F424117

General Info

Members Datasets Scaffolds Average Seq Length
366 113 733 285

Family's Representative Sequence

Representative Sequence 3300046513|Ga0495616_0000193|Ga0495616_0000193_46201_47124
Length 307
Sequence VILPPFRLHRMAQKGTHMSFSSFASFFRGGRRQPVLALLASLLLALALPAHADLMLHPTRIVFEKNQRAAQIELINNGSKPATYRISLVNRRMTEAGQFEAADNAAPDEHFADAMLRFSPRQVTLEPGTAQTVRVMLRKPAELANGEYRSHLQFDRLPDAEGNASIENGGKGADGKGIGVVLNTLIGASVPVIVRHGATSANVSLAGLALKKDETQRLLLALQFEREGSSSVYGDLDVTFTPHGGKPQTLTQVVGIAVYTPNRVRQAALPLAVPAGVALANGTIEVRYRERPEAGGKLLAQANLELP

Samples

Sample ID Description Type Environment
1 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
9 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
10 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
11 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
13 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
16 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
17 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
18 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
19 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
20 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
21 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
22 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
23 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
24 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
25 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
26 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
27 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
28 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
29 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
30 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
31 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
32 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
33 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
34 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
35 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
36 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
37 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
38 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
39 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
40 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
41 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
42 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
43 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
44 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
45 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
46 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
47 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
48 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
49 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
50 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
51 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
52 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
53 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
54 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
55 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
56 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
57 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
58 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
59 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
60 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
61 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
62 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
63 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
64 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
65 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
66 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
67 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
68 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
69 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
70 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
71 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
