metagRoot

F423799

General Info

Members	Datasets	Scaffolds	Average Seq Length
365	242	365	232

Family's Representative Sequence

Representative Sequence	3300046690\|Ga0495624_0008756\|Ga0495624_0008756_5400_6158
Length	252
Sequence	LPLCGNNYDITWKNGGVAERDDPVLLITGASSGIGAATARATASKYRLVLAARRLEPLEELVEELGGAERALAVRCDVSEWDEVEAMVAAGIERFERIDAVFANAGFGATRGFLEESPEHWRSMVLTNVYGLALTIRATLPHLLERGDGHVLVTSSVAGRRALPGSLYSATKHAATAIGEALRAELRQMHENRDIRVTLIEPGMTDTPFFDNRPGEWALRDDDIARAVLYALEQRPGVDVNEILIRPTSQPI

Samples

	Sample ID	Description	Type	Environment
1	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
2	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
3	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
4	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
5	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
6	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
7	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
8	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
9	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
10	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
11	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
12	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
13	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
14	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
15	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
16	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
17	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
18	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
19	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
20	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
21	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
22	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
23	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
24	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
25	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
26	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
27	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
28	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
29	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
30	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
31	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
32	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
33	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
34	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
35	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
36	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
37	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
38	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
39	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
40	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
41	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
42	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
43	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
44	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
45	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
46	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
47	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
48	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
49	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
50	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
51	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
52	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
53	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
54	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
55	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
56	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
57	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
58	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
59	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
60	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
61	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
62	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
63	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
64	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
65	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
66	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
67	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
68	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
69	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
70	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
71	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
72	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
73	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
74	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
75	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
76	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
77	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
120	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
121	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
122	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
123	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
124	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
125	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
126	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
127	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
128	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
129	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
130	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
131	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
132	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
133	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
134	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
135	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
136	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
137	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
138	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
139	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
140	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
141	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
142	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
143	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
144	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
145	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
146	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
147	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
148	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
149	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
150	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
151	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
152	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
153	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
154	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
155	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
156	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
157	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
158	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
159	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
160	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
161	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
162	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
163	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
164	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
165	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
166	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
167	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
168	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
169	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
170	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
171	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
172	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
173	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
174	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
175	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
176	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
177	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
178	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
179	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
180	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
181	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
182	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
183	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
184	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
185	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
186	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
187	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
188	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
189	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
190	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
191	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
192	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
193	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
194	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
195	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
196	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
197	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
198	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
199	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
200	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
201	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
202	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
203	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
204	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
205	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
206	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
207	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
208	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
209	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
210	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
211	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
212	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
213	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
214	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
215	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
216	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
217	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
218	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
219	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
220	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
221	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
222	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
223	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
224	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
225	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
226	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
227	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
228	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
229	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
230	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
231	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
232	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
233	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
234	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
235	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
236	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
237	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
238	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
239	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
240	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
241	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
242	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.45
Metatranscriptomes	0.55
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.38
Nodule	0
Rhizoplane	8.49
Rhizosphere	86.58
Stem	0
Stem Tuber	0
Unclassified	0.55

