F423448

General Info

Members Datasets Scaffolds Average Seq Length
364 225 364 174

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0116898|Ga0496104_0116898_490_1047
Length 185
Sequence MRLSSDVSEVMADRPFNVLFLCTGNSARSILAEAILNKLGAGKFRAYSAGSQPKERIHPETIQLLQGLGYDTSGLRSKSWGEFAKPGAPHLDFVFTVCDNAAAEACPVWPGQPMTAHWGVPDPAQATGSPAEIGLAFKDAYRMLHQRIGIFTALPLRSLDQLSLQRRLQDIGRMQGAAAKASEPS

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
102 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
103 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
104 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
105 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
106 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
122 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.77
Nodule 0
Rhizoplane 14.84
Rhizosphere 78.57
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10023712 3300003203 Bacteria 2422
2 Ga0070670_100563936 3300005331 Bacteria 1017
3 Ga0070682_100046473 3300005337 Bacteria 2694
4 Ga0068868_100072094 3300005338 Bacteria 2755
5 Ga0070687_100143966 3300005343 Bacteria 1391
6 Ga0070661_100208919 3300005344 Bacteria 1494
7 Ga0070671_100481437 3300005355 Bacteria 1066
8 Ga0070674_100100727 3300005356 Bacteria 2104
9 Ga0070688_100051564 3300005365 Bacteria 2567
10 Ga0070709_10147615 3300005434 Bacteria 1622
11 Ga0070714_101002715 3300005435 Bacteria 813
12 Ga0070713_100000923 3300005436 Bacteria 18738
13 Ga0070710_10027268 3300005437 Bacteria 3044
14 Ga0070711_100011070 3300005439 Bacteria 5597
15 Ga0070711_100315587 3300005439 Bacteria 1247
16 Ga0070663_100039645 3300005455 Bacteria 3293
17 Ga0070678_100065354 3300005456 Bacteria 2700
18 Ga0070662_100646252 3300005457 Bacteria 892
19 Ga0070681_10230479 3300005458 Bacteria 1767
20 Ga0070706_100725626 3300005467 Bacteria 921
21 Ga0070698_101466736 3300005471 Bacteria 633
22 Ga0070699_100220461 3300005518 Bacteria 1690
23 Ga0070679_100435825 3300005530 Bacteria 1255
24 Ga0070679_100454019 3300005530 Bacteria 1226
25 Ga0070684_100096208 3300005535 Bacteria 2639
26 Ga0070684_100516838 3300005535 Bacteria 1106
27 Ga0070693_100053361 3300005547 Bacteria 2321
28 Ga0070693_100495940 3300005547 Bacteria 865
29 Ga0070665_100064056 3300005548 Bacteria 3686
30 Ga0070665_100779400 3300005548 Bacteria 969
31 Ga0070664_100155230 3300005564 Bacteria 2022
32 Ga0070702_100003770 3300005615 Bacteria 6843
33 Ga0068859_101653921 3300005617 Bacteria 707
34 Ga0068864_100492282 3300005618 Bacteria 1178
35 Ga0068858_100054706 3300005842 Bacteria 3690
36 Ga0068862_100644728 3300005844 Bacteria 1021
37 Ga0081539_10001543 3300005985 Bacteria 38502
38 Ga0070717_10141074 3300006028 Bacteria 2078
39 Ga0075363_100626137 3300006048 Bacteria 646
40 Ga0075364_10014489 3300006051 Bacteria 4873
41 Ga0075364_10039104 3300006051 Bacteria 3074
42 Ga0070715_10002518 3300006163 Bacteria 5646
43 Ga0070716_100004152 3300006173 Bacteria 6879
44 Ga0070712_100013258 3300006175 Bacteria 5263
45 Ga0070712_100100241 3300006175 Bacteria 2139
46 Ga0070712_100198200 3300006175 Bacteria 1575
47 Ga0075362_10080107 3300006177 Bacteria 1504
48 Ga0075362_10197510 3300006177 Bacteria 978
49 Ga0075367_10263525 3300006178 Bacteria 1082
50 Ga0075369_10013588 3300006186 Bacteria 3236
51 Ga0075366_10182903 3300006195 Bacteria 1273
52 Ga0097621_100006628 3300006237 Bacteria 8228
53 Ga0068871_100006454 3300006358 Bacteria 8299
54 Ga0068871_100174634 3300006358 Bacteria 1844
55 Ga0075433_10126702 3300006852 Bacteria 2267
56 Ga0075433_10318637 3300006852 Bacteria 1376
57 Ga0075434_100096529 3300006871 Bacteria 2961
58 Ga0075434_100141659 3300006871 Bacteria 2425
59 Ga0075434_100423457 3300006871 Bacteria 1352
60 Ga0068865_100092177 3300006881 Bacteria 2201
61 Ga0097620_100812177 3300006931 Bacteria 1022
62 Ga0097620_101653643 3300006931 Bacteria 707
63 Ga0075435_100037053 3300007076 Bacteria 3881
64 Ga0075435_100111482 3300007076 Bacteria 2276
65 Ga0099795_10086650 3300007788 Bacteria 1207
66 Ga0105251_10084715 3300009011 Bacteria 1462
67 Ga0111539_10226284 3300009094 Bacteria 2178
68 Ga0111539_10396615 3300009094 Bacteria 1607
69 Ga0105245_10075199 3300009098 Bacteria 3075
70 Ga0114129_10275155 3300009147 Bacteria 2251
71 Ga0105243_10989341 3300009148 Bacteria 843
72 Ga0105242_10182118 3300009176 Bacteria 1854
73 Ga0105242_10354469 3300009176 Bacteria 1356
74 Ga0105238_10154592 3300009551 Bacteria 2269
75 Ga0105239_10273385 3300010375 Bacteria 1901
76 Ga0105246_10019389 3300011119 Bacteria 4345
77 Ga0157339_1005452 3300012505 Bacteria 1004
78 Ga0157378_10019818 3300013297 Bacteria 5914
79 Ga0157378_10447329 3300013297 Bacteria 1282
80 Ga0163162_10019721 3300013306 Bacteria 6621
81 Ga0157375_10166503 3300013308 Bacteria 2349
82 Ga0157375_10190306 3300013308 Bacteria 2206
83 Ga0163163_10014823 3300014325 Bacteria 7178
84 Ga0163163_10129576 3300014325 Bacteria 2562
85 Ga0163163_10181214 3300014325 Bacteria 2154
