp. Root1298 Isolate Unclassified
26 2643221680 Ensifer sp. Root1312 Isolate Unclassified
27 2643221698 Ensifer sp. Root142 Isolate Unclassified
28 2643221712 Ensifer sp. Root258 Isolate Unclassified
29 2643221723 Ensifer sp. Root278 Isolate Unclassified
30 2643221726 Ensifer sp. Root954 Isolate Unclassified
31 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
32 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
33 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
34 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
35 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
36 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
37 2844163670 Ensifer sp. 1H6 Isolate Unclassified
38 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
39 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
40 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
41 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
42 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
43 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
44 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
45 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
46 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
47 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
48 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
49 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
50 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
51 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
52 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
53 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
54 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
55 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
56 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
57 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
58 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
59 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
60 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
61 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
62 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
63 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
64 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
65 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
66 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
67 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
68 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
69 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
70 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
71 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
72 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
73 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
74 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
75 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
76 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
77 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
78 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
79 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
80 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
81 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
82 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
83 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
84 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
85 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
86 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
87 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
88 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
89 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
90 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
91 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
92 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
93 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
94 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
95 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
96 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
97 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
98 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
99 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
100 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
101 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
102 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
103 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
104 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
105 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
106 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
107 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
108 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
109 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
110 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
111 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
112 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
113 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
114 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
115 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
116 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
117 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
118 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
119 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
120 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
