F423874

General Info

Members Datasets Scaffolds Average Seq Length
365 238 329 241

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2995463766|2995466820
Length 228
Sequence TLITGGSTGIGAETARLLLKQGHRVTVTARRADRLAEFAESTGADGDHLLTVPGDTSDPEHVRQAVDLTVAAWGRLDNVVVNAGFSLPGTLADHAPEDMRAMVLTNVLGPALVVQAVLPRLKESKGRLVLLGSVAGVRNTPGNLYSVTKWAVHALAENTRQMAAPDGIGVTLIAPSVVDTPFWEVRGLNPDAPSMTAAQVADCIVFALNQPEGMAVNHLQLRPVGQVN

Samples

Sample ID Description Type Environment
1 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
2 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
3 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2643221582 Rhizobium sp. Root651 Isolate Unclassified
6 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
7 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
8 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
9 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
10 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
11 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
12 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
13 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
14 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
15 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
16 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
17 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
18 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
19 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
20 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
21 2855730933 Achromobacter sp. HZ28 Isolate Nodule
22 2855767633 Achromobacter sp. HZ34 Isolate Nodule
23 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
24 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
25 2857553236 Duganella sp. R-74557 Isolate Unclassified
26 2857558681 Duganella sp. R-74565 Isolate Unclassified
27 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
28 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
29 2919085039 Luteibacter sp. 1214 Isolate Unclassified
30 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
31 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
32 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
33 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
34 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
35 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
36 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
37 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
43 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
44 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
45 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
46 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
49 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
109 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
110 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
190 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
191 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
211 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
231 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
232 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
236 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
237 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
238 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.32
Metatranscriptomes 0.82
Isolates 9.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.51
Nodule 4.66
Rhizoplane 1.37
Rhizosphere 71.23
Stem 0
Stem Tuber 0
Unclassified 11.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001149 3300001979 Bacteria 11952
2 JGI25152J39213_1003130 3300002773 Bacteria 5780
3 JGI25153J46596_10002161 3300003215 Bacteria 11500
4 rootH1_10008310 3300003316 Bacteria 8717
5 rootH2_10005924 3300003320 Bacteria 8921
6 rootL2_10047815 3300003322 Bacteria 1706
7 rootH1_10043934 3300003323 Bacteria 1584
8 JGI25160J50197_1001646 3300003354 Bacteria 10948
9 JGI25160J50197_1018822 3300003354 Bacteria 2139
10 Ga0055532_1000523 3300003758 Bacteria 16791
11 Ga0055526_1001683 3300003771 Bacteria 15479
12 Ga0055524_1001477 3300003775 Bacteria 13410
13 Ga0055528_1002998 3300003790 Bacteria 8733
14 Ga0055540_1009129 3300003792 Bacteria 3471
15 Ga0058692_1000208 3300003856 Bacteria 35014
16 Ga0070658_10529623 3300005327 Bacteria 1019
17 Ga0070683_100093415 3300005329 Bacteria 2826
18 Ga0070659_100060383 3300005366 Bacteria 2994
19 Ga0070714_100036435 3300005435 Bacteria 4126
20 Ga0070681_10112320 3300005458 Bacteria 2664
21 Ga0070707_100678205 3300005468 Bacteria 993
22 Ga0070679_100030899 3300005530 Bacteria 5291
23 Ga0068853_100453602 3300005539 Bacteria 1206
24 Ga0068855_100016306 3300005563 Bacteria 8936
25 Ga0068852_100123869 3300005616 Bacteria 2371
26 Ga0081540_1010523 3300005983 Bacteria 6252
27 Ga0081540_1023286 3300005983 Bacteria 3626
28 Ga0070717_10224653 3300006028 Bacteria 1651
29 Ga0075368_10000330 3300006042 Bacteria 13869
30 Ga0075363_100123985 3300006048 Bacteria 1445
31 Ga0075367_10004746 3300006178 Bacteria 6685
32 Ga0075367_10013668 3300006178 Bacteria 4372
33 Ga0075370_10046871 3300006353 Bacteria 2447
34 Ga0105251_10027603 3300009011 Bacteria 2876
35 Ga0105244_10001177 3300009036 Bacteria 21645
36 Ga0105239_10081533 3300010375 Bacteria 3561
37 Ga0157370_10000580 3300013104 Bacteria 45646
38 Ga0157370_10065452 3300013104 Bacteria 3439