86 Ga0182008_10135533 3300014497 Bacteria 1230
87 Ga0157379_10156614 3300014968 Bacteria 2055
88 Ga0157379_10833430 3300014968 Bacteria 872
89 Ga0157376_10027383 3300014969 Bacteria 4517
90 Ga0163161_10057061 3300017792 Bacteria 2837
91 Ga0163161_10309418 3300017792 Bacteria 1246
92 Ga0207713_1107827 3300025735 Bacteria 951
93 Ga0207692_10001856 3300025898 Bacteria 8035
94 Ga0207642_10108251 3300025899 Bacteria 1410
95 Ga0207710_10032194 3300025900 Bacteria 2297
96 Ga0207685_10000848 3300025905 Bacteria 5735
97 Ga0207699_10557200 3300025906 Bacteria 832
98 Ga0207684_10547817 3300025910 Bacteria 990
99 Ga0207693_10012093 3300025915 Bacteria 6978
100 Ga0207693_10022117 3300025915 Bacteria 5055
101 Ga0207693_10234792 3300025915 Bacteria 1440
102 Ga0207693_10323919 3300025915 Bacteria 1206
103 Ga0207693_11228906 3300025915 Bacteria 564
104 Ga0207663_10178809 3300025916 Bacteria 1513
105 Ga0207652_10790225 3300025921 Bacteria 843
106 Ga0207694_10212943 3300025924 Bacteria 1574
107 Ga0207700_10002289 3300025928 Bacteria 10987
108 Ga0207644_10023350 3300025931 Bacteria 4235
109 Ga0207706_10357250 3300025933 Bacteria 1270
110 Ga0207686_10400070 3300025934 Bacteria 1046
111 Ga0207704_10018360 3300025938 Bacteria 3649
112 Ga0207665_10000223 3300025939 Bacteria 38647
113 Ga0207689_10081901 3300025942 Bacteria 2653
114 Ga0207679_10162348 3300025945 Bacteria 1830
115 Ga0207679_10182287 3300025945 Bacteria 1738
116 Ga0207677_10061693 3300026023 Bacteria 2597
117 Ga0207677_10091784 3300026023 Bacteria 2210
118 Ga0207678_10019073 3300026067 Bacteria 6021
119 Ga0207678_10077002 3300026067 Bacteria 2857
120 Ga0207641_10013191 3300026088 Bacteria 6775
121 Ga0207648_10983841 3300026089 Bacteria 790
122 Ga0207676_10054332 3300026095 Bacteria 3139
123 Ga0207683_10015344 3300026121 Bacteria 6524
124 Ga0207428_10231313 3300027907 Bacteria 1383
125 Ga0268266_10008517 3300028379 Bacteria 9112
126 Ga0268266_10208949 3300028379 Bacteria 1790
127 Ga0268266_10277595 3300028379 Bacteria 1557
128 Ga0268266_10328257 3300028379 Bacteria 1433
129 Ga0265338_10021348 3300028800 Bacteria 6757
130 Ga0265770_1084427 3300030878 Bacteria 625
131 Ga0265760_10046186 3300031090 Bacteria 1306
132 Ga0265330_10131665 3300031235 Bacteria 1064
133 Ga0265313_10193944 3300031595 Bacteria 848
134 Ga0373950_0004250 3300034818 Bacteria 2089
135 Ga0373959_0023550 3300034820 Bacteria 1198
136 Ga0373938_0002329 3300034957 Bacteria 3059
137 Ga0373926_0102356 3300035083 Bacteria 1072
138 Ga0373928_0014544 3300035084 Bacteria 1593
139 Ga0373929_0030212 3300035085 Bacteria 1154
140 Ga0373944_0041979 3300035089 Bacteria 1417
141 Ga0373949_0018257 3300035090 Bacteria 1588
142 Ga0373923_0000023 3300035111 Bacteria 23047
143 Ga0373936_0000171 3300035113 Bacteria 21558
144 Ga0373939_0014941 3300035114 Bacteria 2023
145 Ga0373945_0433694 3300035116 Bacteria 579
146 Ga0373953_0000572 3300035117 Bacteria 10237
147 Ga0373954_0002827 3300035118 Bacteria 7308
148 Ga0373954_0174421 3300035118 Bacteria 1054
149 Ga0373956_0028006 3300035119 Bacteria 2450
150 Ga0373956_0082300 3300035119 Bacteria 1478
151 Ga0373957_0100511 3300035120 Bacteria 1157
152 Ga0373960_0033193 3300035121 Bacteria 1454
153 Ga0373943_0003257 3300035170 Bacteria 7373
154 Ga0373946_0000384 3300035171 Bacteria 14370
155 Ga0373955_0000031 3300035172 Bacteria 56668
156 Ga0373955_0254945 3300035172 Bacteria 1052
157 Ga0373955_0297224 3300035172 Bacteria 973
158 Ga0373961_0098842 3300035241 Bacteria 942
159 Ga0373962_0011279 3300035242 Bacteria 2239
160 Ga0373924_0003376 3300035410 Bacteria 5484
161 Ga0373931_0020608 3300035691 Bacteria 3300
162 Ga0373935_0000461 3300035692 Bacteria 21136
163 Ga0373935_0082873 3300035692 Bacteria 2087
164 Ga0373935_1283538 3300035692 Bacteria 546
165 Ga0373927_0020575 3300035695 Bacteria 4327
166 Ga0373927_0024019 3300035695 Bacteria 3988
167 Ga0373927_0123584 3300035695 Bacteria 1689
168 Ga0373927_0350388 3300035695 Bacteria 973
169 Ga0373933_0000638 3300035724 Bacteria 21867
170 Ga0373933_0044607 3300035724 Bacteria 2627
171 Ga0373947_0000244 3300035725 Bacteria 30605
172 Ga0373947_0022220 3300035725 Bacteria 3676
173 Ga0373947_0187474 3300035725 Bacteria 1349
174 Ga0373947_0224131 3300035725 Bacteria 1237
175 Ga0373937_0000098 3300036401 Bacteria 81900
176 Ga0373937_0013615 3300036401 Bacteria 7167
177 Ga0373937_0306840 3300036401 Bacteria 1501
178 Ga0373925_0000198 3300037068 Bacteria 65543
179 Ga0373925_0042420 3300037068 Bacteria 3375
180 Ga0436365_1830451 3300039437 Bacteria 692
181 Ga0436360_0347635 3300039438 Bacteria 840
182 Ga0436360_1257918 3300039438 Bacteria 1042
183 Ga0436363_0489187 3300039450 Bacteria 787
184 Ga0466959_0156996 3300045049 Bacteria 1601
185 Ga0466967_0696762 3300045976 Bacteria 1006
186 Ga0495592_0000119 3300046454 Bacteria 69687
187 Ga0495603_0021037 3300046455 Bacteria 3950
188 Ga0495590_0148920 3300046457 Bacteria 848