121 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
122 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
123 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
124 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
125 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
126 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
127 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
128 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
129 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
130 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
131 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
132 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
133 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
134 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
135 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
136 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
137 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
138 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
139 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
140 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
141 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
142 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
143 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
144 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
145 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
146 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
147 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
148 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
149 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
150 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
151 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
152 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
153 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
154 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
155 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
156 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
157 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
158 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
159 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
160 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
161 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
162 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
163 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
164 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
165 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
166 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
167 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
168 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
169 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
170 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
171 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
172 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
173 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
174 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
175 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
176 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
177 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
178 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
179 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
180 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
181 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
182 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
183 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
184 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
185 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
186 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
187 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
188 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
189 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
190 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
191 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
192 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
193 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
194 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
195 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
196 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
197 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
198 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
199 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
200 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
201 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
202 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
203 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
206 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
209 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
211 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
214 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
226 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
227 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
228 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
243 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
254 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
262 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
266 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
273 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
274 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
275 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
276 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
280 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
281 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
282 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
283 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
284 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
285 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
286 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
289 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
290 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
291 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
292 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.83
Metatranscriptomes 0.27
Isolates 42.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.5
Nodule 37.16
Rhizoplane 0.27
Rhizosphere 21.86
Stem 0
Stem Tuber 0
Unclassified 14.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10115417 3300001989 Bacteria 804
2 JGI24735J21928_10069428 3300002067 Bacteria 1010
3 JGI25155J39150_1000323 3300002704 Bacteria 16055
4 JGI25154J39366_1000657 3300002738 Bacteria 16151
5 JGI25157J39369_1000791 3300002741 Bacteria 16148
6 JGI25150J39212_1016184 3300002774 Bacteria 1227
7 JGI25159J45721_1000407 3300002987 Bacteria 19965
8 JGI25159J45721_1016390 3300002987 Bacteria 1581
9 JGI25151J46595_10010088 3300003187 Bacteria 4420
10 JGI25151J46595_10014781 3300003187 Bacteria 3465
11 JGI25151J46595_10015740 3300003187 Bacteria 3322
12 JGI25151J46595_10045880 3300003187 Bacteria 1537
13 JGI25153J46596_10053264 3300003215 Bacteria 1146
14 rootH2_10004521 3300003320 Bacteria 39563
15 rootH2_10028784 3300003320 Bacteria 31504
16 rootH2_10139151 3300003320 Bacteria 4608
17 rootH2_10194633 3300003320 Bacteria 1946
18 rootL2_10193618 3300003322 Unclassified 1112
19 rootH1_10114170 3300003323 Bacteria 1938
20 JGI25160J50197_1000172 3300003354 Bacteria 55781
21 JGI25161J50226_1000007 3300003374 Bacteria 256181
22 Ga0055526_1009546 3300003771 Bacteria 4649
23 Ga0055526_1018589 3300003771 Bacteria 2585
24 Ga0055537_1000356 3300003773 Bacteria 31055
25 Ga0055537_1022752 3300003773 Bacteria 909
26 Ga0055524_1000213 3300003775 Bacteria 61225
27 Ga0055524_1000859 3300003775 Bacteria 19898
28 Ga0055536_1001320 3300003781 Bacteria 15197
29 Ga0055536_1003918 3300003781 Bacteria 7806
30 Ga0055536_1005157 3300003781 Bacteria 6459
31 Ga0055536_1035843 3300003781 Bacteria 1235
32 Ga0055534_1015169 3300003784 Bacteria 1419
33 Ga0055528_1002730 3300003790 Bacteria 9255
34 Ga0055530_10001299 3300003791 Bacteria 18844
35 Ga0055540_1000504 3300003792 Bacteria 29761
36 Ga0055540_1000731 3300003792 Bacteria 22379
37 Ga0055531_10003518 3300003794 Bacteria 9960
38 Ga0055531_10004306 3300003794 Bacteria 8724
39 Ga0055531_10015747 3300003794 Bacteria 3308
40 Ga0055531_10025776 3300003794 Bacteria 2122
41 Ga0055543_1005400 3300004625 Bacteria 3269
42 Ga0065165_1001170 3300005262 Bacteria 30482
43 Ga0065165_1053854 3300005262 Bacteria 1130
44 Ga0070681_10013633 3300005458 Bacteria 8088
45 Ga0070698_101227962 3300005471 Bacteria 699
46 Ga0070679_100007570 3300005530 Bacteria 10158
47 Ga0068853_100005264 3300005539 Bacteria 10126
48 Ga0068853_100019944 3300005539 Bacteria 5568
49 Ga0068853_100598577 3300005539 Bacteria 1047
50 Ga0068855_100057666 3300005563 Bacteria 4551
51 Ga0068855_100544373 3300005563 Bacteria 1257
52 Ga0068856_100079821 3300005614 Bacteria 3245
53 Ga0068866_10373673 3300005718 Bacteria 912
54 Ga0075432_10002756 3300006058 Bacteria 5883
55 Ga0075362_10131882 3300006177 Bacteria 1189
56 Ga0105240_10161808 3300009093 Bacteria 2658
57 Ga0105241_10212673 3300009174 Bacteria 1621
58 Ga0105241_10215155 3300009174 Bacteria 1612
59 Ga0105237_10000221 3300009545 Bacteria 80262
60 Ga0105238_10002426 3300009551 Bacteria 18699
61 Ga0105239_10024169 3300010375 Bacteria 6693
62 Ga0105239_10233704 3300010375 Bacteria 2063
63 Ga0157326_1009622 3300012513 Bacteria 1067
64 Ga0171463_1002 3300013249 Bacteria 1274851
65 Ga0163162_10023053 3300013306 Bacteria 6140
66 Ga0209435_100019 3300025206 Bacteria 260989
67 Ga0209436_111330 3300025208 Bacteria 1572
68 Ga0207425_1001535 3300025245 Bacteria 9474
69 Ga0207425_1001851 3300025245 Bacteria 8164
70 Ga0209646_1000038 3300025246 Bacteria 353982
71 Ga0209026_1000048 3300025250 Bacteria 257264
72 Ga0209759_1000038 3300025256 Bacteria 257264
73 Ga0209565_1000041 3300025263 Bacteria 251081
74 Ga0209565_1000333 3300025263 Bacteria 42094
75 Ga0209565_1024124 3300025263 Bacteria 1241
76 Ga0209673_1000364 3300025273 Bacteria 81319
77 Ga0209130_1000245 3300025284 Bacteria 68668
78 Ga0209130_1000708 3300025284 Bacteria 29740
79 Ga0209675_1004149 3300025291 Bacteria 6578
80 Ga0209675_1020023 3300025291 Bacteria 1825
81 Ga0209675_1045777 3300025291 Bacteria 929
82 Ga0209676_1000013 3300025292 Bacteria 816080
83 Ga0209676_1001225 3300025292 Bacteria 27158
84 Ga0209676_1002248 3300025292 Bacteria 14263
85 Ga0209676_1003354 3300025292 Bacteria 9980
86 Ga0209025_1000470 3300025294 Bacteria 78526
87 Ga0209025_1008649 3300025294 Bacteria 7279
88 Ga0209025_1010276 3300025294 Bacteria 6363
89 Ga0209025_1011906 3300025294 Bacteria 5660
90 Ga0209025_1023660 3300025294 Bacteria 3200
91 Ga0209025_1107076 3300025294 Bacteria 868