39 Ga0157378_10190879 3300013297 Bacteria 1932
40 Ga0182005_1000027 3300015265 Bacteria 223652
41 Ga0206353_10552985 3300020082 Bacteria 1052
42 Ga0224712_10090604 3300022467 Bacteria 1280
43 Ga0224712_10128875 3300022467 Bacteria 1103
44 Ga0209147_100304 3300025229 Bacteria 39912
45 Ga0209129_1001259 3300025258 Bacteria 14526
46 Ga0209673_1001339 3300025273 Bacteria 24643
47 Ga0209564_1000952 3300025295 Bacteria 37023
48 Ga0209564_1001807 3300025295 Bacteria 19738
49 Ga0209758_1002736 3300025297 Bacteria 17345
50 Ga0209256_1003228 3300025299 Bacteria 11763
51 Ga0207426_1001359 3300025302 Bacteria 20741
52 Ga0209051_1004480 3300025303 Bacteria 8587
53 Ga0209257_1008339 3300025304 Bacteria 5925
54 Ga0207655_1001865 3300025728 Bacteria 18163
55 Ga0207713_1015840 3300025735 Bacteria 3852
56 Ga0207647_10030160 3300025904 Bacteria 3502
57 Ga0207705_10180769 3300025909 Bacteria 1592
58 Ga0207707_10147056 3300025912 Bacteria 2060
59 Ga0207657_10004527 3300025919 Bacteria 14685
60 Ga0207649_10041760 3300025920 Bacteria 2793
61 Ga0207652_10019581 3300025921 Bacteria 5568
62 Ga0207646_10671053 3300025922 Bacteria 928
63 Ga0207664_10000800 3300025929 Bacteria 21281
64 Ga0207690_10030294 3300025932 Bacteria 3449
65 Ga0207667_10186665 3300025949 Bacteria 2128
66 Ga0207698_10232737 3300026142 Bacteria 1674
67 Ga0209371_1000134 3300027312 Bacteria 121747
68 Ga0209813_10000168 3300027866 Bacteria 21290
69 Ga0268266_10075735 3300028379 Bacteria 2923
70 Ga0307517_10031634 3300028786 Bacteria 6149
71 Ga0268256_1000790 3300030500 Bacteria 22804
72 Ga0307511_10136414 3300030521 Bacteria 1459
73 Ga0307509_10201305 3300031507 Bacteria 1828
74 Ga0307508_10090174 3300031616 Bacteria 2652
75 Ga0307508_10118111 3300031616 Bacteria 2253
76 Ga0307516_10096652 3300031730 Bacteria 2774
77 Ga0307412_10000002 3300031911 Bacteria 743446
78 Ga0395905_0797924 3300037471 Bacteria 847
79 Ga0395901_0440348 3300038443 Bacteria 1334
80 Ga0451833_0574990 3300041491 Bacteria 32011
81 Ga0451845_0186737 3300041501 Bacteria 1633
82 Ga0451851_0002342 3300041507 Bacteria 4671
83 Ga0451853_3293725 3300041512 Bacteria 3136
84 Ga0450901_001288 3300042533 Bacteria 2887
85 Ga0466969_0005204 3300044656 Bacteria 6920
86 Ga0466969_0012176 3300044656 Bacteria 4545
87 Ga0466969_0062134 3300044656 Bacteria 1813
88 Ga0466969_0080212 3300044656 Bacteria 1559
89 Ga0466966_0000312 3300044684 Bacteria 31314
90 Ga0466966_0278102 3300044684 Bacteria 1007
91 Ga0466961_0047955 3300044693 Bacteria 2730
92 Ga0466961_0234697 3300044693 Bacteria 1128
93 Ga0466970_0001911 3300044765 Bacteria 10073
94 Ga0466970_0128733 3300044765 Bacteria 1390
95 Ga0466970_0243497 3300044765 Bacteria 1007
96 Ga0466959_0086541 3300045049 Bacteria 2254
97 Ga0466959_0403443 3300045049 Bacteria 929
98 Ga0466958_0412795 3300045836 Bacteria 872
99 Ga0495617_022093 3300046452 Bacteria 2150
100 Ga0495627_000007 3300046453 Bacteria 575915
101 Ga0495627_000087 3300046453 Bacteria 110870
102 Ga0495627_004183 3300046453 Bacteria 6117
103 Ga0495592_0009010 3300046454 Bacteria 7497
104 Ga0495592_0039343 3300046454 Bacteria 3553
105 Ga0495592_0315054 3300046454 Bacteria 1013
106 Ga0495603_0006184 3300046455 Bacteria 7158
107 Ga0495603_0071136 3300046455 Bacteria 2045
108 Ga0495629_0046787 3300046459 Bacteria 3034
109 Ga0495638_0052610 3300046460 Bacteria 2536
110 Ga0495638_0266591 3300046460 Bacteria 937
111 Ga0495641_0177647 3300046461 Bacteria 953
112 Ga0495651_0006970 3300046462 Bacteria 8643
113 Ga0495653_0091808 3300046463 Bacteria 2218
114 Ga0495653_0104525 3300046463 Bacteria 2046
115 Ga0495650_0000001 3300046471 Bacteria 1085492
116 Ga0495650_0000108 3300046471 Bacteria 200369
117 Ga0495650_0002761 3300046471 Bacteria 13545
118 Ga0495650_0022417 3300046471 Bacteria 3029
119 Ga0495650_0044238 3300046471 Bacteria 1884
120 Ga0495582_0038506 3300046473 Bacteria 2631
121 Ga0495605_0000008 3300046474 Bacteria 334602
122 Ga0495662_0030405 3300046476 Bacteria 2607
123 Ga0495664_0005085 3300046477 Bacteria 7212
124 Ga0495664_0037373 3300046477 Bacteria 2865
125 Ga0495584_0005926 3300046491 Bacteria 6439
126 Ga0495594_0000625 3300046499 Bacteria 18226
127 Ga0495594_0022426 3300046499 Bacteria 3378
128 Ga0495596_0000760 3300046500 Bacteria 19668
129 Ga0495596_0018663 3300046500 Bacteria 2856
130 Ga0495607_0003034 3300046501 Bacteria 13096
131 Ga0495607_0028018 3300046501 Bacteria 3479
132 Ga0495607_0055104 3300046501 Bacteria 2288
133 Ga0495607_0099311 3300046501 Bacteria 1561
134 Ga0495607_0217362 3300046501 Bacteria 937
135 Ga0495583_0000039 3300046506 Bacteria 241501
136 Ga0495583_0013518 3300046506 Bacteria 4549
137 Ga0495606_0001469 3300046507 Bacteria 31493
138 Ga0495606_0003757 3300046507 Bacteria 15802
139 Ga0495606_0069995 3300046507 Bacteria 2214
140 Ga0495608_0006621 3300046511 Bacteria 8223
141 Ga0495610_0006137 3300046512 Bacteria 8371
142 Ga0495610_0007981 3300046512 Bacteria 6942
143 Ga0495610_0015587 3300046512 Bacteria 4408
144 Ga0495616_0000129 3300046513 Bacteria 66170
145 Ga0495616_0003218 3300046513 Bacteria 10525
146 Ga0495616_0063415 3300046513 Bacteria 1806
147 Ga0495616_0081790 3300046513 Bacteria 1544
148 Ga0495620_0000068 3300046515 Bacteria 86731
149 Ga0495628_0099470 3300046516 Bacteria 2246
150 Ga0495628_0108059 3300046516 Bacteria 2141
151 Ga0495630_0064504 3300046517 Bacteria 2752
152 Ga0495630_0085757 3300046517 Bacteria 2377