72 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
73 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
74 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
75 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
76 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
79 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
80 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
81 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
82 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
83 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
84 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
85 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
86 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
87 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
88 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
89 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
90 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
91 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
96 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
109 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
110 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
111 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
112 2738541337 Pelomonas sp. BT06 Isolate Unclassified
113 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0
Rhizoplane 3.28
Rhizosphere 91.53
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495616_0000193 3300046513 Bacteria 50722
2 rootH1_10079852 3300003316 Bacteria 3959
3 rootL2_10005034 3300003322 Bacteria 7105
4 rootH1_10011039 3300003316 Bacteria 2289
5 rootH1_10011039 3300003323 Bacteria 8468
6 rootH1_10011041 3300003323 Bacteria 3958
7 Ga0055531_10000064 3300003794 Bacteria 117923
8 Ga0065165_1001239 3300005262 Bacteria 29150
9 Ga0068856_100129579 3300005614 Bacteria 2527
10 Ga0068863_100017903 3300005841 Bacteria 6780
11 Ga0213872_10000058 3300021361 Bacteria 100531
12 Ga0213872_10000150 3300021361 Bacteria 63730
13 Ga0213872_10003619 3300021361 Bacteria 8485
14 Ga0213872_10106640 3300021361 Bacteria 1246
15 Ga0209050_1002657 3300025298 Bacteria 14616
16 Ga0209051_1006872 3300025303 Bacteria 6324
17 Ga0209257_1000094 3300025304 Bacteria 262243
18 Ga0209257_1018582 3300025304 Bacteria 2664
19 Ga0207685_10082614 3300025905 Bacteria 1333
20 Ga0207702_10080273 3300026078 Bacteria 2830
21 Ga0307515_10036843 3300028794 Bacteria 7894
22 Ga0316177_1042130 3300030731 Unclassified 2449
23 Ga0316180_1003511 3300030736 Bacteria 6192
24 Ga0265331_10003453 3300031250 Bacteria 10209
25 Ga0265327_10000012 3300031251 Bacteria 530403
26 Ga0395905_0000719 3300037471 Bacteria 43703
27 Ga0395905_0041799 3300037471 Bacteria 4302
28 Ga0436361_0018388 3300039447 Bacteria 44345
29 Ga0436361_0068556 3300039447 Bacteria 100895
30 Ga0436361_0700482 3300039447 Bacteria 4598
31 Ga0436361_0850324 3300039447 Bacteria 16256
32 Ga0436363_0785503 3300039450 Unclassified 1981
33 Ga0450904_001513 3300042139 Bacteria 3198
34 Ga0466957_0000994 3300044842 Bacteria 14564
35 Ga0495617_000002 3300046452 Bacteria 710121
36 Ga0495617_006501 3300046452 Bacteria 4093
37 Ga0495627_000339 3300046453 Bacteria 44178
38 Ga0495627_009600 3300046453 Bacteria 3552
39 Ga0495627_036739 3300046453 Bacteria 1521
40 Ga0495603_0010744 3300046455 Bacteria 5553
41 Ga0495590_0000007 3300046457 Bacteria 331108
42 Ga0495590_0002842 3300046457 Bacteria 7137
43 Ga0495590_0004702 3300046457 Bacteria 5476
44 Ga0495590_0049214 3300046457 Bacteria 1471
45 Ga0495591_000039 3300046458 Bacteria 156460
46 Ga0495653_0011532 3300046463 Bacteria 7217
47 Ga0495653_0014264 3300046463 Bacteria 6478
48 Ga0495653_0023115 3300046463 Bacteria 5027
49 Ga0495650_0010045 3300046471 Bacteria 5322
50 Ga0495650_0017064 3300046471 Bacteria 3652
51 Ga0495580_0011731 3300046472 Bacteria 6767
52 Ga0495582_0011683 3300046473 Bacteria 4838
53 Ga0495605_0000108 3300046474 Bacteria 104865
54 Ga0495605_0005103 3300046474 Bacteria 7655
55 Ga0495605_0007197 3300046474 Bacteria 6329
56 Ga0495605_0008500 3300046474 Bacteria 5803