189 Ga0495629_0003106 3300046459 Bacteria 12592
190 Ga0495629_0011277 3300046459 Bacteria 6492
191 Ga0495641_0025903 3300046461 Bacteria 2872
192 Ga0495641_0255549 3300046461 Bacteria 788
193 Ga0495651_0001083 3300046462 Bacteria 21013
194 Ga0495651_0018225 3300046462 Bacteria 5437
195 Ga0495653_0000030 3300046463 Bacteria 142668
196 Ga0495653_0499371 3300046463 Bacteria 759
197 Ga0495580_0319279 3300046472 Bacteria 1056
198 Ga0495582_0002101 3300046473 Bacteria 11145
199 Ga0495582_0061592 3300046473 Bacteria 2072
200 Ga0495605_0356589 3300046474 Bacteria 613
201 Ga0495662_0001102 3300046476 Bacteria 13286
202 Ga0495662_0364642 3300046476 Bacteria 710
203 Ga0495664_0000003 3300046477 Bacteria 551602
204 Ga0495584_0043815 3300046491 Bacteria 2259
205 Ga0495607_0235685 3300046501 Bacteria 888
206 Ga0495608_0000011 3300046511 Bacteria 248514
207 Ga0495618_0000025 3300046514 Bacteria 116027
208 Ga0495618_0073039 3300046514 Bacteria 2183
209 Ga0495628_0000001 3300046516 Bacteria 917742
210 Ga0495628_0292027 3300046516 Bacteria 1208
211 Ga0495630_0000551 3300046517 Bacteria 27325
212 Ga0495630_0245717 3300046517 Bacteria 1367
213 Ga0495652_0000002 3300046529 Bacteria 946606
214 Ga0495652_0792547 3300046529 Bacteria 631
215 Ga0495665_0182652 3300046531 Bacteria 1090
216 Ga0495665_0235589 3300046531 Bacteria 944
217 Ga0495665_0421321 3300046531 Bacteria 676
218 Ga0495665_0442215 3300046531 Bacteria 658
219 Ga0495640_0000002 3300046533 Bacteria 646434
220 Ga0495640_0188492 3300046533 Bacteria 1312
221 Ga0495640_0257846 3300046533 Bacteria 1090
222 Ga0495586_0641590 3300046535 Bacteria 613
223 Ga0495587_0000001 3300046536 Bacteria 724132
224 Ga0495645_0000002 3300046543 Bacteria 651644
225 Ga0495645_0064928 3300046543 Bacteria 2641
226 Ga0495667_0000004 3300046559 Bacteria 295297
227 Ga0495667_0038825 3300046559 Bacteria 3170
228 Ga0495634_0000010 3300046642 Bacteria 143792
229 Ga0495634_0038303 3300046642 Bacteria 3270
230 Ga0495634_0080856 3300046642 Bacteria 2126
231 Ga0495635_0000001 3300046663 Bacteria 704901
232 Ga0495635_0217653 3300046663 Bacteria 1292
233 Ga0495635_0308480 3300046663 Bacteria 1060
234 Ga0495657_0000369 3300046675 Bacteria 41664
235 Ga0495657_0058862 3300046675 Bacteria 2550
236 Ga0495657_0453511 3300046675 Bacteria 751
237 Ga0495599_0000013 3300046678 Bacteria 179828
238 Ga0495623_0000024 3300046679 Bacteria 96499
239 Ga0495646_0000009 3300046680 Bacteria 200698
240 Ga0495647_0097454 3300046681 Bacteria 1214
241 Ga0495658_0002761 3300046683 Bacteria 8820
242 Ga0495658_0015270 3300046683 Bacteria 3938
243 Ga0495658_0073899 3300046683 Bacteria 1986
244 Ga0495658_0925093 3300046683 Bacteria 557
245 Ga0495613_0048627 3300046689 Bacteria 3132
246 Ga0495624_0011364 3300046690 Bacteria 6119
247 Ga0495600_0000071 3300046809 Bacteria 55914
248 Ga0495600_0007217 3300046809 Bacteria 6784
249 Ga0495581_0105810 3300047315 Bacteria 1635
250 Ga0495604_0000129 3300047317 Bacteria 63593
251 Ga0495604_0128021 3300047317 Bacteria 1828
252 Ga0495604_0596046 3300047317 Bacteria 709
253 Ga0495674_0000002 3300047319 Bacteria 642785
254 Ga0495674_0007187 3300047319 Bacteria 10651
255 Ga0495674_0829762 3300047319 Bacteria 717
256 Ga0495676_0085976 3300047321 Bacteria 2368
257 Ga0495680_0000853 3300047322 Bacteria 33888
258 Ga0495680_0057647 3300047322 Bacteria 3003
259 Ga0495680_0075530 3300047322 Bacteria 2557
260 Ga0495675_0000274 3300047444 Bacteria 37360
261 Ga0495677_0062076 3300047445 Bacteria 1387
262 Ga0495684_0000083 3300047471 Bacteria 65861
263 Ga0495684_0092572 3300047471 Bacteria 2290
264 Ga0495684_0196475 3300047471 Bacteria 1489
265 Ga0495593_0005774 3300047673 Bacteria 7299
266 Ga0495602_0000024 3300048088 Bacteria 151162
267 Ga0495602_0120901 3300048088 Bacteria 2107
268 Ga0495614_0057035 3300048089 Bacteria 1677
269 Ga0496100_0010789 3300048903 Bacteria 5183
270 Ga0496100_0046055 3300048903 Bacteria 2802
271 Ga0496101_0018951 3300048904 Bacteria 4688
272 Ga0496101_0486586 3300048904 Bacteria 974
273 Ga0496102_0049386 3300048905 Bacteria 3828
274 Ga0496102_0103740 3300048905 Bacteria 2644
275 Ga0496102_0174043 3300048905 Bacteria 2026
276 Ga0496102_0281171 3300048905 Bacteria 1568
277 Ga0496103_0034064 3300048906 Bacteria 3113
278 Ga0496103_0173619 3300048906 Bacteria 1384
279 Ga0496104_0072484 3300048907 Bacteria 3275
280 Ga0496104_0116898 3300048907 Bacteria 2559
281 Ga0496104_0566484 3300048907 Bacteria 1046
282 Ga0496104_0741306 3300048907 Bacteria 889
283 Ga0496104_0895795 3300048907 Bacteria 792
284 Ga0496105_0087064 3300048908 Bacteria 2581
285 Ga0496105_0108169 3300048908 Bacteria 2295
286 Ga0496105_0145959 3300048908 Bacteria 1946
287 Ga0496105_0385608 3300048908 Bacteria 1114
288 Ga0496106_0010963 3300048909 Bacteria 6702
289 Ga0496106_0022446 3300048909 Bacteria 4688
290 Ga0496106_0284491 3300048909 Bacteria 1325
291 Ga0496106_0942411 3300048909 Bacteria 680