153 Ga0495631_0000230 3300046518 Bacteria 38328
154 Ga0495631_0002669 3300046518 Bacteria 9929
155 Ga0495631_0003716 3300046518 Bacteria 8322
156 Ga0495631_0047369 3300046518 Bacteria 1888
157 Ga0495632_0000011 3300046519 Bacteria 266804
158 Ga0495632_0003135 3300046519 Bacteria 11955
159 Ga0495632_0003149 3300046519 Bacteria 11926
160 Ga0495637_0006521 3300046520 Bacteria 5848
161 Ga0495637_0066533 3300046520 Bacteria 1464
162 Ga0495643_0004150 3300046522 Bacteria 10288
163 Ga0495643_0028089 3300046522 Bacteria 3157
164 Ga0495644_0020538 3300046523 Bacteria 2520
165 Ga0495644_0057431 3300046523 Bacteria 1463
166 Ga0495648_0000775 3300046524 Bacteria 34064
167 Ga0495648_0001043 3300046524 Bacteria 28117
168 Ga0495648_0014349 3300046524 Bacteria 5805
169 Ga0495648_0021220 3300046524 Bacteria 4505
170 Ga0495666_0004642 3300046526 Bacteria 6950
171 Ga0495666_0053009 3300046526 Bacteria 1947
172 Ga0495652_0014357 3300046529 Bacteria 7110
173 Ga0495652_0042046 3300046529 Bacteria 3941
174 Ga0495652_0092660 3300046529 Bacteria 2468
175 Ga0495652_0280674 3300046529 Bacteria 1220
176 Ga0495654_0001278 3300046530 Bacteria 17657
177 Ga0495654_0001662 3300046530 Bacteria 15055
178 Ga0495654_0052170 3300046530 Bacteria 1993
179 Ga0495665_0003393 3300046531 Bacteria 8646
180 Ga0495640_0056716 3300046533 Bacteria 2675
181 Ga0495586_0049140 3300046535 Bacteria 2280
182 Ga0495587_0023361 3300046536 Bacteria 3799
183 Ga0495587_0344920 3300046536 Bacteria 830
184 Ga0495609_0000031 3300046538 Bacteria 213813
185 Ga0495609_0001197 3300046538 Bacteria 17857
186 Ga0495609_0004201 3300046538 Bacteria 7976
187 Ga0495597_0069385 3300046542 Bacteria 1521
188 Ga0495645_0073705 3300046543 Bacteria 2459
189 Ga0495645_0185804 3300046543 Bacteria 1420
190 Ga0495633_0000011 3300046558 Bacteria 268237
191 Ga0495667_0041149 3300046559 Bacteria 3065
192 Ga0495634_0015288 3300046642 Bacteria 5517
193 Ga0495634_0034421 3300046642 Bacteria 3476
194 Ga0495634_0040922 3300046642 Bacteria 3149
195 Ga0495611_0005403 3300046648 Bacteria 5467
196 Ga0495635_0144716 3300046663 Bacteria 1618
197 Ga0495661_0000493 3300046665 Bacteria 41154
198 Ga0495661_0002864 3300046665 Bacteria 13046
199 Ga0495657_0022782 3300046675 Bacteria 4482
200 Ga0495599_0005097 3300046678 Bacteria 7823
201 Ga0495623_0002668 3300046679 Bacteria 11779
202 Ga0495623_0020487 3300046679 Bacteria 4274
203 Ga0495623_0087543 3300046679 Bacteria 1918
204 Ga0495646_0003648 3300046680 Bacteria 9604
205 Ga0495646_0020521 3300046680 Bacteria 4180
206 Ga0495613_0152279 3300046689 Bacteria 1649
207 Ga0495624_0054959 3300046690 Bacteria 2509
208 Ga0495670_0007409 3300046691 Bacteria 5389
209 Ga0495670_0023318 3300046691 Bacteria 3055
210 Ga0495670_0058124 3300046691 Bacteria 1942
211 Ga0495671_0010382 3300046692 Bacteria 5161
212 Ga0495649_0008837 3300046694 Bacteria 6035
213 Ga0495649_0017816 3300046694 Bacteria 4004
214 Ga0495649_0127634 3300046694 Bacteria 1343
215 Ga0495649_0131676 3300046694 Bacteria 1319
216 Ga0495589_0001653 3300046794 Bacteria 12766
217 Ga0495589_0043559 3300046794 Bacteria 2233
218 Ga0495589_0045338 3300046794 Bacteria 2184
219 Ga0495589_0182311 3300046794 Bacteria 995
220 Ga0495600_0011672 3300046809 Bacteria 5479
221 Ga0495600_0017412 3300046809 Bacteria 4571
222 Ga0495600_0026427 3300046809 Bacteria 3746
223 Ga0495600_0126222 3300046809 Bacteria 1664
224 Ga0495660_0000172 3300046810 Bacteria 69913
225 Ga0495660_0002144 3300046810 Bacteria 12721
226 Ga0495660_0024399 3300046810 Bacteria 3445
227 Ga0495660_0038220 3300046810 Bacteria 2669
228 Ga0495660_0201062 3300046810 Bacteria 951
229 Ga0495581_0014230 3300047315 Bacteria 4613
230 Ga0495604_0008046 3300047317 Bacteria 8354
231 Ga0495604_0013272 3300047317 Bacteria 6560
232 Ga0495604_0098460 3300047317 Bacteria 2154
233 Ga0495604_0103299 3300047317 Bacteria 2091
234 Ga0495636_0182726 3300047318 Bacteria 952
235 Ga0495636_0224759 3300047318 Bacteria 862
236 Ga0495674_0017062 3300047319 Bacteria 6764
237 Ga0495674_0138519 3300047319 Bacteria 2046
238 Ga0495672_0000032 3300047320 Bacteria 295356
239 Ga0495672_0000386 3300047320 Bacteria 54325
240 Ga0495672_0006603 3300047320 Bacteria 8930
241 Ga0495676_0011081 3300047321 Bacteria 8147
242 Ga0495676_0080844 3300047321 Bacteria 2465
243 Ga0495680_0107494 3300047322 Bacteria 2072
244 Ga0495683_0000114 3300047323 Bacteria 82525
245 Ga0495683_0000345 3300047323 Bacteria 38519
246 Ga0495683_0002309 3300047323 Bacteria 11616
247 Ga0495683_0006276 3300047323 Bacteria 6505
248 Ga0495683_0060889 3300047323 Bacteria 1870
249 Ga0495683_0067179 3300047323 Bacteria 1765
250 Ga0495683_0088270 3300047323 Bacteria 1505
251 Ga0495687_001745 3300047443 Bacteria 19238
252 Ga0495675_0002938 3300047444 Bacteria 10239
253 Ga0495675_0005151 3300047444 Bacteria 7955
254 Ga0495675_0200540 3300047444 Bacteria 1215
255 Ga0495679_000043 3300047446 Bacteria 142160
256 Ga0495685_002560 3300047447 Bacteria 5712
257 Ga0495685_011155 3300047447 Bacteria 3027
258 Ga0495681_0008135 3300047470 Bacteria 6604
259 Ga0495681_0017708 3300047470 Bacteria 3946
260 Ga0495681_0051168 3300047470 Bacteria 1944
261 Ga0495684_0080196 3300047471 Bacteria 2478
262 Ga0495686_0001425 3300047472 Bacteria 26145
263 Ga0495686_0041616 3300047472 Bacteria 2925
264 Ga0495593_0106417 3300047673 Bacteria 1434
265 Ga0495602_0190583 3300048088 Bacteria 1572
266 Ga0495602_0273702 3300048088 Bacteria 1247