57 Ga0495605_0009080 3300046474 Bacteria 5596
58 Ga0495605_0010316 3300046474 Bacteria 5229
59 Ga0495605_0011252 3300046474 Bacteria 4995
60 Ga0495605_0013904 3300046474 Bacteria 4420
61 Ga0495605_0196322 3300046474 Bacteria 881
62 Ga0495584_0000712 3300046491 Bacteria 21938
63 Ga0495584_0002110 3300046491 Bacteria 11395
64 Ga0495584_0003500 3300046491 Bacteria 8625
65 Ga0495584_0005350 3300046491 Bacteria 6802
66 Ga0495584_0005403 3300046491 Bacteria 6767
67 Ga0495584_0006348 3300046491 Bacteria 6194
68 Ga0495584_0013577 3300046491 Bacteria 4157
69 Ga0495584_0018737 3300046491 Bacteria 3518
70 Ga0495584_0020123 3300046491 Bacteria 3391
71 Ga0495585_0001726 3300046492 Bacteria 16648
72 Ga0495585_0002480 3300046492 Bacteria 13169
73 Ga0495585_0010549 3300046492 Bacteria 5496
74 Ga0495585_0011985 3300046492 Bacteria 5117
75 Ga0495585_0012408 3300046492 Bacteria 5021
76 Ga0495585_0041301 3300046492 Bacteria 2587
77 Ga0495585_0127467 3300046492 Bacteria 1342
78 Ga0495585_0134874 3300046492 Bacteria 1296
79 Ga0495585_0144337 3300046492 Bacteria 1244
80 Ga0495585_0152714 3300046492 Bacteria 1203
81 Ga0495594_0009109 3300046499 Bacteria 5124
82 Ga0495594_0028756 3300046499 Bacteria 3000
83 Ga0495594_0096666 3300046499 Bacteria 1660
84 Ga0495596_0002487 3300046500 Bacteria 9880
85 Ga0495596_0003084 3300046500 Bacteria 8604
86 Ga0495596_0007518 3300046500 Bacteria 4912
87 Ga0495596_0010547 3300046500 Bacteria 4020
88 Ga0495596_0011447 3300046500 Bacteria 3828
89 Ga0495596_0014049 3300046500 Bacteria 3377
90 Ga0495596_0016256 3300046500 Bacteria 3093
91 Ga0495596_0065976 3300046500 Bacteria 1407
92 Ga0495596_0133968 3300046500 Bacteria 961
93 Ga0495607_0001375 3300046501 Bacteria 21626
94 Ga0495607_0002023 3300046501 Bacteria 16982
95 Ga0495607_0002838 3300046501 Bacteria 13749
96 Ga0495607_0002914 3300046501 Bacteria 13492
97 Ga0495607_0027946 3300046501 Bacteria 3483
98 Ga0495607_0208870 3300046501 Bacteria 962
99 Ga0495583_0000503 3300046506 Bacteria 56256
100 Ga0495583_0001311 3300046506 Bacteria 25872
101 Ga0495583_0001962 3300046506 Bacteria 18882
102 Ga0495583_0005566 3300046506 Bacteria 8508
103 Ga0495583_0008040 3300046506 Bacteria 6505
104 Ga0495583_0008628 3300046506 Bacteria 6202
105 Ga0495583_0024658 3300046506 Bacteria 3017
106 Ga0495583_0028354 3300046506 Bacteria 2754
107 Ga0495606_0027117 3300046507 Bacteria 4068
108 Ga0495606_0048262 3300046507 Bacteria 2802
109 Ga0495606_0060744 3300046507 Bacteria 2420
110 Ga0495606_0093382 3300046507 Bacteria 1846
111 Ga0495606_0234235 3300046507 Bacteria 1027
112 Ga0495610_0002370 3300046512 Bacteria 15919
113 Ga0495610_0063096 3300046512 Bacteria 1756
114 Ga0495616_0004553 3300046513 Bacteria 8727
115 Ga0495616_0006451 3300046513 Bacteria 7093
116 Ga0495616_0007749 3300046513 Bacteria 6414
117 Ga0495616_0011802 3300046513 Bacteria 4985
118 Ga0495616_0025202 3300046513 Bacteria 3180
119 Ga0495616_0034551 3300046513 Bacteria 2625
120 Ga0495616_0102871 3300046513 Bacteria 1338
121 Ga0495630_0172013 3300046517 Bacteria 1650
122 Ga0495631_0003682 3300046518 Bacteria 8359
123 Ga0495631_0004617 3300046518 Bacteria 7293
124 Ga0495631_0008028 3300046518 Bacteria 5333
125 Ga0495631_0008828 3300046518 Bacteria 5061
126 Ga0495631_0013206 3300046518 Bacteria 4014
127 Ga0495631_0031256 3300046518 Bacteria 2410
128 Ga0495631_0040039 3300046518 Bacteria 2077
129 Ga0495631_0043773 3300046518 Bacteria 1974
130 Ga0495631_0098687 3300046518 Bacteria 1257
131 Ga0495631_0120155 3300046518 Bacteria 1130
132 Ga0495631_0145959 3300046518 Bacteria 1015
133 Ga0495632_0000374 3300046519 Bacteria 42607
134 Ga0495632_0000837 3300046519 Bacteria 27084
135 Ga0495632_0000878 3300046519 Bacteria 26434
136 Ga0495632_0003384 3300046519 Bacteria 11360
137 Ga0495632_0006824 3300046519 Bacteria 7284
138 Ga0495632_0015440 3300046519 Bacteria 4281
139 Ga0495632_0029070 3300046519 Bacteria 2881
140 Ga0495632_0157543 3300046519 Bacteria 1047
141 Ga0495637_0000006 3300046520 Bacteria 435763
142 Ga0495637_0053847 3300046520 Bacteria 1673