92 Ga0209564_1000875 3300025295 Bacteria 40039
93 Ga0209564_1004983 3300025295 Bacteria 7819
94 Ga0209564_1017198 3300025295 Bacteria 2832
95 Ga0209758_1001101 3300025297 Bacteria 34939
96 Ga0209758_1019219 3300025297 Bacteria 3306
97 Ga0209758_1046862 3300025297 Bacteria 1553
98 Ga0209050_1000008 3300025298 Bacteria 1144179
99 Ga0209050_1001244 3300025298 Bacteria 29472
100 Ga0209050_1006590 3300025298 Bacteria 6818
101 Ga0209050_1023484 3300025298 Bacteria 2168
102 Ga0209256_1000003 3300025299 Bacteria 1661127
103 Ga0209256_1000131 3300025299 Bacteria 162368
104 Ga0207426_1000091 3300025302 Bacteria 280561
105 Ga0207426_1005778 3300025302 Bacteria 5555
106 Ga0209051_1000005 3300025303 Bacteria 1142353
107 Ga0209051_1003864 3300025303 Bacteria 9573
108 Ga0209051_1007713 3300025303 Bacteria 5835
109 Ga0209257_1000048 3300025304 Bacteria 455536
110 Ga0209257_1000091 3300025304 Bacteria 270637
111 Ga0209257_1001570 3300025304 Bacteria 26406
112 Ga0209257_1001625 3300025304 Bacteria 25742
113 Ga0209257_1005559 3300025304 Bacteria 8776
114 Ga0209257_1012006 3300025304 Bacteria 4073
115 Ga0207707_10421628 3300025912 Bacteria 1144
116 Ga0207695_10173819 3300025913 Bacteria 2077
117 Ga0207671_10000253 3300025914 Bacteria 80240
118 Ga0207660_10024148 3300025917 Bacteria 4112
119 Ga0207652_10019292 3300025921 Bacteria 5607
120 Ga0207667_10214439 3300025949 Bacteria 1973
121 Ga0207639_10640851 3300026041 Bacteria 982
122 Ga0207674_10016123 3300026116 Bacteria 8186
123 Ga0209970_1000297 3300027614 Bacteria 8189
124 Ga0307517_10005537 3300028786 Bacteria 18980
125 Ga0307515_10223916 3300028794 Bacteria 1691
126 Ga0265338_10014893 3300028800 Bacteria 8601
127 Ga0265338_10031719 3300028800 Bacteria 5173
128 Ga0265328_10101184 3300031239 Bacteria 1067
129 Ga0265325_10021407 3300031241 Bacteria 3552
130 Ga0265325_10115300 3300031241 Bacteria 1301
131 Ga0265339_10001174 3300031249 Bacteria 19772
132 Ga0265331_10133926 3300031250 Bacteria 1129
133 Ga0265327_10000010 3300031251 Bacteria 566817
134 Ga0307513_10000206 3300031456 Bacteria 85338
135 Ga0307513_10000543 3300031456 Bacteria 53868
136 Ga0307513_10115722 3300031456 Bacteria 2663
137 Ga0307408_100019595 3300031548 Bacteria 4556
138 Ga0307408_100027315 3300031548 Bacteria 3931
139 Ga0265313_10000523 3300031595 Bacteria 40161
140 Ga0265314_10063924 3300031711 Bacteria 2494
141 Ga0265342_10010417 3300031712 Bacteria 6449
142 Ga0307516_10005941 3300031730 Bacteria 14438
143 Ga0307516_10092893 3300031730 Bacteria 2844
144 Ga0307406_10017312 3300031901 Bacteria 4197
145 Ga0307406_10481724 3300031901 Bacteria 1002
146 Ga0307412_10761090 3300031911 Bacteria 837
147 Ga0307416_100184742 3300032002 Bacteria 1958
148 Ga0307416_100422533 3300032002 Bacteria 1378
149 Ga0307507_10000769 3300033179 Bacteria 70490
150 Ga0307510_10003047 3300033180 Bacteria 19348
151 Ga0395899_0000001 3300037312 Bacteria 1750322
152 Ga0436365_0833750 3300039437 Bacteria 1611
153 Ga0436363_0174408 3300039450 Bacteria 2155
154 Ga0451791_0325970 3300041451 Bacteria 1861
155 Ga0451853_3001305 3300041512 Bacteria 1519
156 Ga0466969_0004773 3300044656 Bacteria 7216
157 Ga0466966_0113482 3300044684 Bacteria 1669
158 Ga0466963_0216809 3300044694 Bacteria 1340
159 Ga0466970_0067680 3300044765 Bacteria 1918
160 Ga0495605_0142239 3300046474 Bacteria 1075
161 Ga0495596_0132272 3300046500 Bacteria 968
162 Ga0495606_0003125 3300046507 Bacteria 17981
163 Ga0495606_0316608 3300046507 Bacteria 840
164 Ga0495610_0036807 3300046512 Bacteria 2498
165 Ga0495616_0027265 3300046513 Bacteria 3033
166 Ga0495631_0008204 3300046518 Bacteria 5268
167 Ga0495631_0050118 3300046518 Bacteria 1827
168 Ga0495668_0005804 3300046616 Bacteria 8251
169 Ga0495661_0000305 3300046665 Bacteria 55940
170 Ga0495683_0120230 3300047323 Unclassified 1247
171 Ga0495687_000785 3300047443 Bacteria 34129
172 Ga0495681_0015890 3300047470 Bacteria 4248
173 Ga0496121_0121537 3300048924 Bacteria 1972
174 Ga0496121_0151614 3300048924 Bacteria 1705
175 Ga0496122_0017857 3300048925 Bacteria 6594
176 Ga0496123_0016549 3300048926 Bacteria 5979
177 Ga0496124_0000022 3300048927 Bacteria 421020
178 Ga0496125_0354907 3300048928 Bacteria 874
179 Ga0496126_0014723 3300048929 Bacteria 7892
180 Ga0496126_0034413 3300048929 Bacteria 4758
181 Ga0496126_0288480 3300048929 Bacteria 1358
182 Ga0501305_024838 3300049161 Bacteria 905
183 Ga0501034_0110874 3300049571 Bacteria 2734
184 Ga0501034_0183889 3300049571 Bacteria 2054
185 Ga0501206_004876 3300049653 Bacteria 1720
186 Ga0501257_006876 3300049686 Bacteria 2532
187 Ga0501225_0082966 3300049705 Bacteria 922
188 Ga0501262_008676 3300049759 Bacteria 1246
189 Ga0501265_001232 3300049762 Bacteria 2894
190 Ga0501044_0029143 3300049823 Bacteria 5822
191 nmdc:mga0k408_2159_c1 3300050493 Bacteria 10550
192 Ga0500644_0068851 3300053088 Bacteria 1269
193 Ga0500651_0026383 3300053093 Bacteria 3651
194 Ga0500566_0071336 3300053094 Bacteria 1949
195 Ga0500566_0201066 3300053094 Bacteria 1006
196 Ga0500650_0128395 3300053098 Bacteria 1179
197 Ga0500660_126571 3300053100 Bacteria 1050
198 Ga0500593_000456 3300053117 Bacteria 16197
199 Ga0500608_000867 3300053122 Bacteria 10918
200 Ga0500604_0001562 3300053151 Bacteria 6412
201 Ga0500604_0064080 3300053151 Unclassified 1160
202 Ga0500616_0000007 3300053153 Bacteria 836875
203 Ga0500616_0000324 3300053153 Bacteria 68394
204 Ga0500622_0082408 3300053156 Bacteria 1609
205 Ga0500634_0000006 3300053161 Bacteria 171639
206 Ga0500645_001755 3300053730 Bacteria 10517