267 Ga0495614_0024749 3300048089 Bacteria 2591
268 Ga0495626_0000017 3300048091 Bacteria 231648
269 Ga0495626_0018073 3300048091 Bacteria 3548
270 Ga0495626_0217701 3300048091 Bacteria 777
271 Ga0496102_0002275 3300048905 Bacteria 16433
272 Ga0496106_0109894 3300048909 Bacteria 2146
273 Ga0496108_0160503 3300048911 Bacteria 1942
274 Ga0496109_0046512 3300048912 Bacteria 3941
275 Ga0496113_0138058 3300048916 Bacteria 1917
276 Ga0496116_0013844 3300048919 Bacteria 6476
277 Ga0496116_0069308 3300048919 Bacteria 2243
278 Ga0496116_0071823 3300048919 Bacteria 2190
279 Ga0496117_0004819 3300048920 Bacteria 14599
280 Ga0496118_0000120 3300048921 Bacteria 142952
281 Ga0496122_0025240 3300048925 Bacteria 5169
282 Ga0496122_0038242 3300048925 Bacteria 3848
283 Ga0496122_0100540 3300048925 Bacteria 1934
284 Ga0496123_0021889 3300048926 Bacteria 4951
285 Ga0496123_0087039 3300048926 Bacteria 1871
286 Ga0496124_0001523 3300048927 Bacteria 33735
287 Ga0496124_0001563 3300048927 Bacteria 33097
288 Ga0496124_0022664 3300048927 Bacteria 5751
289 Ga0496124_0266877 3300048927 Bacteria 1256
290 Ga0496125_0004285 3300048928 Bacteria 16584
291 Ga0496125_0057727 3300048928 Bacteria 3140
292 Ga0495678_000004 3300049459 Bacteria 532920
293 Ga0495678_000018 3300049459 Bacteria 279747
294 Ga0495678_000203 3300049459 Bacteria 69724
295 Ga0495682_0000716 3300049460 Bacteria 21678
296 Ga0501031_0190544 3300049568 Bacteria 1339
297 Ga0501032_0070238 3300049569 Bacteria 2336
298 Ga0501033_0009691 3300049570 Bacteria 7407
299 Ga0501034_0358417 3300049571 Bacteria 1386
300 Ga0501036_0397510 3300049572 Bacteria 1150
301 Ga0501047_0229411 3300049581 Bacteria 1711
302 Ga0501070_0019049 3300049586 Bacteria 5757
303 Ga0501073_0105858 3300049589 Bacteria 1952
304 Ga0501073_0384153 3300049589 Bacteria 970
305 Ga0501249_040006 3300049679 Bacteria 1061
306 Ga0501080_0074128 3300049742 Bacteria 3167
307 Ga0501269_000251 3300049766 Bacteria 15506
308 Ga0501035_0000362 3300049822 Bacteria 52504
309 Ga0501044_0007582 3300049823 Bacteria 11928
310 nmdc:mga06z11_70_c1 3300050494 Bacteria 42581
311 nmdc:mga06z11_9910_c1 3300050494 Bacteria 4036
312 nmdc:mga04h51_278_c1 3300050495 Bacteria 13132
313 nmdc:mga04h51_36265_c1 3300050495 Bacteria 1586
314 nmdc:mga07m45_100371_c1 3300050496 Bacteria 1662
315 Ga0495601_0023479 3300053077 Bacteria 3790
316 Ga0495601_0109977 3300053077 Bacteria 1784
317 Ga0495612_0003224 3300053078 Bacteria 6763
318 Ga0500618_000705 3300053125 Bacteria 19616
319 Ga0500618_002239 3300053125 Bacteria 7536
320 Ga0500618_003121 3300053125 Bacteria 5837
321 Ga0500618_009629 3300053125 Bacteria 2629
322 Ga0500628_014463 3300053129 Bacteria 1491
323 Ga0500652_005685 3300053131 Bacteria 3951
324 Ga0500658_0006337 3300053134 Bacteria 4390
325 Ga0500559_0000663 3300053136 Bacteria 23050
326 Ga0500559_0001253 3300053136 Bacteria 14917
327 Ga0500561_0000948 3300053137 Bacteria 4636
328 Ga0500600_0005945 3300053149 Bacteria 7240
329 Ga0500634_0109577 3300053161 Bacteria 1365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0266591 Ga0495638_0266591_312_926 203
2 3300046543 Ga0495645_0073705 Ga0495645_0073705_43_666 204
3 3300005563 Ga0068855_100016306 Ga0068855_1000163064 208
4 3300049568 Ga0501031_0190544 Ga0501031_0190544_285_983 222
5 3300049571 Ga0501034_0358417 Ga0501034_0358417_613_1311 222
6 3300049822 Ga0501035_0000362 Ga0501035_0000362_20450_21148 222
7 3300049823 Ga0501044_0007582 Ga0501044_0007582_5598_6296 222
8 3300046642 Ga0495634_0040922 Ga0495634_0040922_12_695 226
9 iso_pu_bacteria 2582581313 2585310503 227
10 iso_pu_bacteria 2954002825 2954006092 227
11 iso_pu_bacteria 2995463766 2995466820 227
12 3300028786 Ga0307517_10031634 Ga0307517_100316342 229
13 3300031616 Ga0307508_10118111 Ga0307508_101181112 229
14 3300031730 Ga0307516_10096652 Ga0307516_100966523 229
15 3300044656 Ga0466969_0062134 Ga0466969_0062134_569_1276 229
16 3300046460 Ga0495638_0052610 Ga0495638_0052610_1487_2179 229
17 3300046522 Ga0495643_0004150 Ga0495643_0004150_5684_6376 229
18 3300046679 Ga0495623_0020487 Ga0495623_0020487_164_856 229
19 3300046689 Ga0495613_0152279 Ga0495613_0152279_899_1591 229
20 3300046691 Ga0495670_0023318 Ga0495670_0023318_325_1017 229
21 3300046794 Ga0495589_0182311 Ga0495589_0182311_260_952 229
22 3300046810 Ga0495660_0038220 Ga0495660_0038220_1592_2284 229
23 3300047317 Ga0495604_0013272 Ga0495604_0013272_3078_3770 229
24 3300047318 Ga0495636_0224759 Ga0495636_0224759_86_778 229
25 3300047444 Ga0495675_0005151 Ga0495675_0005151_5047_5739 229
26 3300047447 Ga0495685_002560 Ga0495685_002560_345_1037 229
27 3300047470 Ga0495681_0008135 Ga0495681_0008135_5490_6182 229
28 3300049586 Ga0501070_0019049 Ga0501070_0019049_4764_5456 229
29 3300049589 Ga0501073_0384153 Ga0501073_0384153_83_775 229
30 3300049742 Ga0501080_0074128 Ga0501080_0074128_1469_2161 229
31 3300053129 Ga0500628_014463 Ga0500628_014463_462_1154 229
32 3300053131 Ga0500652_005685 Ga0500652_005685_316_1008 229
33 3300053134 Ga0500658_0006337 Ga0500658_0006337_283_975 229
34 3300053137 Ga0500561_0000948 Ga0500561_0000948_1266_1958 229
35 3300053149 Ga0500600_0005945 Ga0500600_0005945_1828_2520 229
36 3300053161 Ga0500634_0109577 Ga0500634_0109577_267_959 229
37 3300031911 Ga0307412_10000002 Ga0307412_100000022 230
38 3300049570 Ga0501033_0009691 Ga0501033_0009691_5048_5743 230
39 3300003316 rootH1_10008310 rootH1_100083104 231