143 Ga0495643_0002368 3300046522 Bacteria 15092
144 Ga0495643_0004152 3300046522 Bacteria 10287
145 Ga0495643_0005916 3300046522 Bacteria 8165
146 Ga0495643_0013968 3300046522 Bacteria 4787
147 Ga0495644_0003184 3300046523 Bacteria 6486
148 Ga0495644_0005351 3300046523 Bacteria 5011
149 Ga0495644_0007813 3300046523 Bacteria 4121
150 Ga0495644_0015325 3300046523 Bacteria 2935
151 Ga0495644_0019876 3300046523 Bacteria 2564
152 Ga0495644_0038451 3300046523 Bacteria 1804
153 Ga0495644_0044857 3300046523 Bacteria 1663
154 Ga0495644_0062740 3300046523 Bacteria 1396
155 Ga0495648_0000220 3300046524 Bacteria 65480
156 Ga0495648_0016893 3300046524 Bacteria 5243
157 Ga0495648_0017194 3300046524 Bacteria 5180
158 Ga0495648_0046068 3300046524 Bacteria 2707
159 Ga0495648_0161269 3300046524 Bacteria 1159
160 Ga0495648_0175706 3300046524 Unclassified 1093
161 Ga0495666_0035579 3300046526 Bacteria 2427
162 Ga0495666_0056388 3300046526 Bacteria 1882
163 Ga0495642_0000345 3300046528 Bacteria 25250
164 Ga0495642_0000855 3300046528 Bacteria 14486
165 Ga0495642_0003402 3300046528 Bacteria 6281
166 Ga0495642_0007904 3300046528 Bacteria 4074
167 Ga0495642_0010611 3300046528 Bacteria 3527
168 Ga0495642_0014317 3300046528 Bacteria 3072
169 Ga0495642_0020299 3300046528 Bacteria 2609
170 Ga0495642_0023975 3300046528 Bacteria 2412
171 Ga0495642_0045930 3300046528 Bacteria 1786
172 Ga0495642_0095522 3300046528 Bacteria 1261
173 Ga0495642_0121377 3300046528 Bacteria 1121
174 Ga0495652_0006263 3300046529 Bacteria 11091
175 Ga0495654_0030213 3300046530 Bacteria 2758
176 Ga0495654_0032844 3300046530 Bacteria 2629
177 Ga0495654_0077261 3300046530 Bacteria 1567
178 Ga0495654_0116874 3300046530 Bacteria 1211
179 Ga0495665_0012589 3300046531 Bacteria 4580
180 Ga0495665_0034590 3300046531 Bacteria 2702
181 Ga0495640_0006222 3300046533 Bacteria 9446
182 Ga0495586_0072136 3300046535 Bacteria 1887
183 Ga0495587_0010988 3300046536 Bacteria 5744
184 Ga0495609_0002572 3300046538 Bacteria 11067
185 Ga0495609_0011021 3300046538 Bacteria 4318
186 Ga0495609_0011147 3300046538 Bacteria 4291
187 Ga0495609_0011910 3300046538 Bacteria 4134
188 Ga0495609_0020131 3300046538 Bacteria 3083
189 Ga0495609_0079188 3300046538 Bacteria 1437
190 Ga0495597_0000332 3300046542 Bacteria 42493
191 Ga0495597_0000728 3300046542 Bacteria 26264
192 Ga0495597_0004004 3300046542 Bacteria 8275
193 Ga0495597_0006246 3300046542 Bacteria 6176
194 Ga0495597_0006868 3300046542 Bacteria 5843
195 Ga0495597_0019288 3300046542 Bacteria 3192
196 Ga0495597_0022095 3300046542 Bacteria 2953
197 Ga0495597_0032856 3300046542 Bacteria 2353
198 Ga0495597_0124678 3300046542 Bacteria 1071
199 Ga0495622_0007141 3300046557 Bacteria 5189
200 Ga0495633_0004093 3300046558 Bacteria 9407
201 Ga0495633_0010088 3300046558 Bacteria 5175
202 Ga0495633_0012004 3300046558 Bacteria 4630
203 Ga0495633_0022566 3300046558 Bacteria 3130
204 Ga0495633_0116986 3300046558 Bacteria 1235
205 Ga0495656_0013663 3300046615 Bacteria 3026
206 Ga0495656_0036060 3300046615 Bacteria 2035
207 Ga0495668_0004912 3300046616 Bacteria 9282
208 Ga0495668_0007659 3300046616 Bacteria 6872
209 Ga0495668_0018601 3300046616 Bacteria 4014
210 Ga0495668_0022412 3300046616 Bacteria 3610
211 Ga0495668_0052021 3300046616 Bacteria 2267
212 Ga0495668_0058727 3300046616 Bacteria 2122
213 Ga0495668_0079171 3300046616 Bacteria 1804
214 Ga0495634_0008121 3300046642 Bacteria 7823
215 Ga0495611_0000792 3300046648 Bacteria 17558
216 Ga0495611_0005177 3300046648 Bacteria 5592
217 Ga0495611_0007932 3300046648 Bacteria 4507
218 Ga0495611_0085048 3300046648 Bacteria 1458
219 Ga0495611_0173198 3300046648 Bacteria 1008
220 Ga0495625_0046240 3300046660 Bacteria 3142
221 Ga0495625_0102159 3300046660 Bacteria 1968
222 Ga0495625_0251394 3300046660 Bacteria 1147
223 Ga0495635_0000550 3300046663 Bacteria 23878
224 Ga0495661_0001851 3300046665 Bacteria 16899
225 Ga0495661_0005503 3300046665 Bacteria 8989
226 Ga0495661_0006457 3300046665 Bacteria 8247
227 Ga0495661_0007032 3300046665 Bacteria 7867
228 Ga0495661_0020575 3300046665 Bacteria 4306