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1000158	3300001977	Bacteria	8696
2	Ga0070658_10013036	3300005327	Bacteria	6672
3	Ga0070658_10013240	3300005327	Bacteria	6616
4	Ga0070683_100100934	3300005329	Bacteria	2717
5	Ga0070683_100216610	3300005329	Bacteria	1819
6	Ga0070683_100519848	3300005329	Unclassified	1137
7	Ga0070690_100166946	3300005330	Bacteria	1512
8	Ga0070666_10010018	3300005335	Bacteria	5915
9	Ga0070680_100004075	3300005336	Bacteria	10945
10	Ga0070680_100499893	3300005336	Bacteria	1040
11	Ga0070682_100005880	3300005337	Bacteria	6858
12	Ga0070682_100368980	3300005337	Bacteria	1076
13	Ga0068868_100003415	3300005338	Bacteria	11053
14	Ga0068868_100189640	3300005338	Bacteria	1709
15	Ga0070660_100012090	3300005339	Bacteria	6161
16	Ga0070661_100000023	3300005344	Bacteria	123104
17	Ga0070661_100036157	3300005344	Bacteria	3590
18	Ga0070668_100055205	3300005347	Bacteria	3066
19	Ga0070668_100064648	3300005347	Bacteria	2836
20	Ga0070675_100000111	3300005354	Bacteria	47699
21	Ga0070675_100289448	3300005354	Bacteria	1441
22	Ga0070674_100000064	3300005356	Bacteria	47689
23	Ga0070674_100047314	3300005356	Bacteria	2946
24	Ga0070674_100066158	3300005356	Bacteria	2539
25	Ga0070673_100038478	3300005364	Bacteria	3653
26	Ga0070688_100000068	3300005365	Bacteria	50778
27	Ga0070659_100012260	3300005366	Bacteria	6355
28	Ga0070667_100097536	3300005367	Bacteria	2535
29	Ga0070667_100280505	3300005367	Bacteria	1496
30	Ga0070710_10120246	3300005437	Bacteria	1589
31	Ga0070701_10127902	3300005438	Bacteria	1440
32	Ga0070711_100010077	3300005439	Bacteria	5838
33	Ga0070711_100078971	3300005439	Bacteria	2340
34	Ga0070700_100000366	3300005441	Bacteria	23158
35	Ga0070663_100002635	3300005455	Bacteria	10153
36	Ga0070662_100000004	3300005457	Bacteria	195534
37	Ga0070662_100006680	3300005457	Bacteria	7451
38	Ga0070681_10751512	3300005458	Bacteria	892
39	Ga0068867_100000281	3300005459	Bacteria	33623
40	Ga0070685_10000364	3300005466	Bacteria	27523
41	Ga0070685_10011182	3300005466	Bacteria	4694
42	Ga0070679_100005920	3300005530	Bacteria	11359
43	Ga0070679_100263647	3300005530	Bacteria	1678
44	Ga0070684_100013689	3300005535	Bacteria	6545
45	Ga0070684_100035480	3300005535	Bacteria	4268
46	Ga0070684_100224255	3300005535	Bacteria	1715
47	Ga0070684_100334120	3300005535	Bacteria	1393
48	Ga0068853_100033228	3300005539	Bacteria	4375
49	Ga0068853_100055564	3300005539	Bacteria	3413
50	Ga0070672_100000015	3300005543	Bacteria	72591
51	Ga0070672_100053404	3300005543	Bacteria	3159
52	Ga0070686_100020206	3300005544	Bacteria	3938
53	Ga0070665_100000106	3300005548	Bacteria	157315
54	Ga0070665_100001339	3300005548	Bacteria	29297
55	Ga0070665_100089169	3300005548	Bacteria	3090
56	Ga0070704_100058118	3300005549	Bacteria	2754
57	Ga0070704_100089752	3300005549	Bacteria	2287
58	Ga0070664_100090533	3300005564	Bacteria	2648
59	Ga0070664_100208976	3300005564	Bacteria	1744
60	Ga0068857_100012728	3300005577	Bacteria	7333
61	Ga0068854_100005170	3300005578	Bacteria	8229
62	Ga0068854_100185602	3300005578	Bacteria	1627
63	Ga0068856_100013668	3300005614	Bacteria	7849
64	Ga0068856_100350888	3300005614	Bacteria	1494
65	Ga0068852_100002607	3300005616	Bacteria	12455
66	Ga0068864_100000045	3300005618	Bacteria	154739
67	Ga0068866_10000001	3300005718	Bacteria	519680
68	Ga0068863_100000021	3300005841	Bacteria	198088
69	Ga0068858_100000216	3300005842	Bacteria	62188
70	Ga0068858_100040767	3300005842	Bacteria	4307
71	Ga0068860_100056055	3300005843	Bacteria	3748
72	Ga0068860_100531149	3300005843	Bacteria	1177
73	Ga0081538_10017400	3300005981	Bacteria	5458
74	Ga0075365_10093364	3300006038	Bacteria	2052
75	Ga0075365_10464850	3300006038	Bacteria	894
76	Ga0075368_10168041	3300006042	Bacteria	921
77	Ga0075363_100043883	3300006048	Bacteria	2367
78	Ga0075364_10009320	3300006051	Bacteria	5883
79	Ga0075364_10058111	3300006051	Bacteria	2534
80	Ga0075364_10123280	3300006051	Unclassified	1736
81	Ga0070715_10000001	3300006163	Bacteria	693690
82	Ga0070712_100008219	3300006175	Bacteria	6554
83	Ga0070712_100010232	3300006175	Bacteria	5914
84	Ga0075433_10031937	3300006852	Bacteria	4505
85	Ga0075434_100111975	3300006871	Bacteria	2740
86	Ga0068865_100112666	3300006881	Bacteria	2010
87	Ga0075435_100013269	3300007076	Bacteria	6122
88	Ga0105240_10013241	3300009093	Bacteria	11346
89	Ga0105245_10000454	3300009098	Bacteria	37583
90	Ga0105245_10008108	3300009098	Bacteria	9189
91	Ga0105245_10077147	3300009098	Bacteria	3037
92	Ga0105245_10573677	3300009098	Bacteria	1152
93	Ga0114129_10616288	3300009147	Bacteria	1404
94	Ga0105243_10017722	3300009148	Bacteria	5386
95	Ga0105237_10026561	3300009545	Bacteria	5918
96	Ga0105238_10000011	3300009551	Bacteria	261080
97	Ga0105238_10005199	3300009551	Bacteria	12861
98	Ga0105239_10162179	3300010375	Bacteria	2498
99	Ga0105246_10597925	3300011119	Bacteria	953
100	Ga0157371_10158030	3300013102	Bacteria	1618
101	Ga0157371_10290992	3300013102	Unclassified	1181
102	Ga0157370_10043566	3300013104	Bacteria	4317
103	Ga0157369_10027214	3300013105	Bacteria	6340
104	Ga0157369_10282985	3300013105	Bacteria	1727
105	Ga0157374_10005775	3300013296	Bacteria	10446
106	Ga0157378_10002995	3300013297	Bacteria	15012
107	Ga0157378_10005465	3300013297	Bacteria	11132
108	Ga0163162_10790925	3300013306	Bacteria	1066
109	Ga0157372_10135996	3300013307	Bacteria	2830
110	Ga0157375_10001152	3300013308	Bacteria	22842
111	Ga0157375_10002277	3300013308	Bacteria	16605
112	Ga0157375_10016006	3300013308	Bacteria	6727
113	Ga0157375_10016397	3300013308	Bacteria	6655
114	Ga0163163_10508152	3300014325	Bacteria	1267
115	Ga0157380_10001196	3300014326	Bacteria	16795
116	Ga0157380_10498645	3300014326	Bacteria	1182
117	Ga0157377_10031103	3300014745	Bacteria	2898
118	Ga0163161_10000035	3300017792	Bacteria	155979
119	Ga0163161_10154505	3300017792	Bacteria	1746
120	Ga0206353_11335746	3300020082	Bacteria	4272
121	Ga0224712_10285118	3300022467	Unclassified	770