40 3300003320 rootH2_10005924 rootH2_100059247 231
41 3300003322 rootL2_10047815 rootL2_100478151 231
42 3300003323 rootH1_10043934 rootH1_100439342 231
43 3300005327 Ga0070658_10529623 Ga0070658_105296232 231
44 3300005329 Ga0070683_100093415 Ga0070683_1000934152 231
45 3300005435 Ga0070714_100036435 Ga0070714_1000364351 231
46 3300005458 Ga0070681_10112320 Ga0070681_101123202 231
47 3300005468 Ga0070707_100678205 Ga0070707_1006782052 231
48 3300005530 Ga0070679_100030899 Ga0070679_1000308996 231
49 3300006028 Ga0070717_10224653 Ga0070717_102246532 231
50 3300009011 Ga0105251_10027603 Ga0105251_100276035 231
51 3300013104 Ga0157370_10065452 Ga0157370_100654522 231
52 3300022467 Ga0224712_10090604 Ga0224712_100906042 231
53 3300022467 Ga0224712_10128875 Ga0224712_101288752 231
54 3300025735 Ga0207713_1015840 Ga0207713_10158401 231
55 3300025909 Ga0207705_10180769 Ga0207705_101807691 231
56 3300025912 Ga0207707_10147056 Ga0207707_101470562 231
57 3300025921 Ga0207652_10019581 Ga0207652_100195815 231
58 3300025922 Ga0207646_10671053 Ga0207646_106710531 231
59 3300025929 Ga0207664_10000800 Ga0207664_1000080016 231
60 3300028379 Ga0268266_10075735 Ga0268266_100757352 231
61 3300030521 Ga0307511_10136414 Ga0307511_101364142 231
62 3300031507 Ga0307509_10201305 Ga0307509_102013053 231
63 3300031616 Ga0307508_10090174 Ga0307508_100901742 231
64 3300044656 Ga0466969_0005204 Ga0466969_0005204_5194_5892 231
65 3300044656 Ga0466969_0080212 Ga0466969_0080212_277_975 231
66 3300044684 Ga0466966_0000312 Ga0466966_0000312_9332_10030 231
67 3300044693 Ga0466961_0234697 Ga0466961_0234697_183_881 231
68 3300044765 Ga0466970_0128733 Ga0466970_0128733_282_980 231
69 3300044765 Ga0466970_0243497 Ga0466970_0243497_149_847 231
70 3300045049 Ga0466959_0086541 Ga0466959_0086541_241_939 231
71 3300045836 Ga0466958_0412795 Ga0466958_0412795_161_859 231
72 3300046454 Ga0495592_0315054 Ga0495592_0315054_224_922 231
73 3300046455 Ga0495603_0006184 Ga0495603_0006184_739_1437 231
74 3300046462 Ga0495651_0006970 Ga0495651_0006970_1841_2539 231
75 3300046477 Ga0495664_0005085 Ga0495664_0005085_4954_5652 231
76 3300046499 Ga0495594_0022426 Ga0495594_0022426_951_1649 231
77 3300046501 Ga0495607_0217362 Ga0495607_0217362_226_924 231
78 3300046517 Ga0495630_0064504 Ga0495630_0064504_194_892 231
79 3300046523 Ga0495644_0057431 Ga0495644_0057431_35_733 231
80 3300046526 Ga0495666_0004642 Ga0495666_0004642_1539_2237 231
81 3300046529 Ga0495652_0014357 Ga0495652_0014357_1568_2266 231
82 3300046533 Ga0495640_0056716 Ga0495640_0056716_650_1348 231
83 3300046536 Ga0495587_0023361 Ga0495587_0023361_1889_2587 231
84 3300046536 Ga0495587_0344920 Ga0495587_0344920_98_796 231
85 3300046642 Ga0495634_0034421 Ga0495634_0034421_1548_2246 231
86 3300046678 Ga0495599_0005097 Ga0495599_0005097_5558_6256 231
87 3300046679 Ga0495623_0002668 Ga0495623_0002668_6267_6965 231
88 3300046680 Ga0495646_0020521 Ga0495646_0020521_2254_2952 231
89 3300046691 Ga0495670_0058124 Ga0495670_0058124_1069_1767 231
90 3300046694 Ga0495649_0127634 Ga0495649_0127634_280_978 231
91 3300046809 Ga0495600_0017412 Ga0495600_0017412_2901_3599 231
92 3300046809 Ga0495600_0126222 Ga0495600_0126222_139_837 231
93 3300047317 Ga0495604_0008046 Ga0495604_0008046_6105_6803 231
94 3300047318 Ga0495636_0182726 Ga0495636_0182726_173_871 231
95 3300047319 Ga0495674_0017062 Ga0495674_0017062_1835_2533 231
96 3300047321 Ga0495676_0011081 Ga0495676_0011081_3448_4146 231
97 3300047323 Ga0495683_0060889 Ga0495683_0060889_22_720 231
98 3300047443 Ga0495687_001745 Ga0495687_001745_13409_14107 231
99 3300047444 Ga0495675_0200540 Ga0495675_0200540_177_875 231
100 3300047447 Ga0495685_011155 Ga0495685_011155_621_1319 231
101 3300048088 Ga0495602_0273702 Ga0495602_0273702_19_717 231
102 3300048911 Ga0496108_0160503 Ga0496108_0160503_413_1111 231
103 3300048912 Ga0496109_0046512 Ga0496109_0046512_98_796 231
104 3300048916 Ga0496113_0138058 Ga0496113_0138058_445_1143 231
105 3300053077 Ga0495601_0023479 Ga0495601_0023479_339_1037 231
106 3300053077 Ga0495601_0109977 Ga0495601_0109977_237_935 231
107 3300053078 Ga0495612_0003224 Ga0495612_0003224_4878_5576 231
108 3300044656 Ga0466969_0012176 Ga0466969_0012176_1653_2354 232
109 3300044684 Ga0466966_0278102 Ga0466966_0278102_294_995 232
110 3300044693 Ga0466961_0047955 Ga0466961_0047955_1215_1916 232
111 3300044765 Ga0466970_0001911 Ga0466970_0001911_8302_9003 232
112 3300045049 Ga0466959_0403443 Ga0466959_0403443_190_891 232
113 3300046516 Ga0495628_0099470 Ga0495628_0099470_1491_2198 232
114 3300046529 Ga0495652_0092660 Ga0495652_0092660_1576_2283 232
115 3300046809 Ga0495600_0026427 Ga0495600_0026427_2627_3334 232
116 3300047317 Ga0495604_0103299 Ga0495604_0103299_634_1341 232
117 3300020082 Ga0206353_10552985 Ga0206353_105529851 233
118 3300046522 Ga0495643_0028089 Ga0495643_0028089_1200_1940 236
119 iso_pu_bacteria 2511231035 2511432828 242
120 iso_pu_bacteria 2516653085 2517078277 242
121 iso_pu_bacteria 2582581294 2585205853 242
122 iso_pu_bacteria 2643221582 2643917927 242
123 iso_pu_bacteria 2765235942 2766064310 242
124 iso_pu_bacteria 2775506902 2776267332 242
125 iso_pu_bacteria 2775506904 2776281459 242
126 iso_pu_bacteria 2838686498 2838690240 242
127 iso_pu_bacteria 2838729681 2838732015 242
128 iso_pu_bacteria 2838742623 2838744911 242
129 iso_pu_bacteria 2841851746 2841855969 242