229 Ga0495661_0027218 3300046665 Bacteria 3672
230 Ga0495661_0039122 3300046665 Bacteria 2949
231 Ga0495661_0071227 3300046665 Bacteria 2032
232 Ga0495661_0140081 3300046665 Bacteria 1316
233 Ga0495661_0169989 3300046665 Bacteria 1163
234 Ga0495661_0213401 3300046665 Bacteria 1003
235 Ga0495588_0003189 3300046674 Bacteria 7097
236 Ga0495588_0006653 3300046674 Bacteria 5219
237 Ga0495588_0020202 3300046674 Bacteria 3270
238 Ga0495588_0044841 3300046674 Bacteria 2265
239 Ga0495588_0057501 3300046674 Bacteria 2009
240 Ga0495588_0089773 3300046674 Bacteria 1609
241 Ga0495588_0104407 3300046674 Bacteria 1490
242 Ga0495623_0010770 3300046679 Bacteria 5921
243 Ga0495623_0011213 3300046679 Bacteria 5798
244 Ga0495669_0000305 3300046684 Bacteria 27179
245 Ga0495669_0000799 3300046684 Bacteria 13449
246 Ga0495669_0002363 3300046684 Bacteria 7738
247 Ga0495669_0007473 3300046684 Bacteria 4582
248 Ga0495669_0018474 3300046684 Bacteria 2998
249 Ga0495669_0060188 3300046684 Bacteria 1716
250 Ga0495669_0071297 3300046684 Bacteria 1584
251 Ga0495613_0026565 3300046689 Bacteria 4312
252 Ga0495613_0072579 3300046689 Bacteria 2509
253 Ga0495670_0000228 3300046691 Bacteria 25521
254 Ga0495670_0004763 3300046691 Bacteria 6665
255 Ga0495670_0006478 3300046691 Bacteria 5754
256 Ga0495670_0008864 3300046691 Bacteria 4949
257 Ga0495670_0026331 3300046691 Bacteria 2878
258 Ga0495670_0029075 3300046691 Bacteria 2742
259 Ga0495671_0004166 3300046692 Bacteria 8712
260 Ga0495671_0006131 3300046692 Bacteria 6975
261 Ga0495671_0015767 3300046692 Bacteria 4043
262 Ga0495649_0000511 3300046694 Bacteria 33219
263 Ga0495649_0002688 3300046694 Bacteria 12388
264 Ga0495649_0033054 3300046694 Bacteria 2847
265 Ga0495649_0072916 3300046694 Bacteria 1840
266 Ga0495649_0097724 3300046694 Bacteria 1562
267 Ga0495589_0000569 3300046794 Bacteria 25465
268 Ga0495589_0000651 3300046794 Bacteria 22766
269 Ga0495589_0013689 3300046794 Bacteria 4182
270 Ga0495589_0018910 3300046794 Bacteria 3533
271 Ga0495589_0028227 3300046794 Bacteria 2832
272 Ga0495589_0038954 3300046794 Bacteria 2377
273 Ga0495589_0040539 3300046794 Bacteria 2325
274 Ga0495589_0092908 3300046794 Bacteria 1464
275 Ga0495600_0136528 3300046809 Bacteria 1593
276 Ga0495660_0004334 3300046810 Bacteria 8593
277 Ga0495660_0005056 3300046810 Bacteria 7923
278 Ga0495660_0007590 3300046810 Bacteria 6369
279 Ga0495660_0018329 3300046810 Bacteria 4024
280 Ga0495660_0021101 3300046810 Bacteria 3732
281 Ga0495660_0039661 3300046810 Bacteria 2614
282 Ga0495660_0052164 3300046810 Bacteria 2223
283 Ga0495660_0185861 3300046810 Bacteria 1002
284 Ga0495581_0004017 3300047315 Bacteria 8471
285 Ga0495604_0082331 3300047317 Bacteria 2407
286 Ga0495636_0006601 3300047318 Bacteria 4563
287 Ga0495672_0000118 3300047320 Bacteria 124396
288 Ga0495672_0011282 3300047320 Bacteria 6315
289 Ga0495672_0028863 3300047320 Bacteria 3503
290 Ga0495676_0000014 3300047321 Bacteria 203356
291 Ga0495680_0003382 3300047322 Bacteria 15762
292 Ga0495680_0007141 3300047322 Bacteria 10289
293 Ga0495683_0000594 3300047323 Bacteria 27203
294 Ga0495683_0005820 3300047323 Bacteria 6785
295 Ga0495683_0014608 3300047323 Bacteria 4091
296 Ga0495683_0015627 3300047323 Bacteria 3945
297 Ga0495683_0024644 3300047323 Bacteria 3087
298 Ga0495687_000049 3300047443 Bacteria 205432
299 Ga0495687_003380 3300047443 Bacteria 11638
300 Ga0495687_041218 3300047443 Bacteria 2027
301 Ga0495675_0036528 3300047444 Bacteria 3132
302 Ga0495675_0060597 3300047444 Bacteria 2398
303 Ga0495677_0000267 3300047445 Bacteria 22920
304 Ga0495677_0000473 3300047445 Bacteria 17220
305 Ga0495677_0000597 3300047445 Bacteria 14827
306 Ga0495677_0001269 3300047445 Bacteria 10123
307 Ga0495677_0012580 3300047445 Bacteria 3085
308 Ga0495677_0013141 3300047445 Bacteria 3012
309 Ga0495677_0020561 3300047445 Bacteria 2393
310 Ga0495677_0030516 3300047445 Bacteria 1962
311 Ga0495677_0061024 3300047445 Bacteria 1398
312 Ga0495679_003782 3300047446 Bacteria 7183
313 Ga0495679_006072 3300047446 Bacteria 5270
314 Ga0495679_011549 3300047446 Bacteria 3401
