F423777

General Info

Members Datasets Scaffolds Average Seq Length
365 204 730 295

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0024155|Ga0466963_0024155_2359_3321
Length 320
Sequence MSDRRVLQIQQISGHPGPVPGKHTQRTDQVAKLIDTTTCIGCKACEVACVEWNDMPFQPTTFDNTYQTMPNTEWNYWNLIKFNEVQRDDGTLAWLMRKDQCMHCADPGCLRACPADGAIVQYANGIVDFQQENCIGCQFCVSGCPFNIPKFNQATKKVYKCTLCSDRVSQGLEPACIKSCPTGCLHFGTKEDMTMLAESRSAQLRANGFANAGVYDPQSVGGTHVMYVLHDATNPEAYGGLPKNPTIPLSYTIWKSVFKPVGLFVSMLGFFGVILHYVTQGPKRVHPQPPIKQIQGGNGNGREAPVLGEHKDIPQYRKEV

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.89
Metatranscriptomes 4.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 5.48
Rhizosphere 92.88
Stem 0
Stem Tuber 0
Unclassified 3.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0024155 3300044694 Bacteria 3868
2 Ga0058859_10040351 3300004798 Bacteria 3139
3 Ga0058863_11921125 3300004799 Bacteria 1396
4 Ga0058861_10047865 3300004800 Bacteria 2109
5 Ga0058860_12104142 3300004801 Bacteria 1204
6 Ga0058862_10071001 3300004803 Bacteria 1845
7 Ga0070683_100002043 3300005329 Bacteria 15891
8 Ga0070683_100120762 3300005329 Bacteria 2475
9 Ga0070683_100153671 3300005329 Bacteria 2182
10 Ga0070690_100008102 3300005330 Bacteria 6036
11 Ga0070690_100171543 3300005330 Bacteria 1493
12 Ga0070670_100013705 3300005331 Bacteria 6948
13 Ga0070666_10010547 3300005335 Bacteria 5780
14 Ga0070666_10019218 3300005335 Bacteria 4407
15 Ga0070680_100095328 3300005336 Unclassified 2467
16 Ga0070680_100203904 3300005336 Bacteria 1668
17 Ga0070689_100406555 3300005340 Bacteria 1152
18 Ga0070692_10067615 3300005345 Bacteria 1897
19 Ga0070692_10068018 3300005345 Bacteria 1892
20 Ga0070669_100004430 3300005353 Bacteria 10126
21 Ga0070669_100221976 3300005353 Bacteria 1494
22 Ga0070675_100072936 3300005354 Bacteria 2850
23 Ga0070675_100177377 3300005354 Bacteria 1841
24 Ga0070671_100011670 3300005355 Bacteria 7066
25 Ga0070674_100033720 3300005356 Bacteria 3411
26 Ga0070673_100004169 3300005364 Bacteria 9112
27 Ga0070667_100061754 3300005367 Bacteria 3173
28 Ga0070709_10000232 3300005434 Bacteria 36020
29 Ga0070709_10122383 3300005434 Bacteria 1765
30 Ga0070709_10219422 3300005434 Bacteria 1355
31 Ga0070714_100002934 3300005435 Bacteria 12627
32 Ga0070714_100012413 3300005435 Bacteria 6801
33 Ga0070714_100037032 3300005435 Bacteria 4097
34 Ga0070713_100005782 3300005436 Bacteria 8500
35 Ga0070713_100043254 3300005436 Bacteria 3681
36 Ga0070713_100118445 3300005436 Bacteria 2319
37 Ga0070713_100127064 3300005436 Bacteria 2244
38 Ga0070713_100154157 3300005436 Bacteria 2046
39 Ga0070713_100207984 3300005436 Bacteria 1770
40 Ga0070713_100253297 3300005436 Bacteria 1606
41 Ga0070710_10010292 3300005437 Bacteria 4593
42 Ga0070710_10095204 3300005437 Bacteria 1763
43 Ga0070711_100000007 3300005439 Bacteria 182651
44 Ga0070711_100000291 3300005439 Bacteria 26041
45 Ga0070711_100017867 3300005439 Bacteria 4520
46 Ga0070711_100056030 3300005439 Bacteria 2725
47 Ga0070711_100064972 3300005439 Bacteria 2550
48 Ga0070711_100125183 3300005439 Unclassified 1907
49 Ga0070705_100108718 3300005440 Unclassified 1767
50 Ga0070694_100043845 3300005444 Bacteria 2993
51 Ga0070708_100011616 3300005445 Bacteria 7167
52 Ga0070708_100014264 3300005445 Bacteria 6531
53 Ga0070708_100030487 3300005445 Bacteria 4661
54 Ga0070708_100110234 3300005445 Bacteria 2529
55 Ga0070663_100051847 3300005455 Bacteria 2925
56 Ga0070681_10074784 3300005458 Bacteria 3348
57 Ga0070681_10160986 3300005458 Bacteria 2168
58 Ga0070681_10186104 3300005458 Bacteria 1997
59 Ga0070681_10204888 3300005458 Bacteria 1890
60 Ga0070685_10030737 3300005466 Bacteria 2995
61 Ga0070706_100034614 3300005467 Bacteria 4666
62 Ga0070706_100058529 3300005467 Bacteria 3556
63 Ga0070706_100069453 3300005467 Bacteria 3258
64 Ga0070706_100072596 3300005467 Bacteria 3184
65 Ga0070706_100103508 3300005467 Bacteria 2647