122	Ga0207692_10118831	3300025898	Bacteria	1477
123	Ga0207642_10000002	3300025899	Bacteria	658166
124	Ga0207688_10042982	3300025901	Bacteria	2516
125	Ga0207680_10014124	3300025903	Bacteria	4122
126	Ga0207680_10101391	3300025903	Bacteria	1850
127	Ga0207699_10239546	3300025906	Bacteria	1246
128	Ga0207705_10033400	3300025909	Bacteria	3675
129	Ga0207705_10034117	3300025909	Bacteria	3638
130	Ga0207705_10149277	3300025909	Bacteria	1750
131	Ga0207654_10210197	3300025911	Bacteria	1285
132	Ga0207693_10006565	3300025915	Bacteria	9624
133	Ga0207693_10013567	3300025915	Bacteria	6567
134	Ga0207662_10071812	3300025918	Bacteria	2096
135	Ga0207657_10000307	3300025919	Bacteria	51966
136	Ga0207649_10000523	3300025920	Bacteria	26930
137	Ga0207649_10290525	3300025920	Bacteria	1192
138	Ga0207652_10003690	3300025921	Bacteria	12586
139	Ga0207694_10000004	3300025924	Bacteria	967075
140	Ga0207659_10000010	3300025926	Bacteria	286639
141	Ga0207659_10024803	3300025926	Bacteria	4023
142	Ga0207687_10004954	3300025927	Bacteria	8836
143	Ga0207687_10052643	3300025927	Bacteria	2842
144	Ga0207690_10022335	3300025932	Bacteria	3934
145	Ga0207706_10000012	3300025933	Bacteria	195475
146	Ga0207706_10012589	3300025933	Bacteria	7701
147	Ga0207686_10010146	3300025934	Bacteria	5122
148	Ga0207709_10009100	3300025935	Bacteria	5475
149	Ga0207709_10107178	3300025935	Bacteria	1860
150	Ga0207670_10412613	3300025936	Bacteria	1082
151	Ga0207669_10000018	3300025937	Bacteria	114254
152	Ga0207669_10486808	3300025937	Bacteria	984
153	Ga0207704_10026638	3300025938	Bacteria	3175
154	Ga0207691_10000044	3300025940	Bacteria	100027
155	Ga0207691_10031048	3300025940	Bacteria	4990
156	Ga0207661_10000224	3300025944	Bacteria	36954
157	Ga0207661_10004878	3300025944	Bacteria	9402
158	Ga0207661_10008084	3300025944	Bacteria	7501
159	Ga0207661_10218218	3300025944	Bacteria	1684
160	Ga0207668_10002989	3300025972	Bacteria	9908
161	Ga0207668_10058307	3300025972	Bacteria	2698
162	Ga0207640_10007209	3300025981	Bacteria	6129
163	Ga0207640_10080946	3300025981	Bacteria	2219
164	Ga0207658_10079501	3300025986	Bacteria	2508
165	Ga0207677_10015101	3300026023	Bacteria	4531
166	Ga0207677_10079551	3300026023	Bacteria	2344
167	Ga0207703_10000023	3300026035	Bacteria	222018
168	Ga0207703_10000152	3300026035	Bacteria	79658
169	Ga0207639_10041767	3300026041	Bacteria	3434
170	Ga0207639_10047985	3300026041	Bacteria	3230
171	Ga0207639_10144895	3300026041	Bacteria	1983
172	Ga0207678_10015271	3300026067	Bacteria	6754
173	Ga0207708_10005179	3300026075	Bacteria	9617
174	Ga0207702_10241831	3300026078	Bacteria	1691
175	Ga0207641_10000151	3300026088	Bacteria	99225
176	Ga0207641_10220983	3300026088	Bacteria	1757
177	Ga0207648_10000872	3300026089	Bacteria	33984
178	Ga0207648_10297931	3300026089	Bacteria	1446
179	Ga0207676_10000016	3300026095	Bacteria	311561
180	Ga0207674_10176191	3300026116	Bacteria	2091
181	Ga0207675_100125937	3300026118	Bacteria	2426
182	Ga0207675_100514189	3300026118	Bacteria	1193
183	Ga0207683_10020098	3300026121	Bacteria	5708
184	Ga0207683_10087288	3300026121	Bacteria	2774
185	Ga0207698_10025249	3300026142	Bacteria	4182
186	Ga0268266_10000047	3300028379	Bacteria	310996
187	Ga0268266_10009487	3300028379	Bacteria	8562
188	Ga0268264_10006655	3300028381	Bacteria	9721
189	Ga0268264_10545646	3300028381	Bacteria	1136
190	Ga0268264_10578985	3300028381	Bacteria	1104
191	Ga0265326_10000102	3300028558	Bacteria	43681
192	Ga0265322_10000001	3300028654	Bacteria	543854
193	Ga0265338_10125844	3300028800	Bacteria	2034
194	Ga0265324_10005914	3300029957	Bacteria	5194
195	Ga0265332_10041483	3300031238	Bacteria	1991
196	Ga0265328_10041256	3300031239	Bacteria	1699
197	Ga0265320_10000002	3300031240	Bacteria	542875
198	Ga0265329_10005229	3300031242	Bacteria	5276
199	Ga0265331_10000751	3300031250	Bacteria	27117
200	Ga0265327_10000011	3300031251	Bacteria	543807
201	Ga0265316_10070161	3300031344	Bacteria	2703
202	Ga0307408_100037001	3300031548	Bacteria	3435
203	Ga0265314_10000062	3300031711	Bacteria	159496
204	Ga0316576_10001940	3300031727	Bacteria	11553
205	Ga0307405_10012861	3300031731	Bacteria	4447
206	Ga0307410_10050145	3300031852	Bacteria	2805
207	Ga0307406_10059172	3300031901	Bacteria	2465
208	Ga0307409_100019635	3300031995	Bacteria	4582
209	Ga0307416_100289933	3300032002	Bacteria	1620
210	Ga0307411_10042988	3300032005	Bacteria	2888
211	Ga0307415_100061447	3300032126	Bacteria	2601
212	Ga0307415_100188490	3300032126	Bacteria	1625
213	Ga0316574_0046665	3300035398	Bacteria	2687
214	Ga0373937_0496596	3300036401	Bacteria	1159
215	Ga0316582_0278737	3300036647	Bacteria	1147
216	Ga0395898_0022204	3300037466	Bacteria	6431
217	Ga0395898_0043389	3300037466	Bacteria	4432
218	Ga0436365_0172502	3300039437	Bacteria	1929
219	Ga0451853_2516419	3300041512	Bacteria	3773
220	Ga0466963_0000001	3300044694	Bacteria	110556
221	Ga0466968_0026964	3300044735	Bacteria	2362
222	Ga0466967_0041876	3300045976	Bacteria	3953
223	Ga0495592_0036400	3300046454	Unclassified	3707
224	Ga0495603_0001695	3300046455	Bacteria	12959
225	Ga0495603_0226533	3300046455	Bacteria	1078
226	Ga0495629_0000272	3300046459	Bacteria	44883
227	Ga0495629_0004323	3300046459	Bacteria	10654
228	Ga0495641_0000044	3300046461	Bacteria	77415
229	Ga0495641_0019025	3300046461	Bacteria	3527
230	Ga0495641_0044663	3300046461	Bacteria	2043
231	Ga0495653_0088082	3300046463	Bacteria	2278
232	Ga0495582_0000011	3300046473	Bacteria	113352
233	Ga0495662_0000061	3300046476	Bacteria	37295
234	Ga0495664_0452671	3300046477	Bacteria	769
235	Ga0495608_0000583	3300046511	Bacteria	25062
236	Ga0495608_0452156	3300046511	Bacteria	781
237	Ga0495618_0000174	3300046514	Bacteria	45942
238	Ga0495628_0008782	3300046516	Bacteria	8648
239	Ga0495628_0092384	3300046516	Bacteria	2341
240	Ga0495630_0000056	3300046517	Bacteria	91477
241	Ga0495652_0485770	3300046529	Bacteria	859
242	Ga0495586_0012117	3300046535	Bacteria	4578
243	Ga0495621_0001829	3300046539	Bacteria	5599