130 iso_pu_bacteria 2842110456 2842116898 242
131 iso_pu_bacteria 2842156927 2842161139 242
132 iso_pu_bacteria 2842180545 2842184755 242
133 iso_pu_bacteria 2842229732 2842232337 242
134 iso_pu_bacteria 2842243621 2842246752 242
135 iso_pu_bacteria 2842257432 2842261146 242
136 iso_pu_bacteria 2842271015 2842274260 242
137 iso_pu_bacteria 2844454524 2844457061 242
138 iso_pu_bacteria 2855730933 2855735717 242
139 iso_pu_bacteria 2855767633 2855772655 242
140 iso_pu_bacteria 2857357740 2857365384 242
141 iso_pu_bacteria 2857516855 2857519530 242
142 iso_pu_bacteria 2857553236 2857554519 242
143 iso_pu_bacteria 2857558681 2857558904 242
144 iso_pu_bacteria 2885429604 2885433174 242
145 iso_pu_bacteria 2891088606 2891091344 242
146 iso_pu_bacteria 2919085039 2919086670 242
147 iso_pu_bacteria 2933586486 2933593098 242
148 iso_pu_bacteria 3003930520 3003933885 242
149 iso_pu_bacteria 3005409236 3005413933 242
150 iso_pu_bacteria 3005452660 3005456643 242
151 iso_pu_bacteria 8046767195 8046770185 242
152 3300001979 JGI24740J21852_10001149 JGI24740J21852_100011495 246
153 3300002773 JGI25152J39213_1003130 JGI25152J39213_10031304 246
154 3300003215 JGI25153J46596_10002161 JGI25153J46596_100021617 246
155 3300003354 JGI25160J50197_1001646 JGI25160J50197_10016467 246
156 3300003354 JGI25160J50197_1018822 JGI25160J50197_10188222 246
157 3300003758 Ga0055532_1000523 Ga0055532_100052313 246
158 3300003771 Ga0055526_1001683 Ga0055526_10016838 246
159 3300003775 Ga0055524_1001477 Ga0055524_10014779 246
160 3300003790 Ga0055528_1002998 Ga0055528_10029984 246
161 3300003792 Ga0055540_1009129 Ga0055540_10091292 246
162 3300003856 Ga0058692_1000208 Ga0058692_100020839 246
163 3300005366 Ga0070659_100060383 Ga0070659_1000603832 246
164 3300005539 Ga0068853_100453602 Ga0068853_1004536021 246
165 3300005616 Ga0068852_100123869 Ga0068852_1001238692 246
166 3300005983 Ga0081540_1010523 Ga0081540_10105235 246
167 3300005983 Ga0081540_1023286 Ga0081540_10232864 246
168 3300006042 Ga0075368_10000330 Ga0075368_1000033014 246
169 3300006048 Ga0075363_100123985 Ga0075363_1001239852 246
170 3300006178 Ga0075367_10004746 Ga0075367_100047466 246
171 3300006178 Ga0075367_10013668 Ga0075367_100136682 246
172 3300006353 Ga0075370_10046871 Ga0075370_100468712 246
173 3300009036 Ga0105244_10001177 Ga0105244_1000117715 246
174 3300010375 Ga0105239_10081533 Ga0105239_100815332 246
175 3300013104 Ga0157370_10000580 Ga0157370_1000058036 246
176 3300013297 Ga0157378_10190879 Ga0157378_101908792 246
177 3300015265 Ga0182005_1000027 Ga0182005_1000027167 246
178 3300025229 Ga0209147_100304 Ga0209147_10030416 246
179 3300025258 Ga0209129_1001259 Ga0209129_100125911 246
180 3300025273 Ga0209673_1001339 Ga0209673_10013398 246
181 3300025295 Ga0209564_1000952 Ga0209564_100095225 246
182 3300025295 Ga0209564_1001807 Ga0209564_10018077 246
183 3300025297 Ga0209758_1002736 Ga0209758_10027365 246
184 3300025299 Ga0209256_1003228 Ga0209256_10032288 246
185 3300025302 Ga0207426_1001359 Ga0207426_100135912 246
186 3300025303 Ga0209051_1004480 Ga0209051_10044805 246
187 3300025304 Ga0209257_1008339 Ga0209257_10083394 246
188 3300025728 Ga0207655_1001865 Ga0207655_100186510 246
189 3300025904 Ga0207647_10030160 Ga0207647_100301603 246
190 3300025919 Ga0207657_10004527 Ga0207657_100045272 246
191 3300025920 Ga0207649_10041760 Ga0207649_100417602 246
192 3300025932 Ga0207690_10030294 Ga0207690_100302942 246
193 3300025949 Ga0207667_10186665 Ga0207667_101866652 246
194 3300026142 Ga0207698_10232737 Ga0207698_102327372 246
195 3300027312 Ga0209371_1000134 Ga0209371_100013492 246
196 3300027866 Ga0209813_10000168 Ga0209813_1000016816 246
197 3300030500 Ga0268256_1000790 Ga0268256_10007908 246
198 3300037471 Ga0395905_0797924 Ga0395905_0797924_53_793 246
199 3300038443 Ga0395901_0440348 Ga0395901_0440348_478_1218 246
200 3300041491 Ga0451833_0574990 Ga0451833_0574990_16157_16897 246
201 3300041501 Ga0451845_0186737 Ga0451845_0186737_590_1330 246
202 3300041507 Ga0451851_0002342 Ga0451851_0002342_424_1164 246
203 3300041512 Ga0451853_3293725 Ga0451853_3293725_1292_2032 246
204 3300042533 Ga0450901_001288 Ga0450901_001288_1444_2184 246
205 3300046452 Ga0495617_022093 Ga0495617_022093_460_1200 246
206 3300046453 Ga0495627_000007 Ga0495627_000007_382545_383285 246
207 3300046453 Ga0495627_000087 Ga0495627_000087_58044_58784 246
208 3300046453 Ga0495627_004183 Ga0495627_004183_689_1429 246
209 3300046454 Ga0495592_0009010 Ga0495592_0009010_4158_4898 246
210 3300046454 Ga0495592_0039343 Ga0495592_0039343_2354_3094 246
211 3300046455 Ga0495603_0071136 Ga0495603_0071136_1094_1834 246
212 3300046459 Ga0495629_0046787 Ga0495629_0046787_2154_2894 246
213 3300046461 Ga0495641_0177647 Ga0495641_0177647_73_813 246
214 3300046463 Ga0495653_0091808 Ga0495653_0091808_1156_1896 246
215 3300046463 Ga0495653_0104525 Ga0495653_0104525_205_945 246
216 3300046471 Ga0495650_0000001 Ga0495650_0000001_237522_238262 246
217 3300046471 Ga0495650_0000108 Ga0495650_0000108_167093_167833 246
218 3300046471 Ga0495650_0002761 Ga0495650_0002761_12715_13455 246
219 3300046471 Ga0495650_0022417 Ga0495650_0022417_1634_2374 246
220 3300046471 Ga0495650_0044238 Ga0495650_0044238_1098_1838 246
221 3300046473 Ga0495582_0038506 Ga0495582_0038506_66_806 246
222 3300046474 Ga0495605_0000008 Ga0495605_0000008_298065_298805 246
223 3300046476 Ga0495662_0030405 Ga0495662_0030405_54_794 246