315 Ga0495679_019923 3300047446 Bacteria 2346
316 Ga0495679_030933 3300047446 Bacteria 1732
317 Ga0495679_076353 3300047446 Bacteria 957
318 Ga0495685_015429 3300047447 Bacteria 2605
319 Ga0495681_0000494 3300047470 Bacteria 30235
320 Ga0495681_0003130 3300047470 Bacteria 11602
321 Ga0495681_0004522 3300047470 Bacteria 9480
322 Ga0495681_0012874 3300047470 Bacteria 4890
323 Ga0495681_0019850 3300047470 Bacteria 3657
324 Ga0495681_0039252 3300047470 Bacteria 2314
325 Ga0495686_0000140 3300047472 Bacteria 144956
326 Ga0495686_0027765 3300047472 Bacteria 3692
327 Ga0495593_0000527 3300047673 Bacteria 21657
328 Ga0495593_0129919 3300047673 Bacteria 1279
329 Ga0495602_0016918 3300048088 Bacteria 7318
330 Ga0495614_0000102 3300048089 Bacteria 29128
331 Ga0495626_0001987 3300048091 Bacteria 15093
332 Ga0495626_0004110 3300048091 Bacteria 9046
333 Ga0495626_0005528 3300048091 Bacteria 7358
334 Ga0495626_0017056 3300048091 Bacteria 3673
335 Ga0495626_0023357 3300048091 Bacteria 3046
336 Ga0495626_0029390 3300048091 Bacteria 2660
337 Ga0495626_0055190 3300048091 Bacteria 1822
338 Ga0495626_0056250 3300048091 Bacteria 1801
339 Ga0495626_0067790 3300048091 Bacteria 1610
340 Ga0496102_0000098 3300048905 Bacteria 123789
341 Ga0496102_0311262 3300048905 Bacteria 1484
342 Ga0496103_0083395 3300048906 Bacteria 2012
343 Ga0496105_0139990 3300048908 Unclassified 1992
344 Ga0496106_0149116 3300048909 Unclassified 1844
345 Ga0496107_0067249 3300048910 Bacteria 2600
346 Ga0496108_0088429 3300048911 Bacteria 2632
347 Ga0496110_0002669 3300048913 Bacteria 13468
348 Ga0496110_0006620 3300048913 Bacteria 9205
349 Ga0496111_0014982 3300048914 Bacteria 5312
350 Ga0496111_0118898 3300048914 Bacteria 1951
351 Ga0496112_0122929 3300048915 Bacteria 2566
352 Ga0496122_0112726 3300048925 Bacteria 1780
353 Ga0496124_0083190 3300048927 Bacteria 2626
354 Ga0496124_0132298 3300048927 Bacteria 1980
355 Ga0496124_0429965 3300048927 Bacteria 907
356 Ga0495678_000056 3300049459 Bacteria 149598
357 Ga0495678_002201 3300049459 Bacteria 13668
358 Ga0495678_004476 3300049459 Bacteria 8072
359 Ga0495678_006923 3300049459 Bacteria 5950
360 Ga0495678_011366 3300049459 Bacteria 4266
361 Ga0495682_0001378 3300049460 Bacteria 13289
362 Ga0495682_0003556 3300049460 Bacteria 6890
363 Ga0495682_0017682 3300049460 Bacteria 2687
364 2644217833 2643221639 Bacteria 6649903
365 2644258432 2643221646 Bacteria 6433402
366 2739055033 2738541337 Bacteria 6183410
367 2809144361 2808606418 Bacteria 6724496
368 Ga0495616_0000193
369 rootH1_10079852
370 rootL2_10005034
371 rootH1_10011039
372 rootH1_10011041
373 Ga0055531_10000064
374 Ga0065165_1001239
375 Ga0068856_100129579
376 Ga0068863_100017903
377 Ga0213872_10000058
378 Ga0213872_10000150
379 Ga0213872_10003619
380 Ga0213872_10106640
381 Ga0209050_1002657
382 Ga0209051_1006872
383 Ga0209257_1000094
384 Ga0209257_1018582
385 Ga0207685_10082614
386 Ga0207702_10080273
387 Ga0307515_10036843
388 Ga0316177_1042130
389 Ga0316180_1003511
390 Ga0265331_10003453
391 Ga0265327_10000012
392 Ga0395905_0000719
393 Ga0395905_0041799
394 Ga0436361_0018388
395 Ga0436361_0068556
396 Ga0436361_0700482
397 Ga0436361_0850324
398 Ga0436363_0785503
399 Ga0450904_001513
400 Ga0466957_0000994
401 Ga0495617_000002
402 Ga0495617_006501
403 Ga0495627_000339
404 Ga0495627_009600
405 Ga0495627_036739
406 Ga0495603_0010744
407 Ga0495590_0000007
408 Ga0495590_0002842
409 Ga0495590_0004702
410 Ga0495590_0049214
411 Ga0495591_000039
412 Ga0495653_0011532
413 Ga0495653_0014264
414 Ga0495653_0023115
415 Ga0495650_0010045
416 Ga0495650_0017064
417 Ga0495580_0011731
418 Ga0495582_0011683
419 Ga0495605_0000108
420 Ga0495605_0005103
421 Ga0495605_0007197
422 Ga0495605_0008500
423 Ga0495605_0009080
424 Ga0495605_0010316
425 Ga0495605_0011252
426 Ga0495605_0013904
427 Ga0495605_0196322
428 Ga0495584_0000712
429 Ga0495584_0002110
430 Ga0495584_0003500
431 Ga0495584_0005350
432 Ga0495584_0005403
433 Ga0495584_0006348
434 Ga0495584_0013577
435 Ga0495584_0018737
436 Ga0495584_0020123
437 Ga0495585_0001726