244	Ga0495656_0002145	3300046615	Bacteria	6519
245	Ga0495668_0036089	3300046616	Bacteria	2771
246	Ga0495634_0000018	3300046642	Bacteria	121323
247	Ga0495625_0000587	3300046660	Bacteria	52838
248	Ga0495657_0026832	3300046675	Bacteria	4074
249	Ga0495647_0000008	3300046681	Bacteria	101193
250	Ga0495647_0000352	3300046681	Bacteria	12996
251	Ga0495647_0000631	3300046681	Bacteria	10396
252	Ga0495658_0000005	3300046683	Bacteria	149839
253	Ga0495613_0000203	3300046689	Bacteria	58232
254	Ga0495624_0000008	3300046690	Bacteria	145035
255	Ga0495624_0000267	3300046690	Bacteria	41318
256	Ga0495624_0008756	3300046690	Bacteria	7039
257	Ga0495649_0001624	3300046694	Bacteria	16726
258	Ga0495600_0001684	3300046809	Bacteria	12350
259	Ga0495604_0000019	3300047317	Bacteria	175064
260	Ga0495604_0012279	3300047317	Bacteria	6810
261	Ga0495676_0000299	3300047321	Bacteria	40098
262	Ga0495676_0074173	3300047321	Bacteria	2607
263	Ga0495680_0000773	3300047322	Bacteria	35829
264	Ga0495680_0003005	3300047322	Bacteria	16821
265	Ga0495673_0031620	3300047469	Bacteria	2477
266	Ga0495593_0026947	3300047673	Bacteria	3167
267	Ga0495602_0094124	3300048088	Bacteria	2477
268	Ga0496100_0019348	3300048903	Bacteria	4060
269	Ga0496101_0002935	3300048904	Bacteria	10483
270	Ga0496102_0023083	3300048905	Bacteria	5520
271	Ga0496103_0015756	3300048906	Bacteria	4506
272	Ga0496104_0021896	3300048907	Bacteria	5870
273	Ga0496106_0004435	3300048909	Bacteria	10404
274	Ga0496106_0006160	3300048909	Bacteria	8868
275	Ga0496106_0063106	3300048909	Bacteria	2815
276	Ga0496107_0025303	3300048910	Bacteria	4202
277	Ga0496107_0052079	3300048910	Unclassified	2953
278	Ga0496107_0105665	3300048910	Bacteria	2067
279	Ga0496108_0002109	3300048911	Bacteria	15927
280	Ga0496108_0005678	3300048911	Bacteria	10101
281	Ga0496108_0031506	3300048911	Bacteria	4400
282	Ga0496109_0000129	3300048912	Bacteria	77469
283	Ga0496109_0001311	3300048912	Bacteria	20538
284	Ga0496109_0001392	3300048912	Bacteria	20061
285	Ga0496109_0130575	3300048912	Bacteria	2344
286	Ga0496110_0146204	3300048913	Bacteria	2138
287	Ga0496110_0322518	3300048913	Bacteria	1407
288	Ga0496110_0539364	3300048913	Bacteria	1060
289	Ga0496110_0768864	3300048913	Unclassified	867
290	Ga0496110_0855829	3300048913	Bacteria	815
291	Ga0496111_0033844	3300048914	Bacteria	3645
292	Ga0496112_0123478	3300048915	Bacteria	2560
293	Ga0496113_0033970	3300048916	Bacteria	3718
294	Ga0496113_0035645	3300048916	Bacteria	3639
295	Ga0496114_0058546	3300048917	Bacteria	3217
296	Ga0496114_0064505	3300048917	Bacteria	3067
297	Ga0496115_0002082	3300048918	Bacteria	14330
298	Ga0496115_0003019	3300048918	Bacteria	12078
299	Ga0501031_0101404	3300049568	Bacteria	1878
300	Ga0501033_0033540	3300049570	Bacteria	3854
301	Ga0501034_0008403	3300049571	Bacteria	10910
302	Ga0501034_0231347	3300049571	Bacteria	1797
303	Ga0501036_0050458	3300049572	Bacteria	3523
304	Ga0501037_0031121	3300049573	Bacteria	3940
305	Ga0501038_0024670	3300049574	Bacteria	5361
306	Ga0501039_0003795	3300049575	Bacteria	11351
307	Ga0501040_0061348	3300049576	Bacteria	2586
308	Ga0501041_0222215	3300049577	Bacteria	1185
309	Ga0501042_0052938	3300049578	Bacteria	2896
310	Ga0501042_0177050	3300049578	Bacteria	1538
311	Ga0501043_0028532	3300049579	Bacteria	4381
312	Ga0501046_0463302	3300049580	Bacteria	910
313	Ga0501047_0524859	3300049581	Bacteria	1009
314	Ga0501047_0657076	3300049581	Bacteria	867
315	Ga0501047_0680425	3300049581	Bacteria	847
316	Ga0501048_0359160	3300049582	Bacteria	1039
317	Ga0501067_0025635	3300049583	Bacteria	3268
318	Ga0501067_0227134	3300049583	Bacteria	1039
319	Ga0501068_0064036	3300049584	Bacteria	2237
320	Ga0501069_0032882	3300049585	Bacteria	2855
321	Ga0501069_0229226	3300049585	Bacteria	1081
322	Ga0501070_0024271	3300049586	Bacteria	5085
323	Ga0501070_0170835	3300049586	Bacteria	1791
324	Ga0501070_0700174	3300049586	Bacteria	801
325	Ga0501071_0116137	3300049587	Bacteria	1981
326	Ga0501071_0546959	3300049587	Bacteria	889
327	Ga0501072_0051631	3300049588	Bacteria	3237
328	Ga0501072_0071260	3300049588	Bacteria	2746
329	Ga0501073_0153938	3300049589	Bacteria	1593
330	Ga0501074_0058368	3300049590	Bacteria	2780
331	Ga0501075_0004347	3300049591	Bacteria	9586
332	Ga0501076_0156513	3300049592	Bacteria	1855
333	Ga0501079_0158167	3300049741	Bacteria	1766
334	Ga0501079_0254847	3300049741	Bacteria	1372
335	Ga0501080_0161631	3300049742	Bacteria	2068
336	Ga0501081_0487599	3300049743	Bacteria	918
337	Ga0501035_0008158	3300049822	Bacteria	9760
338	Ga0501035_0364087	3300049822	Bacteria	1208
339	Ga0501044_0057502	3300049823	Bacteria	3991
340	Ga0501044_0166201	3300049823	Bacteria	2180
341	Ga0501045_0077981	3300049824	Bacteria	2442
342	Ga0501045_0115198	3300049824	Bacteria	1994
343	nmdc:mga00v17_139342_c1	3300050491	Unclassified	1554
344	nmdc:mga00v17_30717_c1	3300050491	Bacteria	3162
345	nmdc:mga00v17_55756_c1	3300050491	Bacteria	2414
346	nmdc:mga0yw44_15586_c1	3300050492	Bacteria	4076
347	nmdc:mga0yw44_43572_c1	3300050492	Bacteria	2680
348	nmdc:mga0yw44_99150_c1	3300050492	Bacteria	1853
349	nmdc:mga04h51_36325_c1	3300050495	Bacteria	1584
350	nmdc:mga05p37_448803_c1	3300050507	Bacteria	1493
351	nmdc:mga06r32_609226_c1	3300050510	Bacteria	1062
352	nmdc:mga0n895_73788_c1	3300050512	Bacteria	3388
353	nmdc:mga0rr50_105896_c1	3300050513	Bacteria	2218
354	nmdc:mga0a205_221308_c1	3300050515	Bacteria	1778
355	Ga0495601_0000326	3300053077	Bacteria	25282
356	Ga0495612_0011747	3300053078	Bacteria	3529
357	Ga0495595_0000103	3300053084	Bacteria	38598
358	Ga0495619_0000025	3300053085	Bacteria	167905
359	Ga0495619_0033354	3300053085	Bacteria	3343
360	Ga0500566_0001679	3300053094	Bacteria	12979
361	Ga0500614_000397	3300053123	Bacteria	11312
362	Ga0501084_0091048	3300054114	Bacteria	2561
363	Ga0501082_0125991	3300060353	Bacteria	2221
364	Ga0530510_0108453	3300061734	Bacteria	2032
365	Ga0530510_0168569	3300061734	Bacteria	1622