292 Ga0496107_0003431 3300048910 Bacteria 10597
293 Ga0496107_0019248 3300048910 Bacteria 4816
294 Ga0496107_0360612 3300048910 Bacteria 1081
295 Ga0496107_0558493 3300048910 Bacteria 847
296 Ga0496108_0038307 3300048911 Bacteria 3993
297 Ga0496108_0133352 3300048911 Bacteria 2135
298 Ga0496109_0299332 3300048912 Bacteria 1516
299 Ga0496109_0391236 3300048912 Bacteria 1313
300 Ga0496109_0398271 3300048912 Bacteria 1301
301 Ga0496109_1482478 3300048912 Bacteria 613
302 Ga0496110_0172520 3300048913 Bacteria 1962
303 Ga0496110_0207965 3300048913 Bacteria 1778
304 Ga0496110_0793828 3300048913 Bacteria 851
305 Ga0496111_0113784 3300048914 Bacteria 1994
306 Ga0496111_0567172 3300048914 Bacteria 832
307 Ga0496112_0077478 3300048915 Bacteria 3287
308 Ga0496112_0271424 3300048915 Bacteria 1644
309 Ga0496112_0366382 3300048915 Bacteria 1382
310 Ga0496112_0387726 3300048915 Bacteria 1337
311 Ga0496113_0039401 3300048916 Bacteria 3478
312 Ga0496113_0075107 3300048916 Bacteria 2579
313 Ga0496113_0102034 3300048916 Bacteria 2224
314 Ga0496114_0014702 3300048917 Bacteria 6289
315 Ga0496114_0051097 3300048917 Bacteria 3441
316 Ga0496114_0230768 3300048917 Bacteria 1626
317 Ga0496115_0009006 3300048918 Bacteria 7404
318 Ga0496115_0023427 3300048918 Bacteria 4792
319 Ga0496115_0030186 3300048918 Bacteria 4263
320 Ga0496115_0032828 3300048918 Bacteria 4097
321 Ga0496115_0311279 3300048918 Bacteria 1289
322 Ga0496115_0642531 3300048918 Bacteria 839
323 Ga0496126_0620335 3300048929 Bacteria 850
324 Ga0501034_0190281 3300049571 Bacteria 2015
325 Ga0501038_0503975 3300049574 Bacteria 925
326 Ga0501071_0022376 3300049587 Bacteria 4407
327 Ga0501072_0082663 3300049588 Bacteria 2546
328 Ga0501075_0366928 3300049591 Bacteria 1097
329 Ga0501080_0329571 3300049742 Bacteria 1381
330 Ga0501045_0437160 3300049824 Bacteria 973
331 nmdc:mga03683_282461_c1 3300050489 Bacteria 776
332 nmdc:mga03n38_26044_c1 3300050490 Bacteria 2411
333 nmdc:mga0yw44_1125989_c1 3300050492 Bacteria 530
334 nmdc:mga0yw44_20089_c1 3300050492 Bacteria 3700
335 nmdc:mga0k408_326489_c1 3300050493 Bacteria 915
336 nmdc:mga06z11_109337_c1 3300050494 Bacteria 1529
337 nmdc:mga06z11_260556_c1 3300050494 Bacteria 1023
338 nmdc:mga06z11_631035_c1 3300050494 Bacteria 652
339 nmdc:mga06z11_641570_c1 3300050494 Bacteria 646
340 nmdc:mga07m45_39595_c1 3300050496 Bacteria 2635
341 nmdc:mga07m45_399371_c1 3300050496 Bacteria 798
342 nmdc:mga05p37_588124_c1 3300050507 Bacteria 1259
343 nmdc:mga08y16_109349_c1 3300050511 Bacteria 2878
344 nmdc:mga0n895_14300_c1 3300050512 Bacteria 7202
345 nmdc:mga0n895_93467_c1 3300050512 Bacteria 3011
346 nmdc:mga0rr50_254225_c1 3300050513 Bacteria 1460
347 nmdc:mga0rr50_776579_c1 3300050513 Bacteria 818
348 nmdc:mga08x19_145226_c1 3300050514 Bacteria 1604
349 nmdc:mga08x19_629890_c1 3300050514 Bacteria 760
350 nmdc:mga0a205_162822_c1 3300050515 Bacteria 2127
351 nmdc:mga0a205_236276_c1 3300050515 Bacteria 1709
352 Ga0495601_0000001 3300053077 Bacteria 549454
353 Ga0495601_0004017 3300053077 Bacteria 8472
354 Ga0495601_0004614 3300053077 Bacteria 7972
355 Ga0495612_0000017 3300053078 Bacteria 152112
356 Ga0495612_0003891 3300053078 Bacteria 6191
357 Ga0495595_0000010 3300053084 Bacteria 178819
358 Ga0495595_0001565 3300053084 Bacteria 8930
359 Ga0495619_0000004 3300053085 Bacteria 500068
360 Ga0495619_0000945 3300053085 Bacteria 19013
361 Ga0500658_0000022 3300053134 Bacteria 129341
362 Ga0500616_0000408 3300053153 Bacteria 58453
363 Ga0501082_0255263 3300060353 Bacteria 1525
364 Ga0501082_1319088 3300060353 Bacteria 630

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_101466736 Ga0070698_1014667361 147
2 3300005617 Ga0068859_101653921 Ga0068859_1016539211 147
3 3300006931 Ga0097620_101653643 Ga0097620_1016536431 147
4 3300045976 Ga0466967_0696762 Ga0466967_0696762_336_788 147
5 3300035692 Ga0373935_1283538 Ga0373935_1283538_27_485 150
6 3300048912 Ga0496109_1482478 Ga0496109_1482478_46_513 152
7 3300048913 Ga0496110_0793828 Ga0496110_0793828_23_490 152
8 3300049588 Ga0501072_0082663 Ga0501072_0082663_35_502 152
9 3300050492 nmdc:mga0yw44_1125989_c1 nmdc:mga0yw44_1125989_c1_33_503 153
10 3300039450 Ga0436363_0489187 Ga0436363_0489187_267_761 161
11 3300039437 Ga0436365_1830451 Ga0436365_1830451_113_619 162
12 3300053134 Ga0500658_0000022 Ga0500658_0000022_112086_112577 162
13 3300006178 Ga0075367_10263525 Ga0075367_102635252 163
14 3300028379 Ga0268266_10277595 Ga0268266_102775953 163
15 3300050494 nmdc:mga06z11_260556_c1 nmdc:mga06z11_260556_c1_130_627 163
16 3300050496 nmdc:mga07m45_399371_c1 nmdc:mga07m45_399371_c1_39_536 163
17 3300026089 Ga0207648_10983841 Ga0207648_109838412 166
18 3300026095 Ga0207676_10054332 Ga0207676_100543324 166
19 3300046476 Ga0495662_0364642 Ga0495662_0364642_162_677 168
20 3300046514 Ga0495618_0073039 Ga0495618_0073039_1589_2104 168
21 3300046533 Ga0495640_0257846 Ga0495640_0257846_210_725 168