66 Ga0070706_100409103 3300005467 Bacteria 1263
67 Ga0070707_100017804 3300005468 Bacteria 6679
68 Ga0070707_100070204 3300005468 Bacteria 3374
69 Ga0070707_100641251 3300005468 Bacteria 1025
70 Ga0070698_100046030 3300005471 Bacteria 4462
71 Ga0070698_100127241 3300005471 Unclassified 2505
72 Ga0070699_100015328 3300005518 Bacteria 6587
73 Ga0070699_100031942 3300005518 Bacteria 4546
74 Ga0070699_100120613 3300005518 Bacteria 2305
75 Ga0070679_100048233 3300005530 Bacteria 4244
76 Ga0070684_100001401 3300005535 Bacteria 17347
77 Ga0070684_100148645 3300005535 Bacteria 2121
78 Ga0070684_100224368 3300005535 Bacteria 1715
79 Ga0070697_100004333 3300005536 Bacteria 10887
80 Ga0070697_100054296 3300005536 Bacteria 3257
81 Ga0070697_100070752 3300005536 Bacteria 2861
82 Ga0068853_100045846 3300005539 Bacteria 3746
83 Ga0068853_100155471 3300005539 Bacteria 2060
84 Ga0070672_100268798 3300005543 Bacteria 1439
85 Ga0070686_100003149 3300005544 Bacteria 9036
86 Ga0070695_100163588 3300005545 Bacteria 1564
87 Ga0070665_100000292 3300005548 Bacteria 79257
88 Ga0070704_100007899 3300005549 Bacteria 6349
89 Ga0068855_100165481 3300005563 Bacteria 2507
90 Ga0070664_100033545 3300005564 Bacteria 4301
91 Ga0068854_100090252 3300005578 Bacteria 2278
92 Ga0068852_100072118 3300005616 Bacteria 3034
93 Ga0068864_100167994 3300005618 Bacteria 1998
94 Ga0068864_100174998 3300005618 Bacteria 1959
95 Ga0068864_100207856 3300005618 Bacteria 1801
96 Ga0068863_100429279 3300005841 Bacteria 1295
97 Ga0081455_10018703 3300005937 Bacteria 6578
98 Ga0070717_10002115 3300006028 Bacteria 13932
99 Ga0070717_10003600 3300006028 Bacteria 11114
100 Ga0070717_10037405 3300006028 Bacteria 3941
101 Ga0070717_10167815 3300006028 Unclassified 1907
102 Ga0070717_10175639 3300006028 Bacteria 1865
103 Ga0070717_10184052 3300006028 Bacteria 1822
104 Ga0070717_10188657 3300006028 Bacteria 1800
105 Ga0070717_10506565 3300006028 Bacteria 1091
106 Ga0070715_10171138 3300006163 Bacteria 1082
107 Ga0070716_100001531 3300006173 Bacteria 10353
108 Ga0070716_100035919 3300006173 Bacteria 2728
109 Ga0070716_100055408 3300006173 Bacteria 2269
110 Ga0070712_100000183 3300006175 Bacteria 34712
111 Ga0070712_100003994 3300006175 Bacteria 9067
112 Ga0070712_100028426 3300006175 Bacteria 3740
113 Ga0075428_100032675 3300006844 Bacteria 5747
114 Ga0075431_100132896 3300006847 Bacteria 2566
115 Ga0075431_100194465 3300006847 Bacteria 2077
116 Ga0075433_10003446 3300006852 Bacteria 12201
117 Ga0075433_10086211 3300006852 Bacteria 2773
118 Ga0075434_100047546 3300006871 Bacteria 4258
119 Ga0075434_100384654 3300006871 Bacteria 1424
120 Ga0075436_100011247 3300006914 Bacteria 6138
121 Ga0075436_100173702 3300006914 Bacteria 1521
122 Ga0075436_100221214 3300006914 Bacteria 1343
123 Ga0075435_100003128 3300007076 Bacteria 11179
124 Ga0075435_100014738 3300007076 Bacteria 5858
125 Ga0075435_100172741 3300007076 Bacteria 1824
126 Ga0099794_10058147 3300007265 Bacteria 1874
127 Ga0105240_10308914 3300009093 Bacteria 1806
128 Ga0105240_10439284 3300009093 Bacteria 1462
129 Ga0111539_10085712 3300009094 Bacteria 3702
130 Ga0111539_10383751 3300009094 Bacteria 1636
131 Ga0111539_10747856 3300009094 Bacteria 1138
132 Ga0105247_10031585 3300009101 Bacteria 3215
133 Ga0114129_10038528 3300009147 Bacteria 6742
134 Ga0114129_10119026 3300009147 Bacteria 3638
135 Ga0105241_10190533 3300009174 Bacteria 1707
136 Ga0105241_10268436 3300009174 Bacteria 1453
137 Ga0105242_10002118 3300009176 Bacteria 15657
138 Ga0105248_10049170 3300009177 Bacteria 4730
139 Ga0105248_10081248 3300009177 Bacteria 3643
140 Ga0105237_10224154 3300009545 Bacteria 1880
141 Ga0105238_10146933 3300009551 Bacteria 2334
142 Ga0105249_10003049 3300009553 Bacteria 14457
143 Ga0099796_10052618 3300010159 Bacteria 1418
144 Ga0105239_10240457 3300010375 Unclassified 2032