438 Ga0495585_0002480
439 Ga0495585_0010549
440 Ga0495585_0011985
441 Ga0495585_0012408
442 Ga0495585_0041301
443 Ga0495585_0127467
444 Ga0495585_0134874
445 Ga0495585_0144337
446 Ga0495585_0152714
447 Ga0495594_0009109
448 Ga0495594_0028756
449 Ga0495594_0096666
450 Ga0495596_0002487
451 Ga0495596_0003084
452 Ga0495596_0007518
453 Ga0495596_0010547
454 Ga0495596_0011447
455 Ga0495596_0014049
456 Ga0495596_0016256
457 Ga0495596_0065976
458 Ga0495596_0133968
459 Ga0495607_0001375
460 Ga0495607_0002023
461 Ga0495607_0002838
462 Ga0495607_0002914
463 Ga0495607_0027946
464 Ga0495607_0208870
465 Ga0495583_0000503
466 Ga0495583_0001311
467 Ga0495583_0001962
468 Ga0495583_0005566
469 Ga0495583_0008040
470 Ga0495583_0008628
471 Ga0495583_0024658
472 Ga0495583_0028354
473 Ga0495606_0027117
474 Ga0495606_0048262
475 Ga0495606_0060744
476 Ga0495606_0093382
477 Ga0495606_0234235
478 Ga0495610_0002370
479 Ga0495610_0063096
480 Ga0495616_0004553
481 Ga0495616_0006451
482 Ga0495616_0007749
483 Ga0495616_0011802
484 Ga0495616_0025202
485 Ga0495616_0034551
486 Ga0495616_0102871
487 Ga0495630_0172013
488 Ga0495631_0003682
489 Ga0495631_0004617
490 Ga0495631_0008028
491 Ga0495631_0008828
492 Ga0495631_0013206
493 Ga0495631_0031256
494 Ga0495631_0040039
495 Ga0495631_0043773
496 Ga0495631_0098687
497 Ga0495631_0120155
498 Ga0495631_0145959
499 Ga0495632_0000374
500 Ga0495632_0000837
501 Ga0495632_0000878
502 Ga0495632_0003384
503 Ga0495632_0006824
504 Ga0495632_0015440
505 Ga0495632_0029070
506 Ga0495632_0157543
507 Ga0495637_0000006
508 Ga0495637_0053847
509 Ga0495643_0002368
510 Ga0495643_0004152
511 Ga0495643_0005916
512 Ga0495643_0013968
513 Ga0495644_0003184
514 Ga0495644_0005351
515 Ga0495644_0007813
516 Ga0495644_0015325
517 Ga0495644_0019876
518 Ga0495644_0038451
519 Ga0495644_0044857
520 Ga0495644_0062740
521 Ga0495648_0000220
522 Ga0495648_0016893
523 Ga0495648_0017194
524 Ga0495648_0046068
525 Ga0495648_0161269
526 Ga0495648_0175706
527 Ga0495666_0035579
528 Ga0495666_0056388
529 Ga0495642_0000345
530 Ga0495642_0000855
531 Ga0495642_0003402
532 Ga0495642_0007904
533 Ga0495642_0010611
534 Ga0495642_0014317
535 Ga0495642_0020299
536 Ga0495642_0023975
537 Ga0495642_0045930
538 Ga0495642_0095522
539 Ga0495642_0121377
540 Ga0495652_0006263
541 Ga0495654_0030213
542 Ga0495654_0032844
543 Ga0495654_0077261
544 Ga0495654_0116874
545 Ga0495665_0012589
546 Ga0495665_0034590
547 Ga0495640_0006222
548 Ga0495586_0072136
549 Ga0495587_0010988
550 Ga0495609_0002572
551 Ga0495609_0011021
552 Ga0495609_0011147
553 Ga0495609_0011910
554 Ga0495609_0020131
555 Ga0495609_0079188
556 Ga0495597_0000332
557 Ga0495597_0000728
558 Ga0495597_0004004
559 Ga0495597_0006246
560 Ga0495597_0006868
561 Ga0495597_0019288
562 Ga0495597_0022095
563 Ga0495597_0032856
564 Ga0495597_0124678
565 Ga0495622_0007141
566 Ga0495633_0004093
567 Ga0495633_0010088
568 Ga0495633_0012004
569 Ga0495633_0022566
570 Ga0495633_0116986
571 Ga0495656_0013663
572 Ga0495656_0036060
573 Ga0495668_0004912
574 Ga0495668_0007659
575 Ga0495668_0018601
576 Ga0495668_0022412
577 Ga0495668_0052021
578 Ga0495668_0058727
579 Ga0495668_0079171
580 Ga0495634_0008121
581 Ga0495611_0000792
582 Ga0495611_0005177
583 Ga0495611_0007932
584 Ga0495611_0085048
585 Ga0495611_0173198
586 Ga0495625_0046240
587 Ga0495625_0102159
588 Ga0495625_0251394
589 Ga0495635_0000550
590 Ga0495661_0001851
591 Ga0495661_0005503
592 Ga0495661_0006457
593 Ga0495661_0007032
594 Ga0495661_0020575
595 Ga0495661_0027218
596 Ga0495661_0039122
597 Ga0495661_0071227
598 Ga0495661_0140081
599 Ga0495661_0169989
600 Ga0495661_0213401
601 Ga0495588_0003189
602 Ga0495588_0006653
603 Ga0495588_0020202
604 Ga0495588_0044841
605 Ga0495588_0057501
606 Ga0495588_0089773
607 Ga0495588_0104407
608 Ga0495623_0010770
609 Ga0495623_0011213
610 Ga0495669_0000305
611 Ga0495669_0000799
612 Ga0495669_0002363
613 Ga0495669_0007473
614 Ga0495669_0018474
615 Ga0495669_0060188
616 Ga0495669_0071297
617 Ga0495613_0026565
618 Ga0495613_0072579
619 Ga0495670_0000228
620 Ga0495670_0004763
621 Ga0495670_0006478