207 Ga0500645_003241 3300053730 Bacteria 6727
208 Ga0500645_004768 3300053730 Bacteria 5132
209 Ga0500645_035977 3300053730 Bacteria 1474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003794 Ga0055531_10015747 Ga0055531_100157472 200
2 3300025298 Ga0209050_1023484 Ga0209050_10234841 200
3 3300025304 Ga0209257_1000091 Ga0209257_1000091188 200
4 3300044694 Ga0466963_0216809 Ga0466963_0216809_511_1134 200
5 3300048925 Ga0496122_0017857 Ga0496122_0017857_2641_3255 200
6 3300048926 Ga0496123_0016549 Ga0496123_0016549_2729_3343 200
7 3300048929 Ga0496126_0014723 Ga0496126_0014723_2024_2638 200
8 3300039450 Ga0436363_0174408 Ga0436363_0174408_508_1119 201
9 3300044684 Ga0466966_0113482 Ga0466966_0113482_591_1202 201
10 3300046474 Ga0495605_0142239 Ga0495605_0142239_193_810 201
11 3300046507 Ga0495606_0003125 Ga0495606_0003125_13822_14439 201
12 3300046512 Ga0495610_0036807 Ga0495610_0036807_1829_2446 201
13 3300046513 Ga0495616_0027265 Ga0495616_0027265_2396_3013 201
14 3300046518 Ga0495631_0050118 Ga0495631_0050118_274_891 201
15 3300047470 Ga0495681_0015890 Ga0495681_0015890_2752_3369 201
16 3300048927 Ga0496124_0000022 Ga0496124_0000022_134639_135256 201
17 iso_pu_bacteria 2970054988 2970057579 205
18 3300039437 Ga0436365_0833750 Ga0436365_0833750_114_743 206
19 3300044656 Ga0466969_0004773 Ga0466969_0004773_4113_4757 207
20 3300044765 Ga0466970_0067680 Ga0466970_0067680_396_1040 207
21 iso_pu_bacteria 2510065057 2510308043 207
22 iso_pu_bacteria 2511231052 2511503656 207
23 iso_pu_bacteria 2513237086 2513586533 207
24 iso_pu_bacteria 2513237091 2513620256 207
25 iso_pu_bacteria 2516653046 2516897836 207
26 iso_pu_bacteria 2551306084 2551680757 207
27 iso_pu_bacteria 2551306085 2551689941 207
28 iso_pu_bacteria 2551306086 2551696632 207
29 iso_pu_bacteria 2551306087 2551698361 207
30 iso_pu_bacteria 2551306087 2551701577 207
31 iso_pu_bacteria 2551306090 2551722143 207
32 iso_pu_bacteria 2551306091 2551729855 207
33 iso_pu_bacteria 2551306092 2551738544 207
34 iso_pu_bacteria 2551306093 2551742402 207
35 iso_pu_bacteria 2585427633 2585993816 207
36 iso_pu_bacteria 2585427634 2586004740 207
37 iso_pu_bacteria 2643221557 2643805629 207
38 iso_pu_bacteria 2643221591 2643964177 207
39 iso_pu_bacteria 2643221610 2644064561 207
40 iso_pu_bacteria 2643221618 2644106458 207
41 iso_pu_bacteria 2643221626 2644149215 207
42 iso_pu_bacteria 2643221655 2644308341 207
43 iso_pu_bacteria 2643221659 2644332053 207
44 iso_pu_bacteria 2643221668 2644377068 207
45 iso_pu_bacteria 2643221675 2644419558 207
46 iso_pu_bacteria 2643221680 2644452915 207
47 iso_pu_bacteria 2643221698 2644544427 207
48 iso_pu_bacteria 2643221712 2644615729 207
49 iso_pu_bacteria 2643221723 2644672315 207
50 iso_pu_bacteria 2643221726 2644691906 207
51 iso_pu_bacteria 2718218233 2720617921 207
52 iso_pu_bacteria 2802428858 2802720108 207
53 iso_pu_bacteria 2802428861 2802739565 207
54 iso_pu_bacteria 2802428862 2802746032 207
55 iso_pu_bacteria 2842311132 2842316509 207
56 iso_pu_bacteria 2842341865 2842342264 207
57 iso_pu_bacteria 2844163670 2844165271 207
58 iso_pu_bacteria 2855825444 2855831230 207
59 iso_pu_bacteria 2855839649 2855845140 207
60 iso_pu_bacteria 2858800743 2858804553 207
61 iso_pu_bacteria 2898713307 2898716008 207
62 iso_pu_bacteria 2915993759 2915995825 207
63 iso_pu_bacteria 2916007675 2916013791 207
64 iso_pu_bacteria 2916014648 2916019780 207
65 iso_pu_bacteria 2916021584 2916027981 207
66 iso_pu_bacteria 2916028427 2916035107 207
67 iso_pu_bacteria 2916035215 2916035687 207
68 iso_pu_bacteria 2916041962 2916047872 207
69 iso_pu_bacteria 2916048683 2916053993 207
70 iso_pu_bacteria 2916055098 2916058522 207
71 iso_pu_bacteria 2916068649 2916070658 207
72 iso_pu_bacteria 2916076590 2916078810 207
73 iso_pu_bacteria 2919171160 2919176175 207
74 iso_pu_bacteria 2921201388 2921205979 207
75 iso_pu_bacteria 2921237296 2921242000 207
76 iso_pu_bacteria 2921244191 2921249722 207
77 iso_pu_bacteria 2921263974 2921269952 207
78 iso_pu_bacteria 2921282425 2921287881 207
79 iso_pu_bacteria 2921289301 2921295962 207
80 iso_pu_bacteria 2921296804 2921300757 207
81 iso_pu_bacteria 2924144063 2924150066 207
82 iso_pu_bacteria 2924158325 2924161335 207
83 iso_pu_bacteria 2924165586 2924172101 207
84 iso_pu_bacteria 2924172951 2924176538 207
85 iso_pu_bacteria 2924186466 2924192491 207
86 iso_pu_bacteria 2924193448 2924199990 207
87 iso_pu_bacteria 2924200457 2924205962 207
88 iso_pu_bacteria 2924207177 2924211843 207
89 iso_pu_bacteria 2924214083 2924214689 207
90 iso_pu_bacteria 2924221636 2924221659 207
91 iso_pu_bacteria 2924228884 2924230243 207
92 iso_pu_bacteria 2937002841 2937007912 207
93 iso_pu_bacteria 2937009748 2937014595 207
94 iso_pu_bacteria 2937016420 2937019699 207
95 iso_pu_bacteria 2937036028 2937037206 207
96 iso_pu_bacteria 2937042894 2937046399 207
97 iso_pu_bacteria 2937049772 2937055469 207
98 iso_pu_bacteria 2937056579 2937062286 207
99 iso_pu_bacteria 2937063883 2937067179 207
100 iso_pu_bacteria 2937071275 2937072548 207
101 iso_pu_bacteria 2937091812 2937094203 207
102 iso_pu_bacteria 2937098957 2937105943 207
103 iso_pu_bacteria 2937106411 2937106729 207
104 iso_pu_bacteria 2937126314 2937132778 207
105 iso_pu_bacteria 2941499720 2941505375 207
106 iso_pu_bacteria 2957388812 2957394198 207
107 iso_pu_bacteria 2957422303 2957429351 207
108 iso_pu_bacteria 2957430029 2957435359 207
109 iso_pu_bacteria 2957457609 2957459625 207