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049589	Ga0501073_0153938	Ga0501073_0153938_28_624	198
2	3300047321	Ga0495676_0000299	Ga0495676_0000299_88_696	202
3	3300005457	Ga0070662_100000004	Ga0070662_10000000457	204
4	3300005459	Ga0068867_100000281	Ga0068867_10000028113	204
5	3300006051	Ga0075364_10123280	Ga0075364_101232802	204
6	3300025933	Ga0207706_10000012	Ga0207706_10000012161	204
7	3300044694	Ga0466963_0000001	Ga0466963_0000001_57298_57912	204
8	3300046514	Ga0495618_0000174	Ga0495618_0000174_26533_27147	204
9	3300046681	Ga0495647_0000352	Ga0495647_0000352_1142_1756	204
10	3300046689	Ga0495613_0000203	Ga0495613_0000203_57413_58027	204
11	3300046809	Ga0495600_0001684	Ga0495600_0001684_11339_11953	204
12	3300048088	Ga0495602_0094124	Ga0495602_0094124_1228_1842	204
13	3300046461	Ga0495641_0019025	Ga0495641_0019025_2136_2765	208
14	3300050491	nmdc:mga00v17_139342_c1	nmdc:mga00v17_139342_c1_459_1169	209
15	3300009098	Ga0105245_10000454	Ga0105245_1000045412	212
16	3300049571	Ga0501034_0231347	Ga0501034_0231347_180_884	212
17	3300031548	Ga0307408_100037001	Ga0307408_1000370014	215
18	3300031731	Ga0307405_10012861	Ga0307405_100128613	215
19	3300031852	Ga0307410_10050145	Ga0307410_100501453	215
20	3300031901	Ga0307406_10059172	Ga0307406_100591723	215
21	3300031995	Ga0307409_100019635	Ga0307409_1000196353	215
22	3300032005	Ga0307411_10042988	Ga0307411_100429883	215
23	3300032126	Ga0307415_100188490	Ga0307415_1001884902	215
24	3300046660	Ga0495625_0000587	Ga0495625_0000587_741_1442	217
25	3300046511	Ga0495608_0452156	Ga0495608_0452156_80_754	223
26	3300049581	Ga0501047_0657076	Ga0501047_0657076_52_738	223
27	3300005329	Ga0070683_100519848	Ga0070683_1005198481	226
28	3300005336	Ga0070680_100004075	Ga0070680_1000040756	226
29	3300005344	Ga0070661_100036157	Ga0070661_1000361575	226
30	3300005458	Ga0070681_10751512	Ga0070681_107515121	226
31	3300005530	Ga0070679_100005920	Ga0070679_1000059206	226
32	3300005535	Ga0070684_100035480	Ga0070684_1000354802	226
33	3300005577	Ga0068857_100012728	Ga0068857_1000127289	226
34	3300005578	Ga0068854_100185602	Ga0068854_1001856021	226
35	3300005616	Ga0068852_100002607	Ga0068852_1000026077	226
36	3300009093	Ga0105240_10013241	Ga0105240_100132419	226
37	3300009545	Ga0105237_10026561	Ga0105237_100265613	226
38	3300009551	Ga0105238_10005199	Ga0105238_100051997	226
39	3300013102	Ga0157371_10290992	Ga0157371_102909922	226
40	3300013104	Ga0157370_10043566	Ga0157370_100435665	226
41	3300013105	Ga0157369_10027214	Ga0157369_100272142	226
42	3300013105	Ga0157369_10282985	Ga0157369_102829851	226
43	3300020082	Ga0206353_11335746	Ga0206353_113357463	226
44	3300022467	Ga0224712_10285118	Ga0224712_102851181	226
45	3300025909	Ga0207705_10149277	Ga0207705_101492772	226
46	3300025921	Ga0207652_10003690	Ga0207652_1000369011	226
47	3300025944	Ga0207661_10008084	Ga0207661_100080842	226
48	3300025944	Ga0207661_10218218	Ga0207661_102182182	226
49	3300026116	Ga0207674_10176191	Ga0207674_101761914	226
50	3300026142	Ga0207698_10025249	Ga0207698_100252493	226
51	3300045976	Ga0466967_0041876	Ga0466967_0041876_1714_2397	226
52	3300048913	Ga0496110_0768864	Ga0496110_0768864_144_827	226
53	3300006038	Ga0075365_10093364	Ga0075365_100933641	227
54	3300014325	Ga0163163_10508152	Ga0163163_105081522	227
55	3300044735	Ga0466968_0026964	Ga0466968_0026964_1657_2343	227
56	3300048916	Ga0496113_0033970	Ga0496113_0033970_158_841	227
57	3300049568	Ga0501031_0101404	Ga0501031_0101404_914_1600	227
58	3300049570	Ga0501033_0033540	Ga0501033_0033540_1061_1747	227
59	3300049572	Ga0501036_0050458	Ga0501036_0050458_1050_1736	227
60	3300049573	Ga0501037_0031121	Ga0501037_0031121_2112_2798	227
61	3300049574	Ga0501038_0024670	Ga0501038_0024670_138_824	227
62	3300049575	Ga0501039_0003795	Ga0501039_0003795_9762_10448	227
63	3300049579	Ga0501043_0028532	Ga0501043_0028532_905_1591	227
64	3300049580	Ga0501046_0463302	Ga0501046_0463302_84_770	227
65	3300049581	Ga0501047_0524859	Ga0501047_0524859_183_869	227
66	3300049583	Ga0501067_0025635	Ga0501067_0025635_171_857	227
67	3300049585	Ga0501069_0032882	Ga0501069_0032882_2134_2820	227
68	3300049586	Ga0501070_0024271	Ga0501070_0024271_1035_1721	227
69	3300049587	Ga0501071_0116137	Ga0501071_0116137_682_1368	227
70	3300049590	Ga0501074_0058368	Ga0501074_0058368_1167_1853	227
71	3300049741	Ga0501079_0158167	Ga0501079_0158167_333_1019	227
72	3300049742	Ga0501080_0161631	Ga0501080_0161631_433_1119	227
73	3300049822	Ga0501035_0008158	Ga0501035_0008158_1321_2007	227
74	3300049823	Ga0501044_0166201	Ga0501044_0166201_141_827	227
75	3300049824	Ga0501045_0115198	Ga0501045_0115198_881_1567	227
76	3300054114	Ga0501084_0091048	Ga0501084_0091048_1035_1721	227
77	3300005344	Ga0070661_100000023	Ga0070661_10000002321	228
78	3300025920	Ga0207649_10000523	Ga0207649_1000052321	228
79	3300026088	Ga0207641_10220983	Ga0207641_102209834	228
80	3300046455	Ga0495603_0001695	Ga0495603_0001695_12177_12863	228
81	3300061734	Ga0530510_0168569	Ga0530510_0168569_420_1109	228
82	3300037466	Ga0395898_0022204	Ga0395898_0022204_2543_3235	229
83	3300039437	Ga0436365_0172502	Ga0436365_0172502_1208_1900	229
84	3300046477	Ga0495664_0452671	Ga0495664_0452671_56_745	229
85	3300005329	Ga0070683_100216610	Ga0070683_1002166102	230
86	3300009098	Ga0105245_10573677	Ga0105245_105736772	230
87	3300005327	Ga0070658_10013036	Ga0070658_100130362	232
88	3300005330	Ga0070690_100166946	Ga0070690_1001669463	232
89	3300005337	Ga0070682_100005880	Ga0070682_1000058805	232
90	3300005338	Ga0068868_100189640	Ga0068868_1001896403	232
91	3300005339	Ga0070660_100012090	Ga0070660_1000120906	232
92	3300005347	Ga0070668_100055205	Ga0070668_1000552052	232
93	3300005354	Ga0070675_100289448	Ga0070675_1002894482	232
94	3300005356	Ga0070674_100066158	Ga0070674_1000661585	232
95	3300005364	Ga0070673_100038478	Ga0070673_1000384784	232
96	3300005366	Ga0070659_100012260	Ga0070659_1000122606	232
97	3300005441	Ga0070700_100000366	Ga0070700_10000036610	232
98	3300005455	Ga0070663_100002635	Ga0070663_1000026352	232
99	3300005457	Ga0070662_100006680	Ga0070662_1000066807	232
100	3300005466	Ga0070685_10011182	Ga0070685_100111825	232
101	3300005530	Ga0070679_100263647	Ga0070679_1002636472	232
102	3300005535	Ga0070684_100224255	Ga0070684_1002242553	232
103	3300005539	Ga0068853_100033228	Ga0068853_1000332283	232
104	3300005543	Ga0070672_100053404	Ga0070672_1000534043	232
105	3300005564	Ga0070664_100090533	Ga0070664_1000905333	232
106	3300005614	Ga0068856_100350888	Ga0068856_1003508882	232
107	3300005842	Ga0068858_100040767	Ga0068858_1000407673	232
108	3300005843	Ga0068860_100531149	Ga0068860_1005311492	232
109	3300006048	Ga0075363_100043883	Ga0075363_1000438832	232
110	3300006881	Ga0068865_100112666	Ga0068865_1001126663	232
111	3300009098	Ga0105245_10077147	Ga0105245_100771471	232
112	3300009148	Ga0105243_10017722	Ga0105243_100177225	232
113	3300011119	Ga0105246_10597925	Ga0105246_105979252	232
114	3300013102	Ga0157371_10158030	Ga0157371_101580303	232
115	3300013307	Ga0157372_10135996	Ga0157372_101359963	232
116	3300013308	Ga0157375_10016397	Ga0157375_100163973	232
117	3300014745	Ga0157377_10031103	Ga0157377_100311034	232
118	3300025909	Ga0207705_10033400	Ga0207705_100334003	232
119	3300025918	Ga0207662_10071812	Ga0207662_100718123	232
120	3300025919	Ga0207657_10000307	Ga0207657_1000030735	232
121	3300025926	Ga0207659_10024803	Ga0207659_100248033	232
122	3300025932	Ga0207690_10022335	Ga0207690_100223353	232
123	3300025933	Ga0207706_10012589	Ga0207706_100125897	232
124	3300025935	Ga0207709_10009100	Ga0207709_100091005	232