145 Ga0105246_10109238 3300011119 Bacteria 2029
146 Ga0157369_10061042 3300013105 Bacteria 4065
147 Ga0157369_10359569 3300013105 Bacteria 1512
148 Ga0157374_10260075 3300013296 Bacteria 1709
149 Ga0157378_10057296 3300013297 Bacteria 3472
150 Ga0163162_10010074 3300013306 Bacteria 9188
151 Ga0163162_10415736 3300013306 Bacteria 1477
152 Ga0157372_10100163 3300013307 Bacteria 3306
153 Ga0157375_10341070 3300013308 Bacteria 1664
154 Ga0157375_10890721 3300013308 Bacteria 1034
155 Ga0157375_10949486 3300013308 Bacteria 1002
156 Ga0163163_10045870 3300014325 Bacteria 4291
157 Ga0163163_10101111 3300014325 Bacteria 2905
158 Ga0157380_10466056 3300014326 Bacteria 1218
159 Ga0206356_10475994 3300020070 Bacteria 1320
160 Ga0207697_10010817 3300025315 Bacteria 3882
161 Ga0207692_10053770 3300025898 Bacteria 2052
162 Ga0207692_10073327 3300025898 Bacteria 1811
163 Ga0207688_10105205 3300025901 Bacteria 1633
164 Ga0207680_10006007 3300025903 Bacteria 5841
165 Ga0207685_10018761 3300025905 Bacteria 2265
166 Ga0207685_10159460 3300025905 Bacteria 1029
167 Ga0207699_10000009 3300025906 Bacteria 323355
168 Ga0207699_10000270 3300025906 Bacteria 28509
169 Ga0207699_10029130 3300025906 Bacteria 3076
170 Ga0207699_10038768 3300025906 Bacteria 2734
171 Ga0207699_10274145 3300025906 Bacteria 1170
172 Ga0207699_10365499 3300025906 Unclassified 1021
173 Ga0207684_10049782 3300025910 Bacteria 3554
174 Ga0207684_10071804 3300025910 Bacteria 2941
175 Ga0207684_10136325 3300025910 Bacteria 2108
176 Ga0207684_10230796 3300025910 Bacteria 1597
177 Ga0207654_10106352 3300025911 Unclassified 1737
178 Ga0207654_10175608 3300025911 Bacteria 1394
179 Ga0207707_10024605 3300025912 Bacteria 5270
180 Ga0207707_10146539 3300025912 Bacteria 2064
181 Ga0207707_10294414 3300025912 Bacteria 1404
182 Ga0207707_10348102 3300025912 Bacteria 1277
183 Ga0207695_10123600 3300025913 Bacteria 2553
184 Ga0207695_10231779 3300025913 Bacteria 1751
185 Ga0207693_10000011 3300025915 Bacteria 160684
186 Ga0207693_10000016 3300025915 Bacteria 145892
187 Ga0207693_10017218 3300025915 Bacteria 5763
188 Ga0207663_10000001 3300025916 Bacteria 591990
189 Ga0207663_10003308 3300025916 Bacteria 7863
190 Ga0207663_10050208 3300025916 Bacteria 2591
191 Ga0207663_10056849 3300025916 Bacteria 2463
192 Ga0207663_10077237 3300025916 Bacteria 2167
193 Ga0207663_10108864 3300025916 Bacteria 1877
194 Ga0207660_10061631 3300025917 Bacteria 2700
195 Ga0207660_10265683 3300025917 Bacteria 1358
196 Ga0207662_10065355 3300025918 Bacteria 2190
197 Ga0207652_10041214 3300025921 Bacteria 3924
198 Ga0207646_10092617 3300025922 Bacteria 2706
199 Ga0207646_10133121 3300025922 Bacteria 2238
200 Ga0207646_10248742 3300025922 Bacteria 1606
201 Ga0207681_10054456 3300025923 Bacteria 2720
202 Ga0207650_10076032 3300025925 Bacteria 2536
203 Ga0207659_10092756 3300025926 Bacteria 2258
204 Ga0207700_10000359 3300025928 Bacteria 26508
205 Ga0207700_10002290 3300025928 Bacteria 10983
206 Ga0207700_10014721 3300025928 Bacteria 5135
207 Ga0207700_10015253 3300025928 Bacteria 5060
208 Ga0207700_10025073 3300025928 Bacteria 4135
209 Ga0207700_10031422 3300025928 Bacteria 3772
210 Ga0207700_10032242 3300025928 Bacteria 3735
211 Ga0207700_10082446 3300025928 Bacteria 2515
212 Ga0207700_10096227 3300025928 Bacteria 2350
213 Ga0207700_10103639 3300025928 Bacteria 2275
214 Ga0207700_10110574 3300025928 Bacteria 2210
215 Ga0207664_10000337 3300025929 Bacteria 34549
216 Ga0207664_10040153 3300025929 Bacteria 3636
217 Ga0207664_10045922 3300025929 Bacteria 3427
218 Ga0207664_10078935 3300025929 Bacteria 2671
219 Ga0207664_10433747 3300025929 Bacteria 1171
220 Ga0207706_10092826 3300025933 Bacteria 2654
221 Ga0207686_10008427 3300025934 Bacteria 5565
222 Ga0207709_10092460 3300025935 Bacteria 1980
223 Ga0207665_10012066 3300025939 Bacteria 5673