22 3300046642 Ga0495634_0038303 Ga0495634_0038303_365_880 168
23 3300046663 Ga0495635_0217653 Ga0495635_0217653_426_941 168
24 3300047319 Ga0495674_0007187 Ga0495674_0007187_7143_7658 168
25 3300047471 Ga0495684_0092572 Ga0495684_0092572_343_858 168
26 3300053077 Ga0495601_0004614 Ga0495601_0004614_763_1278 168
27 3300006051 Ga0075364_10014489 Ga0075364_100144892 170
28 3300006177 Ga0075362_10197510 Ga0075362_101975101 170
29 3300006195 Ga0075366_10182903 Ga0075366_101829032 170
30 3300007788 Ga0099795_10086650 Ga0099795_100866502 170
31 3300025915 Ga0207693_11228906 Ga0207693_112289061 170
32 3300031235 Ga0265330_10131665 Ga0265330_101316652 170
33 3300035695 Ga0373927_0024019 Ga0373927_0024019_651_1169 170
34 3300035725 Ga0373947_0187474 Ga0373947_0187474_150_668 170
35 3300037068 Ga0373925_0042420 Ga0373925_0042420_928_1446 170
36 3300046457 Ga0495590_0148920 Ga0495590_0148920_74_592 170
37 3300046473 Ga0495582_0061592 Ga0495582_0061592_58_576 170
38 3300046474 Ga0495605_0356589 Ga0495605_0356589_78_596 170
39 3300046491 Ga0495584_0043815 Ga0495584_0043815_1318_1836 170
40 3300046501 Ga0495607_0235685 Ga0495607_0235685_175_693 170
41 3300046517 Ga0495630_0245717 Ga0495630_0245717_59_589 170
42 3300046531 Ga0495665_0182652 Ga0495665_0182652_503_1021 170
43 3300046642 Ga0495634_0080856 Ga0495634_0080856_219_749 170
44 3300046683 Ga0495658_0015270 Ga0495658_0015270_333_851 170
45 3300047319 Ga0495674_0829762 Ga0495674_0829762_95_625 170
46 3300047445 Ga0495677_0062076 Ga0495677_0062076_759_1277 170
47 3300050489 nmdc:mga03683_282461_c1 nmdc:mga03683_282461_c1_83_604 170
48 3300050490 nmdc:mga03n38_26044_c1 nmdc:mga03n38_26044_c1_1196_1717 170
49 3300005331 Ga0070670_100563936 Ga0070670_1005639361 171
50 3300005343 Ga0070687_100143966 Ga0070687_1001439662 171
51 3300005344 Ga0070661_100208919 Ga0070661_1002089192 171
52 3300005355 Ga0070671_100481437 Ga0070671_1004814372 171
53 3300005356 Ga0070674_100100727 Ga0070674_1001007274 171
54 3300005365 Ga0070688_100051564 Ga0070688_1000515642 171
55 3300005435 Ga0070714_101002715 Ga0070714_1010027151 171
56 3300005436 Ga0070713_100000923 Ga0070713_1000009239 171
57 3300005437 Ga0070710_10027268 Ga0070710_100272683 171
58 3300005439 Ga0070711_100011070 Ga0070711_1000110703 171
59 3300005456 Ga0070678_100065354 Ga0070678_1000653543 171
60 3300005535 Ga0070684_100096208 Ga0070684_1000962084 171
61 3300005535 Ga0070684_100516838 Ga0070684_1005168382 171
62 3300005547 Ga0070693_100053361 Ga0070693_1000533612 171
63 3300005548 Ga0070665_100064056 Ga0070665_1000640563 171
64 3300005564 Ga0070664_100155230 Ga0070664_1001552304 171
65 3300005615 Ga0070702_100003770 Ga0070702_1000037702 171
66 3300005618 Ga0068864_100492282 Ga0068864_1004922822 171
67 3300005842 Ga0068858_100054706 Ga0068858_1000547064 171
68 3300005844 Ga0068862_100644728 Ga0068862_1006447282 171
69 3300006048 Ga0075363_100626137 Ga0075363_1006261372 171
70 3300006163 Ga0070715_10002518 Ga0070715_100025183 171
71 3300006173 Ga0070716_100004152 Ga0070716_1000041525 171
72 3300006175 Ga0070712_100013258 Ga0070712_1000132583 171
73 3300006175 Ga0070712_100100241 Ga0070712_1001002412 171
74 3300006237 Ga0097621_100006628 Ga0097621_1000066282 171
75 3300006358 Ga0068871_100006454 Ga0068871_1000064544 171
76 3300006852 Ga0075433_10318637 Ga0075433_103186373 171
77 3300006871 Ga0075434_100141659 Ga0075434_1001416592 171
78 3300006871 Ga0075434_100423457 Ga0075434_1004234573 171
79 3300006931 Ga0097620_100812177 Ga0097620_1008121772 171
80 3300007076 Ga0075435_100037053 Ga0075435_1000370533 171
81 3300009011 Ga0105251_10084715 Ga0105251_100847153 171
82 3300009094 Ga0111539_10396615 Ga0111539_103966153 171
83 3300009148 Ga0105243_10989341 Ga0105243_109893412 171
84 3300009176 Ga0105242_10354469 Ga0105242_103544692 171
85 3300009551 Ga0105238_10154592 Ga0105238_101545923 171
86 3300010375 Ga0105239_10273385 Ga0105239_102733854 171
87 3300011119 Ga0105246_10019389 Ga0105246_100193897 171
88 3300012505 Ga0157339_1005452 Ga0157339_10054522 171
89 3300013297 Ga0157378_10019818 Ga0157378_100198186 171
90 3300013308 Ga0157375_10166503 Ga0157375_101665034 171
91 3300013308 Ga0157375_10190306 Ga0157375_101903064 171
92 3300014325 Ga0163163_10129576 Ga0163163_101295764 171
93 3300014325 Ga0163163_10181214 Ga0163163_101812145 171
94 3300014497 Ga0182008_10135533 Ga0182008_101355332 171
95 3300014968 Ga0157379_10833430 Ga0157379_108334302 171
96 3300017792 Ga0163161_10057061 Ga0163161_100570612 171
97 3300025735 Ga0207713_1107827 Ga0207713_11078272 171
98 3300025898 Ga0207692_10001856 Ga0207692_100018569 171
99 3300025900 Ga0207710_10032194 Ga0207710_100321944 171
100 3300025905 Ga0207685_10000848 Ga0207685_100008483 171
101 3300025915 Ga0207693_10012093 Ga0207693_100120934 171
102 3300025915 Ga0207693_10022117 Ga0207693_100221176 171
103 3300025915 Ga0207693_10323919 Ga0207693_103239192 171
104 3300025924 Ga0207694_10212943 Ga0207694_102129432 171