125	3300025936	Ga0207670_10412613	Ga0207670_104126132	232
126	3300025937	Ga0207669_10486808	Ga0207669_104868082	232
127	3300025938	Ga0207704_10026638	Ga0207704_100266382	232
128	3300025940	Ga0207691_10031048	Ga0207691_100310486	232
129	3300025972	Ga0207668_10058307	Ga0207668_100583071	232
130	3300025981	Ga0207640_10080946	Ga0207640_100809463	232
131	3300026023	Ga0207677_10079551	Ga0207677_100795513	232
132	3300026041	Ga0207639_10144895	Ga0207639_101448951	232
133	3300026067	Ga0207678_10015271	Ga0207678_100152717	232
134	3300026075	Ga0207708_10005179	Ga0207708_1000517910	232
135	3300026089	Ga0207648_10297931	Ga0207648_102979312	232
136	3300026118	Ga0207675_100125937	Ga0207675_1001259373	232
137	3300026121	Ga0207683_10087288	Ga0207683_100872883	232
138	3300028381	Ga0268264_10545646	Ga0268264_105456461	232
139	3300048909	Ga0496106_0004435	Ga0496106_0004435_1315_2016	232
140	3300048911	Ga0496108_0005678	Ga0496108_0005678_306_1007	232
141	3300048912	Ga0496109_0001392	Ga0496109_0001392_17193_17894	232
142	3300048913	Ga0496110_0146204	Ga0496110_0146204_1059_1760	232
143	3300050492	nmdc:mga0yw44_15586_c1	nmdc:mga0yw44_15586_c1_1392_2093	232
144	3300005335	Ga0070666_10010018	Ga0070666_100100185	233
145	3300005336	Ga0070680_100499893	Ga0070680_1004998931	233
146	3300005356	Ga0070674_100000064	Ga0070674_1000000648	233
147	3300005356	Ga0070674_100047314	Ga0070674_1000473143	233
148	3300005437	Ga0070710_10120246	Ga0070710_101202462	233
149	3300005438	Ga0070701_10127902	Ga0070701_101279021	233
150	3300005439	Ga0070711_100078971	Ga0070711_1000789711	233
151	3300005543	Ga0070672_100000015	Ga0070672_10000001555	233
152	3300005544	Ga0070686_100020206	Ga0070686_1000202062	233
153	3300005549	Ga0070704_100058118	Ga0070704_1000581182	233
154	3300005718	Ga0068866_10000001	Ga0068866_10000001329	233
155	3300005841	Ga0068863_100000021	Ga0068863_100000021180	233
156	3300005843	Ga0068860_100056055	Ga0068860_1000560552	233
157	3300006042	Ga0075368_10168041	Ga0075368_101680411	233
158	3300006051	Ga0075364_10009320	Ga0075364_100093203	233
159	3300006163	Ga0070715_10000001	Ga0070715_10000001292	233
160	3300006175	Ga0070712_100008219	Ga0070712_1000082196	233
161	3300006852	Ga0075433_10031937	Ga0075433_100319372	233
162	3300006871	Ga0075434_100111975	Ga0075434_1001119752	233
163	3300007076	Ga0075435_100013269	Ga0075435_1000132693	233
164	3300009098	Ga0105245_10008108	Ga0105245_100081086	233
165	3300009147	Ga0114129_10616288	Ga0114129_106162881	233
166	3300010375	Ga0105239_10162179	Ga0105239_101621793	233
167	3300013306	Ga0163162_10790925	Ga0163162_107909252	233
168	3300014326	Ga0157380_10498645	Ga0157380_104986452	233
169	3300025898	Ga0207692_10118831	Ga0207692_101188312	233
170	3300025899	Ga0207642_10000002	Ga0207642_1000000249	233
171	3300025901	Ga0207688_10042982	Ga0207688_100429823	233
172	3300025903	Ga0207680_10014124	Ga0207680_100141243	233
173	3300025906	Ga0207699_10239546	Ga0207699_102395462	233
174	3300025915	Ga0207693_10013567	Ga0207693_100135676	233
175	3300025927	Ga0207687_10052643	Ga0207687_100526433	233
176	3300025935	Ga0207709_10107178	Ga0207709_101071782	233
177	3300025937	Ga0207669_10000018	Ga0207669_1000001898	233
178	3300025940	Ga0207691_10000044	Ga0207691_1000004479	233
179	3300026023	Ga0207677_10015101	Ga0207677_100151012	233
180	3300026078	Ga0207702_10241831	Ga0207702_102418312	233
181	3300026088	Ga0207641_10000151	Ga0207641_1000015176	233
182	3300026089	Ga0207648_10000872	Ga0207648_1000087225	233
183	3300026118	Ga0207675_100514189	Ga0207675_1005141892	233
184	3300028381	Ga0268264_10006655	Ga0268264_1000665510	233
185	3300028381	Ga0268264_10578985	Ga0268264_105789852	233
186	3300032002	Ga0307416_100289933	Ga0307416_1002899332	233
187	3300046455	Ga0495603_0226533	Ga0495603_0226533_253_957	233
188	3300046461	Ga0495641_0044663	Ga0495641_0044663_1106_1810	233
189	3300046476	Ga0495662_0000061	Ga0495662_0000061_24302_25003	233
190	3300047317	Ga0495604_0000019	Ga0495604_0000019_144638_145339	233
191	3300047321	Ga0495676_0074173	Ga0495676_0074173_1232_1936	233
192	3300048903	Ga0496100_0019348	Ga0496100_0019348_1720_2424	233
193	3300048904	Ga0496101_0002935	Ga0496101_0002935_2973_3677	233
194	3300048905	Ga0496102_0023083	Ga0496102_0023083_1390_2094	233
195	3300048906	Ga0496103_0015756	Ga0496103_0015756_1970_2674	233
196	3300048907	Ga0496104_0021896	Ga0496104_0021896_1857_2561	233
197	3300048909	Ga0496106_0006160	Ga0496106_0006160_3281_3985	233
198	3300048909	Ga0496106_0063106	Ga0496106_0063106_491_1195	233
199	3300048910	Ga0496107_0025303	Ga0496107_0025303_1389_2093	233
200	3300048910	Ga0496107_0052079	Ga0496107_0052079_1748_2452	233
201	3300048910	Ga0496107_0105665	Ga0496107_0105665_819_1520	233
202	3300048911	Ga0496108_0031506	Ga0496108_0031506_1616_2320	233
203	3300048912	Ga0496109_0130575	Ga0496109_0130575_480_1184	233
204	3300048913	Ga0496110_0539364	Ga0496110_0539364_183_887	233
205	3300048914	Ga0496111_0033844	Ga0496111_0033844_1033_1737	233
206	3300048915	Ga0496112_0123478	Ga0496112_0123478_1422_2126	233
207	3300048916	Ga0496113_0035645	Ga0496113_0035645_301_1005	233
208	3300048917	Ga0496114_0058546	Ga0496114_0058546_2318_3022	233
209	3300048918	Ga0496115_0003019	Ga0496115_0003019_9205_9909	233
210	3300049576	Ga0501040_0061348	Ga0501040_0061348_580_1284	233
211	3300049577	Ga0501041_0222215	Ga0501041_0222215_287_991	233
212	3300049578	Ga0501042_0052938	Ga0501042_0052938_837_1538	233
213	3300049578	Ga0501042_0177050	Ga0501042_0177050_54_755	233
214	3300049583	Ga0501067_0227134	Ga0501067_0227134_150_854	233
215	3300049588	Ga0501072_0071260	Ga0501072_0071260_745_1449	233
216	3300049591	Ga0501075_0004347	Ga0501075_0004347_1526_2227	233
217	3300049592	Ga0501076_0156513	Ga0501076_0156513_996_1700	233
218	3300049741	Ga0501079_0254847	Ga0501079_0254847_210_953	233
219	3300049822	Ga0501035_0364087	Ga0501035_0364087_94_798	233
220	3300049824	Ga0501045_0077981	Ga0501045_0077981_114_818	233
221	3300050491	nmdc:mga00v17_30717_c1	nmdc:mga00v17_30717_c1_1904_2608	233
222	3300050492	nmdc:mga0yw44_43572_c1	nmdc:mga0yw44_43572_c1_1781_2485	233
223	3300050495	nmdc:mga04h51_36325_c1	nmdc:mga04h51_36325_c1_111_815	233
224	3300050507	nmdc:mga05p37_448803_c1	nmdc:mga05p37_448803_c1_187_891	233
225	3300050512	nmdc:mga0n895_73788_c1	nmdc:mga0n895_73788_c1_1428_2132	233
226	3300050513	nmdc:mga0rr50_105896_c1	nmdc:mga0rr50_105896_c1_672_1376	233
227	3300050515	nmdc:mga0a205_221308_c1	nmdc:mga0a205_221308_c1_651_1355	233
228	3300053085	Ga0495619_0033354	Ga0495619_0033354_1751_2452	233
229	3300060353	Ga0501082_0125991	Ga0501082_0125991_1259_1963	233
230	3300061734	Ga0530510_0108453	Ga0530510_0108453_1137_1841	233
231	3300005327	Ga0070658_10013240	Ga0070658_100132403	234
232	3300005338	Ga0068868_100003415	Ga0068868_1000034153	234
233	3300005347	Ga0070668_100064648	Ga0070668_1000646483	234
234	3300005354	Ga0070675_100000111	Ga0070675_10000011134	234
235	3300005365	Ga0070688_100000068	Ga0070688_10000006812	234
236	3300005367	Ga0070667_100280505	Ga0070667_1002805052	234
237	3300005439	Ga0070711_100010077	Ga0070711_1000100774	234
238	3300005466	Ga0070685_10000364	Ga0070685_1000036413	234
239	3300005535	Ga0070684_100334120	Ga0070684_1003341202	234
240	3300005548	Ga0070665_100000106	Ga0070665_100000106120	234
241	3300005548	Ga0070665_100001339	Ga0070665_10000133916	234
242	3300005549	Ga0070704_100089752	Ga0070704_1000897522	234
243	3300005564	Ga0070664_100208976	Ga0070664_1002089763	234
244	3300005842	Ga0068858_100000216	Ga0068858_10000021636	234
245	3300005981	Ga0081538_10017400	Ga0081538_100174006	234