224 Ga0207665_10013300 3300025939 Bacteria 5410
225 Ga0207665_10080729 3300025939 Bacteria 2238
226 Ga0207711_10150662 3300025941 Bacteria 2098
227 Ga0207661_10001049 3300025944 Bacteria 18344
228 Ga0207661_10093121 3300025944 Bacteria 2514
229 Ga0207679_10008519 3300025945 Bacteria 6532
230 Ga0207667_10086977 3300025949 Bacteria 3233
231 Ga0207651_10030598 3300025960 Bacteria 3430
232 Ga0207640_10207921 3300025981 Bacteria 1488
233 Ga0207677_10044370 3300026023 Bacteria 2962
234 Ga0207677_10395178 3300026023 Bacteria 1171
235 Ga0207639_10045151 3300026041 Bacteria 3318
236 Ga0207648_10554606 3300026089 Bacteria 1056
237 Ga0207676_10160749 3300026095 Bacteria 1946
238 Ga0207674_10327001 3300026116 Bacteria 1483
239 Ga0207683_10292501 3300026121 Bacteria 1489
240 Ga0207698_10014678 3300026142 Bacteria 5216
241 Ga0207428_10245435 3300027907 Bacteria 1337
242 Ga0268266_10000885 3300028379 Bacteria 38797
243 Ga0268265_10054178 3300028380 Bacteria 3042
244 Ga0265338_10018083 3300028800 Bacteria 7563
245 Ga0265338_10045212 3300028800 Unclassified 4052
246 Ga0265338_10106875 3300028800 Bacteria 2264
247 Ga0265765_1007365 3300030879 Bacteria 1184
248 Ga0265760_10002897 3300031090 Bacteria 5013
249 Ga0265325_10003113 3300031241 Bacteria 10945
250 Ga0265339_10008076 3300031249 Bacteria 6725
251 Ga0265339_10015458 3300031249 Bacteria 4574
252 Ga0265316_10026401 3300031344 Bacteria 4832
253 Ga0307508_10019279 3300031616 Bacteria 6203
254 Ga0373926_0023135 3300035083 Bacteria 2157
255 Ga0373926_0056645 3300035083 Bacteria 1423
256 Ga0373934_0111570 3300035086 Bacteria 1109
257 Ga0373923_0081727 3300035111 Bacteria 1402
258 Ga0373936_0005619 3300035113 Bacteria 4728
259 Ga0373945_0004530 3300035116 Bacteria 4416
260 Ga0373953_0008454 3300035117 Bacteria 3497
261 Ga0373956_0034795 3300035119 Bacteria 2219
262 Ga0373943_0002399 3300035170 Bacteria 8492
263 Ga0373943_0122513 3300035170 Bacteria 1383
264 Ga0373946_0007930 3300035171 Bacteria 3898
265 Ga0373955_0244831 3300035172 Unclassified 1074
266 Ga0373924_0010784 3300035410 Bacteria 3382
267 Ga0373935_0001166 3300035692 Bacteria 14432
268 Ga0373935_0016094 3300035692 Bacteria 4525
269 Ga0373935_0026329 3300035692 Bacteria 3588
270 Ga0373935_0039617 3300035692 Bacteria 2954
271 Ga0373927_0012695 3300035695 Bacteria 5602
272 Ga0373933_0021206 3300035724 Bacteria 3688
273 Ga0373947_0000576 3300035725 Bacteria 21462
274 Ga0373947_0017176 3300035725 Bacteria 4161
275 Ga0373937_0000094 3300036401 Bacteria 82254
276 Ga0373937_0003107 3300036401 Bacteria 13885
277 Ga0373937_0123475 3300036401 Bacteria 2414
278 Ga0373937_0127212 3300036401 Unclassified 2378
279 Ga0373937_0345214 3300036401 Bacteria 1410
280 Ga0373925_0004973 3300037068 Bacteria 9981
281 Ga0373925_0008993 3300037068 Bacteria 7277
282 Ga0373925_0013897 3300037068 Bacteria 5827
283 Ga0373925_0028723 3300037068 Bacteria 4076
284 Ga0373925_0371736 3300037068 Bacteria 1163
285 Ga0436362_0262179 3300039453 Bacteria 5794
286 Ga0436362_0464898 3300039453 Bacteria 1640
287 Ga0451576_0074804 3300045051 Bacteria 3524
288 Ga0466967_0022260 3300045976 Bacteria 5167
289 Ga0495603_0171142 3300046455 Bacteria 1258
290 Ga0495629_0004647 3300046459 Bacteria 10281
291 Ga0495580_0000774 3300046472 Bacteria 27522
292 Ga0495580_0000873 3300046472 Bacteria 26074
293 Ga0495580_0127992 3300046472 Bacteria 1763
294 Ga0495582_0001668 3300046473 Bacteria 12525
295 Ga0495639_0012491 3300046475 Bacteria 3663
296 Ga0495664_0015780 3300046477 Bacteria 4299
297 Ga0495608_0084044 3300046511 Bacteria 2066
298 Ga0495628_0093886 3300046516 Bacteria 2320
299 Ga0495630_0065229 3300046517 Bacteria 2736
300 Ga0495630_0143094 3300046517 Bacteria 1818
301 Ga0495652_0317288 3300046529 Unclassified 1127
302 Ga0495635_0129097 3300046663 Bacteria 1723
303 Ga0495588_0202003 3300046674 Bacteria 1050
304 Ga0495658_0061107 3300046683 Bacteria 2162