110 iso_pu_bacteria 2957464669 2957469908 207
111 iso_pu_bacteria 2957471148 2957471534 207
112 iso_pu_bacteria 2957478035 2957481807 207
113 iso_pu_bacteria 2957484790 2957489628 207
114 iso_pu_bacteria 2957498199 2957498430 207
115 iso_pu_bacteria 2957505466 2957511088 207
116 iso_pu_bacteria 2960584000 2960589814 207
117 iso_pu_bacteria 2960603979 2960609895 207
118 iso_pu_bacteria 2960617483 2960621964 207
119 iso_pu_bacteria 2960624210 2960628636 207
120 iso_pu_bacteria 2960631154 2960637744 207
121 iso_pu_bacteria 2960645483 2960651463 207
122 iso_pu_bacteria 2960652885 2960653387 207
123 iso_pu_bacteria 2960687367 2960688466 207
124 iso_pu_bacteria 2964607997 2964612771 207
125 iso_pu_bacteria 2964621998 2964626291 207
126 iso_pu_bacteria 2964628898 2964635515 207
127 iso_pu_bacteria 2964643177 2964648990 207
128 iso_pu_bacteria 2964649959 2964650549 207
129 iso_pu_bacteria 2964656573 2964658675 207
130 iso_pu_bacteria 2964663802 2964670022 207
131 iso_pu_bacteria 2964678106 2964684044 207
132 iso_pu_bacteria 2964685014 2964690847 207
133 iso_pu_bacteria 2964691889 2964697357 207
134 iso_pu_bacteria 2964698721 2964700409 207
135 iso_pu_bacteria 2964705432 2964708486 207
136 iso_pu_bacteria 2967664464 2967671256 207
137 iso_pu_bacteria 2967671571 2967676085 207
138 iso_pu_bacteria 2967678726 2967684263 207
139 iso_pu_bacteria 2967693043 2967698028 207
140 iso_pu_bacteria 2967699805 2967702770 207
141 iso_pu_bacteria 2967706974 2967710667 207
142 iso_pu_bacteria 2967714385 2967716032 207
143 iso_pu_bacteria 2967721400 2967722819 207
144 iso_pu_bacteria 2967728569 2967728618 207
145 iso_pu_bacteria 2967748971 2967752729 207
146 iso_pu_bacteria 2967762386 2967768956 207
147 iso_pu_bacteria 2967769361 2967774787 207
148 iso_pu_bacteria 2967775926 2967776211 207
149 iso_pu_bacteria 2970019648 2970025291 207
150 iso_pu_bacteria 2970033650 2970034962 207
151 iso_pu_bacteria 2970040964 2970044893 207
152 iso_pu_bacteria 2970047711 2970050799 207
153 iso_pu_bacteria 2970061556 2970061787 207
154 iso_pu_bacteria 2970068827 2970070633 207
155 iso_pu_bacteria 2970088815 2970089044 207
156 iso_pu_bacteria 2970109326 2970113136 207
157 iso_pu_bacteria 2970116247 2970121628 207
158 iso_pu_bacteria 2970129317 2970134080 207
159 iso_pu_bacteria 2970136068 2970143076 207
160 iso_pu_bacteria 2970149975 2970155934 207
161 iso_pu_bacteria 2970156795 2970163231 207
162 iso_pu_bacteria 2970164137 2970168902 207
163 iso_pu_bacteria 2970170962 2970175476 207
164 iso_pu_bacteria 2970177841 2970183187 207
165 iso_pu_bacteria 2970184632 2970188128 207
166 iso_pu_bacteria 2970191845 2970198071 207
167 iso_pu_bacteria 2977523885 2977524211 207
168 iso_pu_bacteria 2977537788 2977543656 207
169 iso_pu_bacteria 2977544691 2977546623 207
170 iso_pu_bacteria 2977551784 2977557106 207
171 iso_pu_bacteria 2977558990 2977564851 207
172 iso_pu_bacteria 2977572785 2977577835 207
173 iso_pu_bacteria 2977579622 2977580110 207
174 iso_pu_bacteria 648276728 648739978 207
175 iso_pu_bacteria 8003992118 8003997562 207
176 iso_pu_bacteria 2511231002 2511245299 208
177 3300009174 Ga0105241_10215155 Ga0105241_102151552 210
178 3300009545 Ga0105237_10000221 Ga0105237_1000022115 210
179 3300009551 Ga0105238_10002426 Ga0105238_1000242619 210
180 3300025914 Ga0207671_10000253 Ga0207671_1000025364 210
181 3300032002 Ga0307416_100184742 Ga0307416_1001847423 210
182 3300049161 Ga0501305_024838 Ga0501305_024838_11_646 210
183 3300049653 Ga0501206_004876 Ga0501206_004876_467_1102 210
184 3300049686 Ga0501257_006876 Ga0501257_006876_150_785 210
185 3300049705 Ga0501225_0082966 Ga0501225_0082966_19_654 210
186 3300049759 Ga0501262_008676 Ga0501262_008676_211_846 210
187 3300049762 Ga0501265_001232 Ga0501265_001232_2110_2745 210
188 3300002067 JGI24735J21928_10069428 JGI24735J21928_100694282 211
189 3300003187 JGI25151J46595_10045880 JGI25151J46595_100458802 211
190 3300003215 JGI25153J46596_10053264 JGI25153J46596_100532642 211
191 3300003320 rootH2_10194633 rootH2_101946332 211
192 3300003323 rootH1_10114170 rootH1_101141702 211
193 3300003775 Ga0055524_1000859 Ga0055524_100085918 211
194 3300003781 Ga0055536_1001320 Ga0055536_10013206 211
195 3300003792 Ga0055540_1000731 Ga0055540_10007312 211
196 3300003794 Ga0055531_10003518 Ga0055531_100035183 211
197 3300005458 Ga0070681_10013633 Ga0070681_100136334 211
198 3300005530 Ga0070679_100007570 Ga0070679_1000075704 211
199 3300005563 Ga0068855_100544373 Ga0068855_1005443732 211
200 3300009093 Ga0105240_10161808 Ga0105240_101618081 211
201 3300009174 Ga0105241_10212673 Ga0105241_102126732 211
202 3300010375 Ga0105239_10024169 Ga0105239_100241696 211
203 3300013249 Ga0171463_1002 Ga0171463_1002477 211
204 3300025292 Ga0209676_1001225 Ga0209676_100122523 211
205 3300025294 Ga0209025_1000470 Ga0209025_100047059 211
206 3300025294 Ga0209025_1107076 Ga0209025_11070762 211
207 3300025297 Ga0209758_1001101 Ga0209758_100110141 211
208 3300025299 Ga0209256_1000131 Ga0209256_1000131114 211
209 3300025303 Ga0209051_1003864 Ga0209051_10038643 211
210 3300025304 Ga0209257_1001570 Ga0209257_10015706 211
211 3300025304 Ga0209257_1001625 Ga0209257_10016257 211
212 3300025912 Ga0207707_10421628 Ga0207707_104216282 211
213 3300025913 Ga0207695_10173819 Ga0207695_101738191 211
214 3300025917 Ga0207660_10024148 Ga0207660_100241482 211
215 3300025921 Ga0207652_10019292 Ga0207652_100192924 211
216 3300025949 Ga0207667_10214439 Ga0207667_102144392 211