224 3300046477 Ga0495664_0037373 Ga0495664_0037373_724_1464 246
225 3300046491 Ga0495584_0005926 Ga0495584_0005926_3501_4241 246
226 3300046499 Ga0495594_0000625 Ga0495594_0000625_3651_4391 246
227 3300046500 Ga0495596_0000760 Ga0495596_0000760_5419_6159 246
228 3300046500 Ga0495596_0018663 Ga0495596_0018663_273_1013 246
229 3300046501 Ga0495607_0003034 Ga0495607_0003034_2173_2913 246
230 3300046501 Ga0495607_0028018 Ga0495607_0028018_2259_2999 246
231 3300046501 Ga0495607_0055104 Ga0495607_0055104_892_1632 246
232 3300046501 Ga0495607_0099311 Ga0495607_0099311_471_1211 246
233 3300046506 Ga0495583_0000039 Ga0495583_0000039_35470_36210 246
234 3300046506 Ga0495583_0013518 Ga0495583_0013518_3310_4050 246
235 3300046507 Ga0495606_0001469 Ga0495606_0001469_7298_8038 246
236 3300046507 Ga0495606_0003757 Ga0495606_0003757_8151_8891 246
237 3300046507 Ga0495606_0069995 Ga0495606_0069995_372_1112 246
238 3300046511 Ga0495608_0006621 Ga0495608_0006621_5457_6197 246
239 3300046512 Ga0495610_0006137 Ga0495610_0006137_2819_3559 246
240 3300046512 Ga0495610_0007981 Ga0495610_0007981_1011_1751 246
241 3300046512 Ga0495610_0015587 Ga0495610_0015587_2182_2922 246
242 3300046513 Ga0495616_0000129 Ga0495616_0000129_23311_24051 246
243 3300046513 Ga0495616_0003218 Ga0495616_0003218_4860_5600 246
244 3300046513 Ga0495616_0063415 Ga0495616_0063415_576_1316 246
245 3300046513 Ga0495616_0081790 Ga0495616_0081790_733_1473 246
246 3300046515 Ga0495620_0000068 Ga0495620_0000068_35669_36409 246
247 3300046516 Ga0495628_0108059 Ga0495628_0108059_1357_2097 246
248 3300046517 Ga0495630_0085757 Ga0495630_0085757_1481_2221 246
249 3300046518 Ga0495631_0000230 Ga0495631_0000230_20599_21339 246
250 3300046518 Ga0495631_0002669 Ga0495631_0002669_6301_7041 246
251 3300046518 Ga0495631_0003716 Ga0495631_0003716_2619_3359 246
252 3300046518 Ga0495631_0047369 Ga0495631_0047369_1094_1834 246
253 3300046519 Ga0495632_0000011 Ga0495632_0000011_53007_53747 246
254 3300046519 Ga0495632_0003135 Ga0495632_0003135_8663_9403 246
255 3300046519 Ga0495632_0003149 Ga0495632_0003149_5749_6489 246
256 3300046520 Ga0495637_0006521 Ga0495637_0006521_1086_1826 246
257 3300046520 Ga0495637_0066533 Ga0495637_0066533_546_1286 246
258 3300046523 Ga0495644_0020538 Ga0495644_0020538_1189_1929 246
259 3300046524 Ga0495648_0000775 Ga0495648_0000775_24767_25507 246
260 3300046524 Ga0495648_0001043 Ga0495648_0001043_3586_4326 246
261 3300046524 Ga0495648_0014349 Ga0495648_0014349_3302_4042 246
262 3300046524 Ga0495648_0021220 Ga0495648_0021220_1802_2542 246
263 3300046526 Ga0495666_0053009 Ga0495666_0053009_189_929 246
264 3300046529 Ga0495652_0042046 Ga0495652_0042046_1602_2342 246
265 3300046529 Ga0495652_0280674 Ga0495652_0280674_283_1023 246
266 3300046530 Ga0495654_0001278 Ga0495654_0001278_8171_8911 246
267 3300046530 Ga0495654_0001662 Ga0495654_0001662_13114_13854 246
268 3300046530 Ga0495654_0052170 Ga0495654_0052170_1008_1748 246
269 3300046531 Ga0495665_0003393 Ga0495665_0003393_2231_2971 246
270 3300046535 Ga0495586_0049140 Ga0495586_0049140_188_928 246
271 3300046538 Ga0495609_0000031 Ga0495609_0000031_13149_13889 246
272 3300046538 Ga0495609_0001197 Ga0495609_0001197_12885_13625 246
273 3300046538 Ga0495609_0004201 Ga0495609_0004201_5512_6252 246
274 3300046542 Ga0495597_0069385 Ga0495597_0069385_638_1378 246
275 3300046543 Ga0495645_0185804 Ga0495645_0185804_355_1095 246
276 3300046558 Ga0495633_0000011 Ga0495633_0000011_232133_232873 246
277 3300046559 Ga0495667_0041149 Ga0495667_0041149_647_1387 246
278 3300046642 Ga0495634_0015288 Ga0495634_0015288_3131_3871 246
279 3300046648 Ga0495611_0005403 Ga0495611_0005403_1993_2733 246
280 3300046663 Ga0495635_0144716 Ga0495635_0144716_817_1557 246
281 3300046665 Ga0495661_0000493 Ga0495661_0000493_35605_36345 246
282 3300046665 Ga0495661_0002864 Ga0495661_0002864_895_1635 246
283 3300046675 Ga0495657_0022782 Ga0495657_0022782_1605_2345 246
284 3300046679 Ga0495623_0087543 Ga0495623_0087543_926_1666 246
285 3300046680 Ga0495646_0003648 Ga0495646_0003648_2127_2867 246
286 3300046690 Ga0495624_0054959 Ga0495624_0054959_1408_2148 246
287 3300046691 Ga0495670_0007409 Ga0495670_0007409_2310_3050 246
288 3300046692 Ga0495671_0010382 Ga0495671_0010382_901_1641 246
289 3300046694 Ga0495649_0008837 Ga0495649_0008837_3329_4069 246
290 3300046694 Ga0495649_0017816 Ga0495649_0017816_626_1366 246
291 3300046694 Ga0495649_0131676 Ga0495649_0131676_219_959 246
292 3300046794 Ga0495589_0001653 Ga0495589_0001653_6883_7623 246
293 3300046794 Ga0495589_0043559 Ga0495589_0043559_333_1073 246
294 3300046794 Ga0495589_0045338 Ga0495589_0045338_349_1089 246
295 3300046809 Ga0495600_0011672 Ga0495600_0011672_1700_2440 246
296 3300046810 Ga0495660_0000172 Ga0495660_0000172_38956_39696 246
297 3300046810 Ga0495660_0002144 Ga0495660_0002144_1789_2529 246
298 3300046810 Ga0495660_0024399 Ga0495660_0024399_360_1100 246
299 3300046810 Ga0495660_0201062 Ga0495660_0201062_180_920 246
300 3300047315 Ga0495581_0014230 Ga0495581_0014230_2266_3006 246
301 3300047317 Ga0495604_0098460 Ga0495604_0098460_597_1337 246
302 3300047319 Ga0495674_0138519 Ga0495674_0138519_149_889 246
303 3300047320 Ga0495672_0000032 Ga0495672_0000032_32793_33533 246
304 3300047320 Ga0495672_0000386 Ga0495672_0000386_8969_9709 246
305 3300047320 Ga0495672_0006603 Ga0495672_0006603_7695_8435 246
306 3300047321 Ga0495676_0080844 Ga0495676_0080844_183_923 246