305 Ga0495669_0008319 3300046684 Unclassified 4359
306 Ga0495624_0065614 3300046690 Bacteria 2267
307 Ga0495636_0076891 3300047318 Bacteria 1432
308 Ga0495674_0010001 3300047319 Bacteria 8987
309 Ga0495680_0090079 3300047322 Bacteria 2302
310 Ga0495683_0096829 3300047323 Bacteria 1423
311 Ga0495593_0053368 3300047673 Bacteria 2134
312 Ga0495602_0207944 3300048088 Bacteria 1488
313 Ga0496102_0418499 3300048905 Bacteria 1259
314 Ga0496104_0003243 3300048907 Bacteria 14015
315 Ga0496104_0517023 3300048907 Bacteria 1105
316 Ga0496104_0519894 3300048907 Bacteria 1101
317 Ga0496105_0000394 3300048908 Bacteria 28691
318 Ga0496105_0111867 3300048908 Bacteria 2253
319 Ga0496105_0112793 3300048908 Bacteria 2244
320 Ga0496106_0246334 3300048909 Bacteria 1428
321 Ga0496108_0002229 3300048911 Bacteria 15527
322 Ga0496109_0015620 3300048912 Bacteria 6622
323 Ga0496110_0058183 3300048913 Bacteria 3404
324 Ga0496111_0393359 3300048914 Bacteria 1024
325 Ga0496112_0009420 3300048915 Bacteria 8799
326 Ga0496112_0025895 3300048915 Bacteria 5637
327 Ga0496112_0103022 3300048915 Bacteria 2824
328 Ga0496112_0136556 3300048915 Bacteria 2422
329 Ga0496112_0250823 3300048915 Bacteria 1721
330 Ga0496112_0435125 3300048915 Bacteria 1250
331 Ga0496114_0000064 3300048917 Bacteria 83513
332 Ga0496115_0228191 3300048918 Bacteria 1536
333 Ga0501068_0191519 3300049584 Bacteria 1295
334 Ga0501077_0000071 3300049593 Bacteria 50853
335 nmdc:mga0k408_256737_c1 3300050493 Bacteria 1043
336 nmdc:mga05p37_22920_c1 3300050507 Bacteria 7573
337 nmdc:mga05p37_339198_c1 3300050507 Bacteria 1773
338 nmdc:mga06r32_155230_c1 3300050510 Bacteria 2270
339 nmdc:mga08y16_135807_c1 3300050511 Bacteria 2556
340 nmdc:mga08y16_35825_c1 3300050511 Bacteria 5212
341 nmdc:mga08y16_81559_c1 3300050511 Bacteria 3372
342 nmdc:mga0n895_220216_c1 3300050512 Bacteria 1927
343 nmdc:mga0n895_315164_c1 3300050512 Bacteria 1585
344 nmdc:mga0n895_325580_c1 3300050512 Bacteria 1557
345 nmdc:mga0n895_63526_c1 3300050512 Bacteria 3651
346 nmdc:mga0rr50_106622_c1 3300050513 Bacteria 2211
347 nmdc:mga0rr50_112122_c1 3300050513 Bacteria 2160
348 nmdc:mga0rr50_5096_c1 3300050513 Bacteria 7794
349 nmdc:mga08x19_14615_c1 3300050514 Bacteria 4764
350 nmdc:mga08x19_28_c1 3300050514 Bacteria 224933
351 nmdc:mga0a205_153491_c1 3300050515 Bacteria 2201
352 nmdc:mga0a205_37995_c1 3300050515 Bacteria 4631
353 nmdc:mga0a205_8672_c2 3300050515 Bacteria 7842
354 Ga0495601_0059181 3300053077 Bacteria 2429
355 Ga0495601_0185288 3300053077 Bacteria 1361
356 Ga0500555_002074 3300053103 Bacteria 5892
357 Ga0500645_001622 3300053730 Bacteria 11134
358 Ga0587084_010277 3300059477 Bacteria 1224
359 Ga0587093_007798 3300059478 Bacteria 1203
360 Ga0587066_004132 3300059490 Bacteria 1761
361 Ga0587091_005180 3300059511 Bacteria 1759
362 Ga0587094_019600 3300059513 Bacteria 972
363 Ga0587117_009698 3300059627 Bacteria 1158
364 Ga0587067_014611 3300059640 Bacteria 1261
365 Ga0501082_0000703 3300060353 Bacteria 29422
366 Ga0466963_0024155
367 Ga0058859_10040351
368 Ga0058863_11921125
369 Ga0058861_10047865
370 Ga0058860_12104142
371 Ga0058862_10071001
372 Ga0070683_100002043
373 Ga0070683_100120762
374 Ga0070683_100153671
375 Ga0070690_100008102
376 Ga0070690_100171543
377 Ga0070670_100013705
378 Ga0070666_10010547
379 Ga0070666_10019218
380 Ga0070680_100095328
381 Ga0070680_100203904
382 Ga0070689_100406555
383 Ga0070692_10067615
384 Ga0070692_10068018
385 Ga0070669_100004430
386 Ga0070669_100221976
387 Ga0070675_100072936
388 Ga0070675_100177377
389 Ga0070671_100011670
390 Ga0070674_100033720
391 Ga0070673_100004169
392 Ga0070667_100061754
393 Ga0070709_10000232
394 Ga0070709_10122383
395 Ga0070709_10219422
396 Ga0070714_100002934
397 Ga0070714_100012413
398 Ga0070714_100037032
399 Ga0070713_100005782
400 Ga0070713_100043254
401 Ga0070713_100118445