217 3300028794 Ga0307515_10223916 Ga0307515_102239162 211
218 3300028800 Ga0265338_10031719 Ga0265338_100317192 211
219 3300031239 Ga0265328_10101184 Ga0265328_101011841 211
220 3300031241 Ga0265325_10021407 Ga0265325_100214073 211
221 3300031241 Ga0265325_10115300 Ga0265325_101153002 211
222 3300031249 Ga0265339_10001174 Ga0265339_100011744 211
223 3300031250 Ga0265331_10133926 Ga0265331_101339261 211
224 3300031456 Ga0307513_10115722 Ga0307513_101157222 211
225 3300031595 Ga0265313_10000523 Ga0265313_1000052318 211
226 3300031711 Ga0265314_10063924 Ga0265314_100639242 211
227 3300031712 Ga0265342_10010417 Ga0265342_100104172 211
228 3300037312 Ga0395899_0000001 Ga0395899_0000001_1675349_1675987 211
229 3300046665 Ga0495661_0000305 Ga0495661_0000305_35068_35715 211
230 3300048924 Ga0496121_0121537 Ga0496121_0121537_1163_1813 211
231 3300048924 Ga0496121_0151614 Ga0496121_0151614_891_1541 211
232 3300048928 Ga0496125_0354907 Ga0496125_0354907_140_790 211
233 3300048929 Ga0496126_0034413 Ga0496126_0034413_373_1023 211
234 3300049571 Ga0501034_0110874 Ga0501034_0110874_1229_1879 211
235 3300053151 Ga0500604_0001562 Ga0500604_0001562_2100_2750 211
236 3300053151 Ga0500604_0064080 Ga0500604_0064080_493_1143 211
237 3300053153 Ga0500616_0000324 Ga0500616_0000324_42646_43296 211
238 3300053156 Ga0500622_0082408 Ga0500622_0082408_481_1137 211
239 3300053161 Ga0500634_0000006 Ga0500634_0000006_20699_21349 211
240 3300002704 JGI25155J39150_1000323 JGI25155J39150_100032315 212
241 3300002738 JGI25154J39366_1000657 JGI25154J39366_10006571 212
242 3300002741 JGI25157J39369_1000791 JGI25157J39369_10007911 212
243 3300002774 JGI25150J39212_1016184 JGI25150J39212_10161842 212
244 3300002987 JGI25159J45721_1000407 JGI25159J45721_10004071 212
245 3300002987 JGI25159J45721_1016390 JGI25159J45721_10163901 212
246 3300003187 JGI25151J46595_10010088 JGI25151J46595_100100881 212
247 3300003187 JGI25151J46595_10014781 JGI25151J46595_100147812 212
248 3300003187 JGI25151J46595_10015740 JGI25151J46595_100157402 212
249 3300003322 rootL2_10193618 rootL2_101936182 212
250 3300003354 JGI25160J50197_1000172 JGI25160J50197_100017249 212
251 3300003374 JGI25161J50226_1000007 JGI25161J50226_100000780 212
252 3300003771 Ga0055526_1009546 Ga0055526_10095463 212
253 3300003771 Ga0055526_1018589 Ga0055526_10185893 212
254 3300003773 Ga0055537_1000356 Ga0055537_10003563 212
255 3300003773 Ga0055537_1022752 Ga0055537_10227521 212
256 3300003775 Ga0055524_1000213 Ga0055524_100021330 212
257 3300003781 Ga0055536_1003918 Ga0055536_10039188 212
258 3300003781 Ga0055536_1005157 Ga0055536_10051571 212
259 3300003781 Ga0055536_1035843 Ga0055536_10358431 212
260 3300003784 Ga0055534_1015169 Ga0055534_10151691 212
261 3300003790 Ga0055528_1002730 Ga0055528_10027305 212
262 3300003791 Ga0055530_10001299 Ga0055530_100012991 212
263 3300003792 Ga0055540_1000504 Ga0055540_100050431 212
264 3300003794 Ga0055531_10004306 Ga0055531_100043061 212
265 3300003794 Ga0055531_10025776 Ga0055531_100257762 212
266 3300004625 Ga0055543_1005400 Ga0055543_10054004 212
267 3300005471 Ga0070698_101227962 Ga0070698_1012279621 212
268 3300005539 Ga0068853_100005264 Ga0068853_10000526415 212
269 3300005539 Ga0068853_100598577 Ga0068853_1005985772 212
270 3300005563 Ga0068855_100057666 Ga0068855_1000576662 212
271 3300006058 Ga0075432_10002756 Ga0075432_100027565 212
272 3300006177 Ga0075362_10131882 Ga0075362_101318822 212
273 3300010375 Ga0105239_10233704 Ga0105239_102337042 212
274 3300012513 Ga0157326_1009622 Ga0157326_10096221 212
275 3300025206 Ga0209435_100019 Ga0209435_100019131 212
276 3300025208 Ga0209436_111330 Ga0209436_1113302 212
277 3300025245 Ga0207425_1001535 Ga0207425_10015351 212
278 3300025245 Ga0207425_1001851 Ga0207425_10018513 212
279 3300025246 Ga0209646_1000038 Ga0209646_1000038132 212
280 3300025250 Ga0209026_1000048 Ga0209026_1000048131 212
281 3300025256 Ga0209759_1000038 Ga0209759_1000038113 212
282 3300025263 Ga0209565_1000041 Ga0209565_100004122 212
283 3300025263 Ga0209565_1000333 Ga0209565_10003332 212
284 3300025263 Ga0209565_1024124 Ga0209565_10241242 212
285 3300025273 Ga0209673_1000364 Ga0209673_100036413 212
286 3300025284 Ga0209130_1000245 Ga0209130_10002451 212
287 3300025284 Ga0209130_1000708 Ga0209130_100070830 212
288 3300025291 Ga0209675_1004149 Ga0209675_10041491 212
289 3300025291 Ga0209675_1020023 Ga0209675_10200232 212
290 3300025291 Ga0209675_1045777 Ga0209675_10457771 212
291 3300025292 Ga0209676_1000013 Ga0209676_1000013257 212
292 3300025292 Ga0209676_1002248 Ga0209676_100224812 212
293 3300025292 Ga0209676_1003354 Ga0209676_100335410 212
294 3300025294 Ga0209025_1008649 Ga0209025_10086494 212
295 3300025294 Ga0209025_1010276 Ga0209025_10102763 212
296 3300025294 Ga0209025_1011906 Ga0209025_10119062 212
297 3300025294 Ga0209025_1023660 Ga0209025_10236604 212
298 3300025295 Ga0209564_1000875 Ga0209564_100087516 212
299 3300025295 Ga0209564_1004983 Ga0209564_10049833 212
300 3300025295 Ga0209564_1017198 Ga0209564_10171981 212
301 3300025297 Ga0209758_1019219 Ga0209758_10192193 212
302 3300025297 Ga0209758_1046862 Ga0209758_10468621 212
303 3300025298 Ga0209050_1000008 Ga0209050_1000008257 212
304 3300025298 Ga0209050_1001244 Ga0209050_100124410 212
305 3300025299 Ga0209256_1000003 Ga0209256_1000003144 212
306 3300025302 Ga0207426_1000091 Ga0207426_1000091139 212
307 3300025302 Ga0207426_1005778 Ga0207426_10057781 212
308 3300025303 Ga0209051_1000005 Ga0209051_1000005257 212