307 3300047322 Ga0495680_0107494 Ga0495680_0107494_59_799 246
308 3300047323 Ga0495683_0000114 Ga0495683_0000114_42666_43406 246
309 3300047323 Ga0495683_0000345 Ga0495683_0000345_2005_2745 246
310 3300047323 Ga0495683_0002309 Ga0495683_0002309_4143_4883 246
311 3300047323 Ga0495683_0006276 Ga0495683_0006276_5499_6239 246
312 3300047323 Ga0495683_0067179 Ga0495683_0067179_462_1202 246
313 3300047323 Ga0495683_0088270 Ga0495683_0088270_353_1105 246
314 3300047444 Ga0495675_0002938 Ga0495675_0002938_8241_8981 246
315 3300047446 Ga0495679_000043 Ga0495679_000043_105979_106719 246
316 3300047470 Ga0495681_0017708 Ga0495681_0017708_2129_2869 246
317 3300047470 Ga0495681_0051168 Ga0495681_0051168_197_937 246
318 3300047471 Ga0495684_0080196 Ga0495684_0080196_410_1150 246
319 3300047472 Ga0495686_0001425 Ga0495686_0001425_5873_6613 246
320 3300047472 Ga0495686_0041616 Ga0495686_0041616_378_1220 246
321 3300047673 Ga0495593_0106417 Ga0495593_0106417_450_1190 246
322 3300048088 Ga0495602_0190583 Ga0495602_0190583_255_995 246
323 3300048089 Ga0495614_0024749 Ga0495614_0024749_1407_2147 246
324 3300048091 Ga0495626_0000017 Ga0495626_0000017_137807_138547 246
325 3300048091 Ga0495626_0018073 Ga0495626_0018073_105_845 246
326 3300048091 Ga0495626_0217701 Ga0495626_0217701_22_762 246
327 3300048905 Ga0496102_0002275 Ga0496102_0002275_12662_13402 246
328 3300048909 Ga0496106_0109894 Ga0496106_0109894_909_1649 246
329 3300048919 Ga0496116_0013844 Ga0496116_0013844_1914_2654 246
330 3300048919 Ga0496116_0069308 Ga0496116_0069308_1235_1975 246
331 3300048919 Ga0496116_0071823 Ga0496116_0071823_1380_2120 246
332 3300048920 Ga0496117_0004819 Ga0496117_0004819_2002_2742 246
333 3300048921 Ga0496118_0000120 Ga0496118_0000120_37295_38035 246
334 3300048925 Ga0496122_0025240 Ga0496122_0025240_2634_3374 246
335 3300048925 Ga0496122_0038242 Ga0496122_0038242_2472_3230 246
336 3300048925 Ga0496122_0100540 Ga0496122_0100540_311_1051 246
337 3300048926 Ga0496123_0021889 Ga0496123_0021889_2312_3052 246
338 3300048926 Ga0496123_0087039 Ga0496123_0087039_374_1132 246
339 3300048927 Ga0496124_0001523 Ga0496124_0001523_23391_24149 246
340 3300048927 Ga0496124_0001563 Ga0496124_0001563_11958_12698 246
341 3300048927 Ga0496124_0022664 Ga0496124_0022664_2648_3388 246
342 3300048927 Ga0496124_0266877 Ga0496124_0266877_52_792 246
343 3300048928 Ga0496125_0004285 Ga0496125_0004285_5991_6749 246
344 3300048928 Ga0496125_0057727 Ga0496125_0057727_1225_1965 246
345 3300049459 Ga0495678_000004 Ga0495678_000004_328483_329223 246
346 3300049459 Ga0495678_000018 Ga0495678_000018_243365_244105 246
347 3300049459 Ga0495678_000203 Ga0495678_000203_61566_62306 246
348 3300049460 Ga0495682_0000716 Ga0495682_0000716_13539_14279 246
349 3300049569 Ga0501032_0070238 Ga0501032_0070238_1093_1833 246
350 3300049572 Ga0501036_0397510 Ga0501036_0397510_391_1131 246
351 3300049581 Ga0501047_0229411 Ga0501047_0229411_327_1067 246
352 3300049589 Ga0501073_0105858 Ga0501073_0105858_695_1435 246
353 3300049679 Ga0501249_040006 Ga0501249_040006_64_804 246
354 3300049766 Ga0501269_000251 Ga0501269_000251_7716_8456 246
355 3300050494 nmdc:mga06z11_70_c1 nmdc:mga06z11_70_c1_236_976 246
356 3300050494 nmdc:mga06z11_9910_c1 nmdc:mga06z11_9910_c1_3188_3928 246
357 3300050495 nmdc:mga04h51_278_c1 nmdc:mga04h51_278_c1_2115_2855 246
358 3300050495 nmdc:mga04h51_36265_c1 nmdc:mga04h51_36265_c1_294_1034 246
359 3300050496 nmdc:mga07m45_100371_c1 nmdc:mga07m45_100371_c1_386_1126 246
360 3300053125 Ga0500618_000705 Ga0500618_000705_14500_15240 246
361 3300053125 Ga0500618_002239 Ga0500618_002239_384_1124 246
362 3300053125 Ga0500618_003121 Ga0500618_003121_196_936 246
363 3300053125 Ga0500618_009629 Ga0500618_009629_697_1437 246
364 3300053136 Ga0500559_0000663 Ga0500559_0000663_6779_7519 246
365 3300053136 Ga0500559_0001253 Ga0500559_0001253_1677_2417 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

1

190

0.96

PF08659

KR

KR domain

1

177

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

5

212

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

1

178

0.71

PF13460

NAD_binding_10

NAD(P)H-binding

5

211

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.963 6 243
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9586 6 243
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9567 8 244
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9471 7 246
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9439 8 244
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9672 5 83 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.963 6 243 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9586 6 243 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9385 8 54 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.936 2 94 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A383B9X5-F1-model_v4 Uncharacterized protein 0.963 3 125 GO:0016616
AF-A0A166GEU0-F1-model_v4 Oxidoreductase 0.9564 5 246 GO:0016020
GO:0016491
AF-X1KF86-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase 0.9505 1 194 GO:0016616
GO:0030497
AF-A0A6B3H269-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9497 6 122 GO:0008667
GO:0019290
AF-A0A358DUF9-F1-model_v4 Short chain dehydrogenase 0.9465 10 125 GO:0016491

Feature Viewer

pLDDT pTM Quality
89.77 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map