402 Ga0070713_100127064
403 Ga0070713_100154157
404 Ga0070713_100207984
405 Ga0070713_100253297
406 Ga0070710_10010292
407 Ga0070710_10095204
408 Ga0070711_100000007
409 Ga0070711_100000291
410 Ga0070711_100017867
411 Ga0070711_100056030
412 Ga0070711_100064972
413 Ga0070711_100125183
414 Ga0070705_100108718
415 Ga0070694_100043845
416 Ga0070708_100011616
417 Ga0070708_100014264
418 Ga0070708_100030487
419 Ga0070708_100110234
420 Ga0070663_100051847
421 Ga0070681_10074784
422 Ga0070681_10160986
423 Ga0070681_10186104
424 Ga0070681_10204888
425 Ga0070685_10030737
426 Ga0070706_100034614
427 Ga0070706_100058529
428 Ga0070706_100069453
429 Ga0070706_100072596
430 Ga0070706_100103508
431 Ga0070706_100409103
432 Ga0070707_100017804
433 Ga0070707_100070204
434 Ga0070707_100641251
435 Ga0070698_100046030
436 Ga0070698_100127241
437 Ga0070699_100015328
438 Ga0070699_100031942
439 Ga0070699_100120613
440 Ga0070679_100048233
441 Ga0070684_100001401
442 Ga0070684_100148645
443 Ga0070684_100224368
444 Ga0070697_100004333
445 Ga0070697_100054296
446 Ga0070697_100070752
447 Ga0068853_100045846
448 Ga0068853_100155471
449 Ga0070672_100268798
450 Ga0070686_100003149
451 Ga0070695_100163588
452 Ga0070665_100000292
453 Ga0070704_100007899
454 Ga0068855_100165481
455 Ga0070664_100033545
456 Ga0068854_100090252
457 Ga0068852_100072118
458 Ga0068864_100167994
459 Ga0068864_100174998
460 Ga0068864_100207856
461 Ga0068863_100429279
462 Ga0081455_10018703
463 Ga0070717_10002115
464 Ga0070717_10003600
465 Ga0070717_10037405
466 Ga0070717_10167815
467 Ga0070717_10175639
468 Ga0070717_10184052
469 Ga0070717_10188657
470 Ga0070717_10506565
471 Ga0070715_10171138
472 Ga0070716_100001531
473 Ga0070716_100035919
474 Ga0070716_100055408
475 Ga0070712_100000183
476 Ga0070712_100003994
477 Ga0070712_100028426
478 Ga0075428_100032675
479 Ga0075431_100132896
480 Ga0075431_100194465
481 Ga0075433_10003446
482 Ga0075433_10086211
483 Ga0075434_100047546
484 Ga0075434_100384654
485 Ga0075436_100011247
486 Ga0075436_100173702
487 Ga0075436_100221214
488 Ga0075435_100003128
489 Ga0075435_100014738
490 Ga0075435_100172741
491 Ga0099794_10058147
492 Ga0105240_10308914
493 Ga0105240_10439284
494 Ga0111539_10085712
495 Ga0111539_10383751
496 Ga0111539_10747856
497 Ga0105247_10031585
498 Ga0114129_10038528
499 Ga0114129_10119026
500 Ga0105241_10190533
501 Ga0105241_10268436
502 Ga0105242_10002118
503 Ga0105248_10049170
504 Ga0105248_10081248
505 Ga0105237_10224154
506 Ga0105238_10146933
507 Ga0105249_10003049
508 Ga0099796_10052618
509 Ga0105239_10240457
510 Ga0105246_10109238
511 Ga0157369_10061042
512 Ga0157369_10359569
513 Ga0157374_10260075
514 Ga0157378_10057296
515 Ga0163162_10010074
516 Ga0163162_10415736
517 Ga0157372_10100163
518 Ga0157375_10341070
519 Ga0157375_10890721
520 Ga0157375_10949486
521 Ga0163163_10045870
522 Ga0163163_10101111
523 Ga0157380_10466056
524 Ga0206356_10475994
525 Ga0207697_10010817
526 Ga0207692_10053770
527 Ga0207692_10073327
528 Ga0207688_10105205
529 Ga0207680_10006007
530 Ga0207685_10018761
531 Ga0207685_10159460
532 Ga0207699_10000009
533 Ga0207699_10000270
534 Ga0207699_10029130
535 Ga0207699_10038768
536 Ga0207699_10274145
537 Ga0207699_10365499
538 Ga0207684_10049782
539 Ga0207684_10071804
540 Ga0207684_10136325
541 Ga0207684_10230796
542 Ga0207654_10106352
543 Ga0207654_10175608
544 Ga0207707_10024605
545 Ga0207707_10146539
546 Ga0207707_10294414
547 Ga0207707_10348102
548 Ga0207695_10123600
549 Ga0207695_10231779
550 Ga0207693_10000011
551 Ga0207693_10000016
552 Ga0207693_10017218
553 Ga0207663_10000001
554 Ga0207663_10003308
555 Ga0207663_10050208
556 Ga0207663_10056849
557 Ga0207663_10077237
558 Ga0207663_10108864
559 Ga0207660_10061631
560 Ga0207660_10265683
561 Ga0207662_10065355
562 Ga0207652_10041214
563 Ga0207646_10092617
564 Ga0207646_10133121
565 Ga0207646_10248742