246	3300006038	Ga0075365_10464850	Ga0075365_104648501	234
247	3300006175	Ga0070712_100010232	Ga0070712_1000102323	234
248	3300009551	Ga0105238_10000011	Ga0105238_10000011124	234
249	3300013296	Ga0157374_10005775	Ga0157374_100057753	234
250	3300013297	Ga0157378_10002995	Ga0157378_1000299512	234
251	3300013297	Ga0157378_10005465	Ga0157378_100054655	234
252	3300013308	Ga0157375_10002277	Ga0157375_100022773	234
253	3300013308	Ga0157375_10016006	Ga0157375_100160065	234
254	3300014326	Ga0157380_10001196	Ga0157380_100011968	234
255	3300017792	Ga0163161_10000035	Ga0163161_10000035102	234
256	3300017792	Ga0163161_10154505	Ga0163161_101545052	234
257	3300025909	Ga0207705_10034117	Ga0207705_100341173	234
258	3300025911	Ga0207654_10210197	Ga0207654_102101972	234
259	3300025915	Ga0207693_10006565	Ga0207693_100065657	234
260	3300025920	Ga0207649_10290525	Ga0207649_102905252	234
261	3300025924	Ga0207694_10000004	Ga0207694_10000004499	234
262	3300025926	Ga0207659_10000010	Ga0207659_10000010131	234
263	3300025934	Ga0207686_10010146	Ga0207686_100101462	234
264	3300025944	Ga0207661_10000224	Ga0207661_100002243	234
265	3300025972	Ga0207668_10002989	Ga0207668_100029895	234
266	3300026035	Ga0207703_10000023	Ga0207703_10000023182	234
267	3300026041	Ga0207639_10047985	Ga0207639_100479853	234
268	3300028379	Ga0268266_10000047	Ga0268266_10000047272	234
269	3300032126	Ga0307415_100061447	Ga0307415_1000614472	234
270	3300037466	Ga0395898_0043389	Ga0395898_0043389_1956_2666	234
271	3300046454	Ga0495592_0036400	Ga0495592_0036400_38_742	234
272	3300046459	Ga0495629_0000272	Ga0495629_0000272_11871_12575	234
273	3300046463	Ga0495653_0088082	Ga0495653_0088082_750_1460	234
274	3300046473	Ga0495582_0000011	Ga0495582_0000011_50610_51314	234
275	3300046511	Ga0495608_0000583	Ga0495608_0000583_23269_23973	234
276	3300046516	Ga0495628_0008782	Ga0495628_0008782_1327_2037	234
277	3300046516	Ga0495628_0092384	Ga0495628_0092384_1089_1793	234
278	3300046517	Ga0495630_0000056	Ga0495630_0000056_60995_61699	234
279	3300046535	Ga0495586_0012117	Ga0495586_0012117_3798_4502	234
280	3300046539	Ga0495621_0001829	Ga0495621_0001829_1960_2664	234
281	3300046616	Ga0495668_0036089	Ga0495668_0036089_810_1526	234
282	3300046642	Ga0495634_0000018	Ga0495634_0000018_78816_79520	234
283	3300046675	Ga0495657_0026832	Ga0495657_0026832_2602_3312	234
284	3300046681	Ga0495647_0000008	Ga0495647_0000008_34820_35524	234
285	3300046681	Ga0495647_0000631	Ga0495647_0000631_6513_7217	234
286	3300046683	Ga0495658_0000005	Ga0495658_0000005_62036_62740	234
287	3300046690	Ga0495624_0000008	Ga0495624_0000008_76852_77556	234
288	3300046690	Ga0495624_0000267	Ga0495624_0000267_36930_37634	234
289	3300046690	Ga0495624_0008756	Ga0495624_0008756_5400_6158	234
290	3300047317	Ga0495604_0012279	Ga0495604_0012279_5045_5749	234
291	3300047322	Ga0495680_0000773	Ga0495680_0000773_151_855	234
292	3300047469	Ga0495673_0031620	Ga0495673_0031620_1498_2208	234
293	3300047673	Ga0495593_0026947	Ga0495593_0026947_2299_3003	234
294	3300048911	Ga0496108_0002109	Ga0496108_0002109_4303_5007	234
295	3300048912	Ga0496109_0000129	Ga0496109_0000129_40088_40792	234
296	3300048912	Ga0496109_0001311	Ga0496109_0001311_78_785	234
297	3300048913	Ga0496110_0322518	Ga0496110_0322518_279_983	234
298	3300049571	Ga0501034_0008403	Ga0501034_0008403_5258_5962	234
299	3300049581	Ga0501047_0680425	Ga0501047_0680425_71_775	234
300	3300049586	Ga0501070_0170835	Ga0501070_0170835_659_1363	234
301	3300049587	Ga0501071_0546959	Ga0501071_0546959_122_826	234
302	3300049823	Ga0501044_0057502	Ga0501044_0057502_137_841	234
303	3300050510	nmdc:mga06r32_609226_c1	nmdc:mga06r32_609226_c1_56_763	234
304	3300053078	Ga0495612_0011747	Ga0495612_0011747_244_948	234
305	3300053084	Ga0495595_0000103	Ga0495595_0000103_31302_32006	234
306	3300053085	Ga0495619_0000025	Ga0495619_0000025_19587_20294	234
307	3300006051	Ga0075364_10058111	Ga0075364_100581113	235
308	3300031727	Ga0316576_10001940	Ga0316576_1000194011	235
309	3300035398	Ga0316574_0046665	Ga0316574_0046665_1422_2129	235
310	3300036647	Ga0316582_0278737	Ga0316582_0278737_325_1032	235
311	3300046529	Ga0495652_0485770	Ga0495652_0485770_77_787	235
312	3300046615	Ga0495656_0002145	Ga0495656_0002145_5543_6250	235
313	3300049584	Ga0501068_0064036	Ga0501068_0064036_207_932	235
314	3300049586	Ga0501070_0700174	Ga0501070_0700174_40_753	235
315	3300050491	nmdc:mga00v17_55756_c1	nmdc:mga00v17_55756_c1_971_1678	235
316	3300050492	nmdc:mga0yw44_99150_c1	nmdc:mga0yw44_99150_c1_693_1400	235
317	3300001977	JGI24746J21847_1000158	JGI24746J21847_10001584	236
318	3300005329	Ga0070683_100100934	Ga0070683_1001009343	236
319	3300005337	Ga0070682_100368980	Ga0070682_1003689801	236
320	3300005367	Ga0070667_100097536	Ga0070667_1000975363	236
321	3300005535	Ga0070684_100013689	Ga0070684_1000136893	236
322	3300005539	Ga0068853_100055564	Ga0068853_1000555642	236
323	3300005548	Ga0070665_100089169	Ga0070665_1000891693	236
324	3300005578	Ga0068854_100005170	Ga0068854_1000051704	236
325	3300005614	Ga0068856_100013668	Ga0068856_1000136689	236
326	3300005618	Ga0068864_100000045	Ga0068864_100000045140	236
327	3300013308	Ga0157375_10001152	Ga0157375_1000115217	236
328	3300025903	Ga0207680_10101391	Ga0207680_101013911	236
329	3300025927	Ga0207687_10004954	Ga0207687_100049542	236
330	3300025944	Ga0207661_10004878	Ga0207661_100048784	236
331	3300025981	Ga0207640_10007209	Ga0207640_100072093	236
332	3300025986	Ga0207658_10079501	Ga0207658_100795011	236
333	3300026035	Ga0207703_10000152	Ga0207703_1000015232	236
334	3300026041	Ga0207639_10041767	Ga0207639_100417672	236
335	3300026095	Ga0207676_10000016	Ga0207676_1000001624	236
336	3300026121	Ga0207683_10020098	Ga0207683_100200983	236
337	3300028379	Ga0268266_10009487	Ga0268266_100094871	236
338	3300028558	Ga0265326_10000102	Ga0265326_1000010228	236
339	3300028654	Ga0265322_10000001	Ga0265322_10000001317	236
340	3300028800	Ga0265338_10125844	Ga0265338_101258442	236
341	3300029957	Ga0265324_10005914	Ga0265324_100059142	236
342	3300031238	Ga0265332_10041483	Ga0265332_100414833	236
343	3300031239	Ga0265328_10041256	Ga0265328_100412561	236
344	3300031240	Ga0265320_10000002	Ga0265320_10000002316	236
345	3300031242	Ga0265329_10005229	Ga0265329_100052293	236
346	3300031250	Ga0265331_10000751	Ga0265331_1000075121	236
347	3300031251	Ga0265327_10000011	Ga0265327_10000011316	236
348	3300031344	Ga0265316_10070161	Ga0265316_100701613	236
349	3300031711	Ga0265314_10000062	Ga0265314_1000006250	236
350	3300036401	Ga0373937_0496596	Ga0373937_0496596_80_793	236
351	3300041512	Ga0451853_2516419	Ga0451853_2516419_1738_2451	236
352	3300046459	Ga0495629_0004323	Ga0495629_0004323_7921_8637	236
353	3300046461	Ga0495641_0000044	Ga0495641_0000044_51142_51855	236
354	3300046694	Ga0495649_0001624	Ga0495649_0001624_144_857	236
355	3300047322	Ga0495680_0003005	Ga0495680_0003005_64_777	236
356	3300048913	Ga0496110_0855829	Ga0496110_0855829_63_776	236
357	3300048917	Ga0496114_0064505	Ga0496114_0064505_65_778	236
358	3300048918	Ga0496115_0002082	Ga0496115_0002082_645_1361	236
359	3300049582	Ga0501048_0359160	Ga0501048_0359160_301_1014	236
360	3300049585	Ga0501069_0229226	Ga0501069_0229226_235_966	236
361	3300049588	Ga0501072_0051631	Ga0501072_0051631_1526_2239	236
362	3300049743	Ga0501081_0487599	Ga0501081_0487599_26_739	236
363	3300053077	Ga0495601_0000326	Ga0495601_0000326_24487_25200	236
364	3300053094	Ga0500566_0001679	Ga0500566_0001679_8495_9211	236
365	3300053123	Ga0500614_000397	Ga0500614_000397_10536_11249	236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