309 3300025303 Ga0209051_1007713 Ga0209051_10077136 212
310 3300025304 Ga0209257_1000048 Ga0209257_1000048257 212
311 3300025304 Ga0209257_1005559 Ga0209257_10055593 212
312 3300025304 Ga0209257_1012006 Ga0209257_10120063 212
313 3300026041 Ga0207639_10640851 Ga0207639_106408511 212
314 3300026116 Ga0207674_10016123 Ga0207674_100161232 212
315 3300027614 Ga0209970_1000297 Ga0209970_10002978 212
316 3300028800 Ga0265338_10014893 Ga0265338_100148937 212
317 3300031251 Ga0265327_10000010 Ga0265327_10000010110 212
318 3300031456 Ga0307513_10000206 Ga0307513_1000020618 212
319 3300031456 Ga0307513_10000543 Ga0307513_1000054347 212
320 3300031548 Ga0307408_100019595 Ga0307408_1000195953 212
321 3300031548 Ga0307408_100027315 Ga0307408_1000273155 212
322 3300031730 Ga0307516_10005941 Ga0307516_1000594112 212
323 3300031730 Ga0307516_10092893 Ga0307516_100928933 212
324 3300031901 Ga0307406_10017312 Ga0307406_100173125 212
325 3300031901 Ga0307406_10481724 Ga0307406_104817241 212
326 3300031911 Ga0307412_10761090 Ga0307412_107610901 212
327 3300032002 Ga0307416_100422533 Ga0307416_1004225332 212
328 3300041451 Ga0451791_0325970 Ga0451791_0325970_454_1098 212
329 3300041512 Ga0451853_3001305 Ga0451853_3001305_406_1050 212
330 3300049571 Ga0501034_0183889 Ga0501034_0183889_695_1342 212
331 3300050493 nmdc:mga0k408_2159_c1 nmdc:mga0k408_2159_c1_7933_8577 212
332 3300053088 Ga0500644_0068851 Ga0500644_0068851_347_1069 212
333 3300053093 Ga0500651_0026383 Ga0500651_0026383_685_1329 212
334 3300053094 Ga0500566_0071336 Ga0500566_0071336_809_1543 212
335 3300053094 Ga0500566_0201066 Ga0500566_0201066_241_915 212
336 3300053098 Ga0500650_0128395 Ga0500650_0128395_264_938 212
337 3300053100 Ga0500660_126571 Ga0500660_126571_232_876 212
338 3300053117 Ga0500593_000456 Ga0500593_000456_222_866 212
339 3300053730 Ga0500645_001755 Ga0500645_001755_9087_9761 212
340 3300053730 Ga0500645_003241 Ga0500645_003241_1117_1761 212
341 3300053730 Ga0500645_004768 Ga0500645_004768_4306_4950 212
342 3300053730 Ga0500645_035977 Ga0500645_035977_272_916 212
343 3300001989 JGI24739J22299_10115417 JGI24739J22299_101154172 213
344 3300003320 rootH2_10004521 rootH2_100045216 213
345 3300003320 rootH2_10028784 rootH2_1002878420 213
346 3300003320 rootH2_10139151 rootH2_101391515 213
347 3300005262 Ga0065165_1001170 Ga0065165_100117019 213
348 3300005262 Ga0065165_1053854 Ga0065165_10538542 213
349 3300005539 Ga0068853_100019944 Ga0068853_1000199447 213
350 3300005614 Ga0068856_100079821 Ga0068856_1000798213 213
351 3300005718 Ga0068866_10373673 Ga0068866_103736732 213
352 3300013306 Ga0163162_10023053 Ga0163162_100230535 213
353 3300025298 Ga0209050_1006590 Ga0209050_10065905 213
354 3300028786 Ga0307517_10005537 Ga0307517_100055378 213
355 3300033179 Ga0307507_10000769 Ga0307507_1000076933 213
356 3300033180 Ga0307510_10003047 Ga0307510_100030474 213
357 3300046500 Ga0495596_0132272 Ga0495596_0132272_258_902 213
358 3300046507 Ga0495606_0316608 Ga0495606_0316608_59_703 213
359 3300046518 Ga0495631_0008204 Ga0495631_0008204_3657_4301 213
360 3300046616 Ga0495668_0005804 Ga0495668_0005804_3198_3857 213
361 3300047323 Ga0495683_0120230 Ga0495683_0120230_456_1100 213
362 3300047443 Ga0495687_000785 Ga0495687_000785_14613_15254 213
363 3300048929 Ga0496126_0288480 Ga0496126_0288480_589_1233 213
364 3300049823 Ga0501044_0029143 Ga0501044_0029143_4944_5597 213
365 3300053122 Ga0500608_000867 Ga0500608_000867_1869_2513 213
366 3300053153 Ga0500616_0000007 Ga0500616_0000007_566843_567496 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

33

138

0.92

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

156

0.85

PF13460

NAD_binding_10

NAD(P)H-binding

37

233

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dhn-assembly1.cif.gz_A crystal structure of the putative epimerase q89z24_bactn from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr310. 0.9543 2 213
4jgb-assembly2.cif.gz_B crystal structure of putative exported protein from burkholderia pseudomallei 0.9304 1 213
4jgb-assembly1.cif.gz_A crystal structure of putative exported protein from burkholderia pseudomallei 0.93 1 213
3dhn-assembly1.cif.gz_A crystal structure of the putative epimerase q89z24_bactn from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr310. 0.9281 2 213
4jgb-assembly2.cif.gz_B crystal structure of putative exported protein from burkholderia pseudomallei 0.9217 1 213
ID Description Score Start End Superfamily
3dhnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.956 2 213 3.40.50.720
4jgbB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9304 1 213 3.40.50.720
4jgbB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9217 1 213 3.40.50.720
3dhnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9162 2 213 3.40.50.720
4r01B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9112 1 212 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3B7N047-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.992 1 213 GO:0016646
AF-A0A522T0B2-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9893 61 213 GO:0016646
AF-A0A643F4N6-F1-model_v4 NAD(P)-dependent oxidoreductase 0.989 2 213 GO:0016646
AF-A0A256FHA7-F1-model_v4 3-beta hydroxysteroid dehydrogenase/isomerase family protein 0.9887 2 213 GO:0016646
GO:0016853
AF-A0A368K7G6-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9884 2 213 GO:0016646

Feature Viewer

pLDDT pTM Quality
96.93 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map