105 3300025928 Ga0207700_10002289 Ga0207700_100022899 171
106 3300025931 Ga0207644_10023350 Ga0207644_100233502 171
107 3300025933 Ga0207706_10357250 Ga0207706_103572503 171
108 3300025938 Ga0207704_10018360 Ga0207704_100183605 171
109 3300025939 Ga0207665_10000223 Ga0207665_1000022336 171
110 3300025942 Ga0207689_10081901 Ga0207689_100819014 171
111 3300025945 Ga0207679_10182287 Ga0207679_101822872 171
112 3300026023 Ga0207677_10091784 Ga0207677_100917844 171
113 3300026067 Ga0207678_10077002 Ga0207678_100770026 171
114 3300026088 Ga0207641_10013191 Ga0207641_100131912 171
115 3300026121 Ga0207683_10015344 Ga0207683_100153446 171
116 3300028379 Ga0268266_10008517 Ga0268266_100085178 171
117 3300028379 Ga0268266_10328257 Ga0268266_103282572 171
118 3300034818 Ga0373950_0004250 Ga0373950_0004250_368_889 171
119 3300034820 Ga0373959_0023550 Ga0373959_0023550_590_1111 171
120 3300034957 Ga0373938_0002329 Ga0373938_0002329_1265_1786 171
121 3300035083 Ga0373926_0102356 Ga0373926_0102356_343_864 171
122 3300035084 Ga0373928_0014544 Ga0373928_0014544_623_1144 171
123 3300035085 Ga0373929_0030212 Ga0373929_0030212_90_611 171
124 3300035089 Ga0373944_0041979 Ga0373944_0041979_202_723 171
125 3300035090 Ga0373949_0018257 Ga0373949_0018257_680_1201 171
126 3300035114 Ga0373939_0014941 Ga0373939_0014941_1462_1983 171
127 3300035121 Ga0373960_0033193 Ga0373960_0033193_43_564 171
128 3300035241 Ga0373961_0098842 Ga0373961_0098842_236_757 171
129 3300035242 Ga0373962_0011279 Ga0373962_0011279_791_1312 171
130 3300035691 Ga0373931_0020608 Ga0373931_0020608_1395_1916 171
131 3300035692 Ga0373935_0082873 Ga0373935_0082873_20_541 171
132 3300035725 Ga0373947_0022220 Ga0373947_0022220_2159_2680 171
133 3300046455 Ga0495603_0021037 Ga0495603_0021037_1744_2265 171
134 3300046459 Ga0495629_0011277 Ga0495629_0011277_3641_4162 171
135 3300046461 Ga0495641_0025903 Ga0495641_0025903_1980_2501 171
136 3300046463 Ga0495653_0499371 Ga0495653_0499371_20_541 171
137 3300046473 Ga0495582_0002101 Ga0495582_0002101_8896_9417 171
138 3300046531 Ga0495665_0421321 Ga0495665_0421321_83_604 171
139 3300046531 Ga0495665_0442215 Ga0495665_0442215_57_641 171
140 3300046681 Ga0495647_0097454 Ga0495647_0097454_290_811 171
141 3300046683 Ga0495658_0002761 Ga0495658_0002761_5452_5973 171
142 3300046689 Ga0495613_0048627 Ga0495613_0048627_1681_2202 171
143 3300047321 Ga0495676_0085976 Ga0495676_0085976_1455_1976 171
144 3300047322 Ga0495680_0057647 Ga0495680_0057647_980_1501 171
145 3300047471 Ga0495684_0196475 Ga0495684_0196475_453_974 171
146 3300048089 Ga0495614_0057035 Ga0495614_0057035_800_1321 171
147 3300048903 Ga0496100_0010789 Ga0496100_0010789_830_1351 171
148 3300048903 Ga0496100_0046055 Ga0496100_0046055_1173_1694 171
149 3300048904 Ga0496101_0018951 Ga0496101_0018951_2785_3306 171
150 3300048905 Ga0496102_0103740 Ga0496102_0103740_129_650 171
151 3300048905 Ga0496102_0174043 Ga0496102_0174043_1464_1985 171
152 3300048905 Ga0496102_0281171 Ga0496102_0281171_811_1332 171
153 3300048906 Ga0496103_0034064 Ga0496103_0034064_2340_2861 171
154 3300048906 Ga0496103_0173619 Ga0496103_0173619_49_570 171
155 3300048907 Ga0496104_0566484 Ga0496104_0566484_368_889 171
156 3300048907 Ga0496104_0741306 Ga0496104_0741306_211_732 171
157 3300048907 Ga0496104_0895795 Ga0496104_0895795_11_535 171
158 3300048908 Ga0496105_0087064 Ga0496105_0087064_302_823 171
159 3300048908 Ga0496105_0108169 Ga0496105_0108169_392_913 171
160 3300048908 Ga0496105_0385608 Ga0496105_0385608_230_751 171
161 3300048909 Ga0496106_0022446 Ga0496106_0022446_1383_1904 171
162 3300048909 Ga0496106_0942411 Ga0496106_0942411_52_573 171
163 3300048910 Ga0496107_0019248 Ga0496107_0019248_1383_1904 171
164 3300048910 Ga0496107_0360612 Ga0496107_0360612_508_1029 171
165 3300048910 Ga0496107_0558493 Ga0496107_0558493_48_569 171
166 3300048911 Ga0496108_0133352 Ga0496108_0133352_1406_1927 171
167 3300048912 Ga0496109_0299332 Ga0496109_0299332_838_1359 171
168 3300048912 Ga0496109_0398271 Ga0496109_0398271_567_1088 171
169 3300048913 Ga0496110_0207965 Ga0496110_0207965_866_1387 171
170 3300048914 Ga0496111_0567172 Ga0496111_0567172_256_777 171
171 3300048915 Ga0496112_0271424 Ga0496112_0271424_93_614 171
172 3300048915 Ga0496112_0366382 Ga0496112_0366382_24_545 171
173 3300048915 Ga0496112_0387726 Ga0496112_0387726_659_1180 171
174 3300048916 Ga0496113_0039401 Ga0496113_0039401_1621_2142 171
175 3300048916 Ga0496113_0102034 Ga0496113_0102034_866_1387 171
176 3300048917 Ga0496114_0014702 Ga0496114_0014702_1639_2160 171
177 3300048918 Ga0496115_0023427 Ga0496115_0023427_1317_1838 171
178 3300048918 Ga0496115_0032828 Ga0496115_0032828_3018_3539 171
179 3300048918 Ga0496115_0311279 Ga0496115_0311279_353_886 171
180 3300048918 Ga0496115_0642531 Ga0496115_0642531_41_562 171
181 3300048929 Ga0496126_0620335 Ga0496126_0620335_122_643 171