23

216

0.96 PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

237

0.89 PF08659

KR

KR domain

24

200

0.8 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2ehd-assembly1.cif.gz_A	crystal structure analysis of oxidoreductase	0.9362	6	231
3asu-assembly1.cif.gz_B-2	crystal structure of serine dehydrogenase from escherichia coli	0.9311	8	236
3tfo-assembly1.cif.gz_D	crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti	0.928	6	232
2ehd-assembly1.cif.gz_A	crystal structure analysis of oxidoreductase	0.9275	6	231
3tfo-assembly1.cif.gz_B	crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti	0.9261	6	233

ID	Description	Score	Start	End	Superfamily
2ehdA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9362	6	231	3.40.50.720
2ehdA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9275	6	231	3.40.50.720
3tfoB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9261	6	233	3.40.50.720
af_Q2FVD5_4_231_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9255	6	232	3.40.50.720
3p19C00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9233	7	234	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A838FIT2-F1-model_v4	SDR family oxidoreductase	0.968	4	235	GO:0016020 GO:0016491
AF-A0A838PSI1-F1-model_v4	SDR family NAD(P)-dependent oxidoreductase	0.9631	50	236
AF-A0A838PSI1-F1-model_v4	SDR family NAD(P)-dependent oxidoreductase	0.9482	50	236
AF-A0A7S1EY49-F1-model_v4	Uncharacterized protein	0.9446	5	147	GO:0016020 GO:0016491
AF-A0A7S0ZS60-F1-model_v4	Uncharacterized protein	0.9374	1	137	GO:0016020 GO:0016491

Feature Viewer

pLDDT	pTM	Quality
89.06	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F423799

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00106

adh_short

short chain dehydrogenase

23

216

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

237

0.89

PF08659

KR

KR domain

24

200

0.8

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map