622 Ga0495670_0008864
623 Ga0495670_0026331
624 Ga0495670_0029075
625 Ga0495671_0004166
626 Ga0495671_0006131
627 Ga0495671_0015767
628 Ga0495649_0000511
629 Ga0495649_0002688
630 Ga0495649_0033054
631 Ga0495649_0072916
632 Ga0495649_0097724
633 Ga0495589_0000569
634 Ga0495589_0000651
635 Ga0495589_0013689
636 Ga0495589_0018910
637 Ga0495589_0028227
638 Ga0495589_0038954
639 Ga0495589_0040539
640 Ga0495589_0092908
641 Ga0495600_0136528
642 Ga0495660_0004334
643 Ga0495660_0005056
644 Ga0495660_0007590
645 Ga0495660_0018329
646 Ga0495660_0021101
647 Ga0495660_0039661
648 Ga0495660_0052164
649 Ga0495660_0185861
650 Ga0495581_0004017
651 Ga0495604_0082331
652 Ga0495636_0006601
653 Ga0495672_0000118
654 Ga0495672_0011282
655 Ga0495672_0028863
656 Ga0495676_0000014
657 Ga0495680_0003382
658 Ga0495680_0007141
659 Ga0495683_0000594
660 Ga0495683_0005820
661 Ga0495683_0014608
662 Ga0495683_0015627
663 Ga0495683_0024644
664 Ga0495687_000049
665 Ga0495687_003380
666 Ga0495687_041218
667 Ga0495675_0036528
668 Ga0495675_0060597
669 Ga0495677_0000267
670 Ga0495677_0000473
671 Ga0495677_0000597
672 Ga0495677_0001269
673 Ga0495677_0012580
674 Ga0495677_0013141
675 Ga0495677_0020561
676 Ga0495677_0030516
677 Ga0495677_0061024
678 Ga0495679_003782
679 Ga0495679_006072
680 Ga0495679_011549
681 Ga0495679_019923
682 Ga0495679_030933
683 Ga0495679_076353
684 Ga0495685_015429
685 Ga0495681_0000494
686 Ga0495681_0003130
687 Ga0495681_0004522
688 Ga0495681_0012874
689 Ga0495681_0019850
690 Ga0495681_0039252
691 Ga0495686_0000140
692 Ga0495686_0027765
693 Ga0495593_0000527
694 Ga0495593_0129919
695 Ga0495602_0016918
696 Ga0495614_0000102
697 Ga0495626_0001987
698 Ga0495626_0004110
699 Ga0495626_0005528
700 Ga0495626_0017056
701 Ga0495626_0023357
702 Ga0495626_0029390
703 Ga0495626_0055190
704 Ga0495626_0056250
705 Ga0495626_0067790
706 Ga0496102_0000098
707 Ga0496102_0311262
708 Ga0496103_0083395
709 Ga0496105_0139990
710 Ga0496106_0149116
711 Ga0496107_0067249
712 Ga0496108_0088429
713 Ga0496110_0002669
714 Ga0496110_0006620
715 Ga0496111_0014982
716 Ga0496111_0118898
717 Ga0496112_0122929
718 Ga0496122_0112726
719 Ga0496124_0083190
720 Ga0496124_0132298
721 Ga0496124_0429965
722 Ga0495678_000056
723 Ga0495678_002201
724 Ga0495678_004476
725 Ga0495678_006923
726 Ga0495678_011366
727 Ga0495682_0001378
728 Ga0495682_0003556
729 Ga0495682_0017682
730 2644217833
731 2644258432
732 2739055033
733 2809144361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00345

PapD_N

Pili and flagellar-assembly chaperone, PapD N-terminal domain

53

195

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f65-assembly4.cif.gz_D the f4 fimbrial chaperone faee does not self-cap its interactive surfaces 0.7315 25 165
3f65-assembly8.cif.gz_H the f4 fimbrial chaperone faee does not self-cap its interactive surfaces 0.7297 25 165
3f65-assembly6.cif.gz_F the f4 fimbrial chaperone faee does not self-cap its interactive surfaces 0.7284 25 165
3o0l-assembly1.cif.gz_B crystal structure of a pfam duf1425 family member (shew_1734) from shewanella sp. pv-4 at 1.81 a resolution 0.6984 173 261
3f6i-assembly2.cif.gz_B structure of the semet labeled f4 fibrial chaperone faee 0.6966 25 165
ID Description Score Start End Superfamily
af_A0A0R4IEX1_1690_1790_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8248 30 167 2.60.40.10
af_Q18438_11_137_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8183 26 168 2.60.40.10
af_Q4G0P3_2817_2929_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8113 39 166 2.60.40.10
af_Q9U2I5_26_123_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8088 25 128 2.60.40.10
3q48B01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8036 26 165 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A4Q3KHX4-F1-model_v4 deleted 0.9277 26 278
AF-A0A4Q3KHX4-F1-model_v4 deleted 0.9205 26 278
AF-A0A538UB00-F1-model_v4 Uncharacterized protein 0.9104 164 278
AF-A0A2Z3MUU2-F1-model_v4 deleted 0.9083 160 277
AF-A0A165LPI4-F1-model_v4 Pili assembly chaperone N-terminal domain-containing protein 0.9055 24 277

Map