566 Ga0207681_10054456
567 Ga0207650_10076032
568 Ga0207659_10092756
569 Ga0207700_10000359
570 Ga0207700_10002290
571 Ga0207700_10014721
572 Ga0207700_10015253
573 Ga0207700_10025073
574 Ga0207700_10031422
575 Ga0207700_10032242
576 Ga0207700_10082446
577 Ga0207700_10096227
578 Ga0207700_10103639
579 Ga0207700_10110574
580 Ga0207664_10000337
581 Ga0207664_10040153
582 Ga0207664_10045922
583 Ga0207664_10078935
584 Ga0207664_10433747
585 Ga0207706_10092826
586 Ga0207686_10008427
587 Ga0207709_10092460
588 Ga0207665_10012066
589 Ga0207665_10013300
590 Ga0207665_10080729
591 Ga0207711_10150662
592 Ga0207661_10001049
593 Ga0207661_10093121
594 Ga0207679_10008519
595 Ga0207667_10086977
596 Ga0207651_10030598
597 Ga0207640_10207921
598 Ga0207677_10044370
599 Ga0207677_10395178
600 Ga0207639_10045151
601 Ga0207648_10554606
602 Ga0207676_10160749
603 Ga0207674_10327001
604 Ga0207683_10292501
605 Ga0207698_10014678
606 Ga0207428_10245435
607 Ga0268266_10000885
608 Ga0268265_10054178
609 Ga0265338_10018083
610 Ga0265338_10045212
611 Ga0265338_10106875
612 Ga0265765_1007365
613 Ga0265760_10002897
614 Ga0265325_10003113
615 Ga0265339_10008076
616 Ga0265339_10015458
617 Ga0265316_10026401
618 Ga0307508_10019279
619 Ga0373926_0023135
620 Ga0373926_0056645
621 Ga0373934_0111570
622 Ga0373923_0081727
623 Ga0373936_0005619
624 Ga0373945_0004530
625 Ga0373953_0008454
626 Ga0373956_0034795
627 Ga0373943_0002399
628 Ga0373943_0122513
629 Ga0373946_0007930
630 Ga0373955_0244831
631 Ga0373924_0010784
632 Ga0373935_0001166
633 Ga0373935_0016094
634 Ga0373935_0026329
635 Ga0373935_0039617
636 Ga0373927_0012695
637 Ga0373933_0021206
638 Ga0373947_0000576
639 Ga0373947_0017176
640 Ga0373937_0000094
641 Ga0373937_0003107
642 Ga0373937_0123475
643 Ga0373937_0127212
644 Ga0373937_0345214
645 Ga0373925_0004973
646 Ga0373925_0008993
647 Ga0373925_0013897
648 Ga0373925_0028723
649 Ga0373925_0371736
650 Ga0436362_0262179
651 Ga0436362_0464898
652 Ga0451576_0074804
653 Ga0466967_0022260
654 Ga0495603_0171142
655 Ga0495629_0004647
656 Ga0495580_0000774
657 Ga0495580_0000873
658 Ga0495580_0127992
659 Ga0495582_0001668
660 Ga0495639_0012491
661 Ga0495664_0015780
662 Ga0495608_0084044
663 Ga0495628_0093886
664 Ga0495630_0065229
665 Ga0495630_0143094
666 Ga0495652_0317288
667 Ga0495635_0129097
668 Ga0495588_0202003
669 Ga0495658_0061107
670 Ga0495669_0008319
671 Ga0495624_0065614
672 Ga0495636_0076891
673 Ga0495674_0010001
674 Ga0495680_0090079
675 Ga0495683_0096829
676 Ga0495593_0053368
677 Ga0495602_0207944
678 Ga0496102_0418499
679 Ga0496104_0003243
680 Ga0496104_0517023
681 Ga0496104_0519894
682 Ga0496105_0000394
683 Ga0496105_0111867
684 Ga0496105_0112793
685 Ga0496106_0246334
686 Ga0496108_0002229
687 Ga0496109_0015620
688 Ga0496110_0058183
689 Ga0496111_0393359
690 Ga0496112_0009420
691 Ga0496112_0025895
692 Ga0496112_0103022
693 Ga0496112_0136556
694 Ga0496112_0250823
695 Ga0496112_0435125
696 Ga0496114_0000064
697 Ga0496115_0228191
698 Ga0501068_0191519
699 Ga0501077_0000071
700 nmdc:mga0k408_256737_c1
701 nmdc:mga05p37_22920_c1
702 nmdc:mga05p37_339198_c1
703 nmdc:mga06r32_155230_c1
704 nmdc:mga08y16_135807_c1
705 nmdc:mga08y16_35825_c1
706 nmdc:mga08y16_81559_c1
707 nmdc:mga0n895_220216_c1
708 nmdc:mga0n895_315164_c1
709 nmdc:mga0n895_325580_c1
710 nmdc:mga0n895_63526_c1
711 nmdc:mga0rr50_106622_c1
712 nmdc:mga0rr50_112122_c1
713 nmdc:mga0rr50_5096_c1
714 nmdc:mga08x19_14615_c1
715 nmdc:mga08x19_28_c1
716 nmdc:mga0a205_153491_c1
717 nmdc:mga0a205_37995_c1
718 nmdc:mga0a205_8672_c2
719 Ga0495601_0059181
720 Ga0495601_0185288
721 Ga0500555_002074
722 Ga0500645_001622
723 Ga0587084_010277
724 Ga0587093_007798
725 Ga0587066_004132
726 Ga0587091_005180
727 Ga0587094_019600
728 Ga0587117_009698
729 Ga0587067_014611
730 Ga0501082_0000703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12838