182 3300049571 Ga0501034_0190281 Ga0501034_0190281_962_1486 171
183 3300050492 nmdc:mga0yw44_20089_c1 nmdc:mga0yw44_20089_c1_2061_2585 171
184 3300050494 nmdc:mga06z11_641570_c1 nmdc:mga06z11_641570_c1_56_580 171
185 3300050512 nmdc:mga0n895_93467_c1 nmdc:mga0n895_93467_c1_1608_2129 171
186 3300050513 nmdc:mga0rr50_776579_c1 nmdc:mga0rr50_776579_c1_100_621 171
187 3300050514 nmdc:mga08x19_145226_c1 nmdc:mga08x19_145226_c1_177_698 171
188 3300050514 nmdc:mga08x19_629890_c1 nmdc:mga08x19_629890_c1_22_543 171
189 3300050515 nmdc:mga0a205_236276_c1 nmdc:mga0a205_236276_c1_583_1104 171
190 3300060353 Ga0501082_0255263 Ga0501082_0255263_104_628 171
191 3300003203 JGI25406J46586_10023712 JGI25406J46586_100237123 172
192 3300005337 Ga0070682_100046473 Ga0070682_1000464734 172
193 3300005338 Ga0068868_100072094 Ga0068868_1000720943 172
194 3300005434 Ga0070709_10147615 Ga0070709_101476151 172
195 3300005439 Ga0070711_100315587 Ga0070711_1003155872 172
196 3300005455 Ga0070663_100039645 Ga0070663_1000396454 172
197 3300005457 Ga0070662_100646252 Ga0070662_1006462521 172
198 3300005458 Ga0070681_10230479 Ga0070681_102304793 172
199 3300005467 Ga0070706_100725626 Ga0070706_1007256261 172
200 3300005518 Ga0070699_100220461 Ga0070699_1002204613 172
201 3300005530 Ga0070679_100435825 Ga0070679_1004358251 172
202 3300005530 Ga0070679_100454019 Ga0070679_1004540192 172
203 3300005547 Ga0070693_100495940 Ga0070693_1004959401 172
204 3300005548 Ga0070665_100779400 Ga0070665_1007794001 172
205 3300005985 Ga0081539_10001543 Ga0081539_1000154340 172
206 3300006028 Ga0070717_10141074 Ga0070717_101410742 172
207 3300006051 Ga0075364_10039104 Ga0075364_100391044 172
208 3300006175 Ga0070712_100198200 Ga0070712_1001982003 172
209 3300006177 Ga0075362_10080107 Ga0075362_100801072 172
210 3300006186 Ga0075369_10013588 Ga0075369_100135885 172
211 3300006358 Ga0068871_100174634 Ga0068871_1001746344 172
212 3300006852 Ga0075433_10126702 Ga0075433_101267023 172
213 3300006871 Ga0075434_100096529 Ga0075434_1000965293 172
214 3300006881 Ga0068865_100092177 Ga0068865_1000921772 172
215 3300007076 Ga0075435_100111482 Ga0075435_1001114823 172
216 3300009094 Ga0111539_10226284 Ga0111539_102262842 172
217 3300009098 Ga0105245_10075199 Ga0105245_100751992 172
218 3300009147 Ga0114129_10275155 Ga0114129_102751552 172
219 3300009176 Ga0105242_10182118 Ga0105242_101821182 172
220 3300013297 Ga0157378_10447329 Ga0157378_104473292 172
221 3300013306 Ga0163162_10019721 Ga0163162_100197212 172
222 3300014325 Ga0163163_10014823 Ga0163163_100148234 172
223 3300014968 Ga0157379_10156614 Ga0157379_101566143 172
224 3300014969 Ga0157376_10027383 Ga0157376_100273833 172
225 3300017792 Ga0163161_10309418 Ga0163161_103094182 172
226 3300025899 Ga0207642_10108251 Ga0207642_101082512 172
227 3300025906 Ga0207699_10557200 Ga0207699_105572002 172
228 3300025910 Ga0207684_10547817 Ga0207684_105478172 172
229 3300025915 Ga0207693_10234792 Ga0207693_102347922 172
230 3300025916 Ga0207663_10178809 Ga0207663_101788092 172
231 3300025921 Ga0207652_10790225 Ga0207652_107902252 172
232 3300025934 Ga0207686_10400070 Ga0207686_104000702 172
233 3300025945 Ga0207679_10162348 Ga0207679_101623484 172
234 3300026023 Ga0207677_10061693 Ga0207677_100616934 172
235 3300026067 Ga0207678_10019073 Ga0207678_100190736 172
236 3300027907 Ga0207428_10231313 Ga0207428_102313132 172
237 3300028379 Ga0268266_10208949 Ga0268266_102089493 172
238 3300028800 Ga0265338_10021348 Ga0265338_100213489 172
239 3300030878 Ga0265770_1084427 Ga0265770_10844271 172
240 3300031090 Ga0265760_10046186 Ga0265760_100461862 172
241 3300031595 Ga0265313_10193944 Ga0265313_101939441 172
242 3300035111 Ga0373923_0000023 Ga0373923_0000023_20012_20539 172
243 3300035113 Ga0373936_0000171 Ga0373936_0000171_14395_14922 172
244 3300035116 Ga0373945_0433694 Ga0373945_0433694_21_548 172
245 3300035117 Ga0373953_0000572 Ga0373953_0000572_7958_8485 172
246 3300035118 Ga0373954_0002827 Ga0373954_0002827_4579_5106 172
247 3300035118 Ga0373954_0174421 Ga0373954_0174421_405_932 172
248 3300035119 Ga0373956_0028006 Ga0373956_0028006_1042_1569 172
249 3300035119 Ga0373956_0082300 Ga0373956_0082300_515_1042 172
250 3300035120 Ga0373957_0100511 Ga0373957_0100511_153_680 172
251 3300035170 Ga0373943_0003257 Ga0373943_0003257_5807_6334 172
252 3300035171 Ga0373946_0000384 Ga0373946_0000384_5532_6059 172
253 3300035172 Ga0373955_0000031 Ga0373955_0000031_48610_49137 172
254 3300035172 Ga0373955_0254945 Ga0373955_0254945_205_732 172
255 3300035172 Ga0373955_0297224 Ga0373955_0297224_80_607 172
256 3300035410 Ga0373924_0003376 Ga0373924_0003376_3782_4309 172
257 3300035692 Ga0373935_0000461 Ga0373935_0000461_14328_14855 172
258 3300035695 Ga0373927_0020575 Ga0373927_0020575_1529_2056 172
259 3300035695 Ga0373927_0123584 Ga0373927_0123584_34_561 172
260 3300035695 Ga0373927_0350388 Ga0373927_0350388_52_579 172
261 3300035724 Ga0373933_0000638 Ga0373933_0000638_15296_15823 172