Fer4_7

4Fe-4S dicluster domain

38

117

0.96

PF13247

Fer4_11

4Fe-4S dicluster domain

92

190

0.95

PF09163

Form-deh_trans

Formate dehydrogenase N, transmembrane

247

290

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kqf-assembly1.cif.gz_B formate dehydrogenase n from e. coli 0.8473 6 290
1kqf-assembly1.cif.gz_B formate dehydrogenase n from e. coli 0.8337 6 290
8bqk-assembly1.cif.gz_B w-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 22 min 0.8259 29 238
1h0h-assembly2.cif.gz_L tungsten containing formate dehydrogenase from desulfovibrio gigas 0.8121 28 238
8bqk-assembly1.cif.gz_B w-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 22 min 0.798 29 238
ID Description Score Start End Superfamily
1kqgB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9128 100 162 3.30.70.20
af_O06560_187_241_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8975 102 156 3.30.70.20
af_O06560_187_241_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8829 102 156 3.30.70.20
2vpwB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8708 106 159 3.30.70.20
2vpwB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8564 106 159 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A378EHB2-F1-model_v4 deleted 0.9475 101 255
AF-A0A316XKB8-F1-model_v4 deleted 0.9333 83 247
AF-A0A378EHB2-F1-model_v4 deleted 0.93 101 255
AF-A0A316XKB8-F1-model_v4 deleted 0.9278 83 247
AF-A0A377LQA2-F1-model_v4 Formate dehydrogenase subunit beta (EC 1.17.1.9) 0.9264 80 231 GO:0008863
GO:0030313
GO:0046872
GO:0051539

Map