262 3300035724 Ga0373933_0044607 Ga0373933_0044607_339_866 172
263 3300035725 Ga0373947_0000244 Ga0373947_0000244_4876_5403 172
264 3300035725 Ga0373947_0224131 Ga0373947_0224131_449_976 172
265 3300036401 Ga0373937_0000098 Ga0373937_0000098_44553_45080 172
266 3300036401 Ga0373937_0013615 Ga0373937_0013615_2203_2730 172
267 3300036401 Ga0373937_0306840 Ga0373937_0306840_519_1046 172
268 3300037068 Ga0373925_0000198 Ga0373925_0000198_48796_49323 172
269 3300039438 Ga0436360_0347635 Ga0436360_0347635_182_700 172
270 3300039438 Ga0436360_1257918 Ga0436360_1257918_185_703 172
271 3300045049 Ga0466959_0156996 Ga0466959_0156996_762_1289 172
272 3300046454 Ga0495592_0000119 Ga0495592_0000119_48793_49320 172
273 3300046459 Ga0495629_0003106 Ga0495629_0003106_5150_5677 172
274 3300046461 Ga0495641_0255549 Ga0495641_0255549_114_641 172
275 3300046462 Ga0495651_0001083 Ga0495651_0001083_19876_20403 172
276 3300046462 Ga0495651_0018225 Ga0495651_0018225_2781_3308 172
277 3300046463 Ga0495653_0000030 Ga0495653_0000030_121781_122308 172
278 3300046472 Ga0495580_0319279 Ga0495580_0319279_14_541 172
279 3300046476 Ga0495662_0001102 Ga0495662_0001102_11145_11672 172
280 3300046477 Ga0495664_0000003 Ga0495664_0000003_104055_104582 172
281 3300046511 Ga0495608_0000011 Ga0495608_0000011_50059_50586 172
282 3300046514 Ga0495618_0000025 Ga0495618_0000025_20361_20888 172
283 3300046516 Ga0495628_0000001 Ga0495628_0000001_593456_593983 172
284 3300046516 Ga0495628_0292027 Ga0495628_0292027_435_962 172
285 3300046517 Ga0495630_0000551 Ga0495630_0000551_21589_22116 172
286 3300046529 Ga0495652_0000002 Ga0495652_0000002_807990_808517 172
287 3300046529 Ga0495652_0792547 Ga0495652_0792547_15_542 172
288 3300046531 Ga0495665_0235589 Ga0495665_0235589_10_537 172
289 3300046533 Ga0495640_0000002 Ga0495640_0000002_48319_48846 172
290 3300046533 Ga0495640_0188492 Ga0495640_0188492_393_920 172
291 3300046535 Ga0495586_0641590 Ga0495586_0641590_37_564 172
292 3300046536 Ga0495587_0000001 Ga0495587_0000001_120725_121252 172
293 3300046543 Ga0495645_0000002 Ga0495645_0000002_593469_593996 172
294 3300046543 Ga0495645_0064928 Ga0495645_0064928_1404_1928 172
295 3300046559 Ga0495667_0000004 Ga0495667_0000004_20372_20899 172
296 3300046559 Ga0495667_0038825 Ga0495667_0038825_1427_1954 172
297 3300046642 Ga0495634_0000010 Ga0495634_0000010_48499_49026 172
298 3300046663 Ga0495635_0000001 Ga0495635_0000001_106549_107076 172
299 3300046663 Ga0495635_0308480 Ga0495635_0308480_197_724 172
300 3300046675 Ga0495657_0000369 Ga0495657_0000369_20794_21321 172
301 3300046675 Ga0495657_0058862 Ga0495657_0058862_1534_2061 172
302 3300046675 Ga0495657_0453511 Ga0495657_0453511_94_627 172
303 3300046678 Ga0495599_0000013 Ga0495599_0000013_57630_58157 172
304 3300046679 Ga0495623_0000024 Ga0495623_0000024_60388_60915 172
305 3300046680 Ga0495646_0000009 Ga0495646_0000009_121558_122085 172
306 3300046683 Ga0495658_0073899 Ga0495658_0073899_821_1348 172
307 3300046683 Ga0495658_0925093 Ga0495658_0925093_18_545 172
308 3300046690 Ga0495624_0011364 Ga0495624_0011364_2523_3050 172
309 3300046809 Ga0495600_0000071 Ga0495600_0000071_10846_11373 172
310 3300046809 Ga0495600_0007217 Ga0495600_0007217_113_640 172
311 3300047315 Ga0495581_0105810 Ga0495581_0105810_1083_1610 172
312 3300047317 Ga0495604_0000129 Ga0495604_0000129_57610_58137 172
313 3300047317 Ga0495604_0128021 Ga0495604_0128021_507_1034 172
314 3300047317 Ga0495604_0596046 Ga0495604_0596046_145_672 172
315 3300047319 Ga0495674_0000002 Ga0495674_0000002_593457_593984 172
316 3300047322 Ga0495680_0000853 Ga0495680_0000853_16002_16529 172
317 3300047322 Ga0495680_0075530 Ga0495680_0075530_261_788 172
318 3300047444 Ga0495675_0000274 Ga0495675_0000274_16469_16996 172
319 3300047471 Ga0495684_0000083 Ga0495684_0000083_48808_49335 172
320 3300047673 Ga0495593_0005774 Ga0495593_0005774_3196_3723 172
321 3300048088 Ga0495602_0000024 Ga0495602_0000024_95263_95790 172
322 3300048088 Ga0495602_0120901 Ga0495602_0120901_990_1517 172
323 3300048904 Ga0496101_0486586 Ga0496101_0486586_371_895 172
324 3300048905 Ga0496102_0049386 Ga0496102_0049386_2464_2988 172
325 3300048907 Ga0496104_0072484 Ga0496104_0072484_2647_3171 172
326 3300048907 Ga0496104_0116898 Ga0496104_0116898_490_1047 172
327 3300048908 Ga0496105_0145959 Ga0496105_0145959_1335_1892 172
328 3300048909 Ga0496106_0010963 Ga0496106_0010963_5247_5771 172
329 3300048909 Ga0496106_0284491 Ga0496106_0284491_169_726 172
330 3300048910 Ga0496107_0003431 Ga0496107_0003431_5407_5931 172
331 3300048911 Ga0496108_0038307 Ga0496108_0038307_2719_3243 172
332 3300048912 Ga0496109_0391236 Ga0496109_0391236_160_684 172
333 3300048913 Ga0496110_0172520 Ga0496110_0172520_236_760 172
334 3300048914 Ga0496111_0113784 Ga0496111_0113784_1101_1625 172
335 3300048915 Ga0496112_0077478 Ga0496112_0077478_2392_2916 172
336 3300048916 Ga0496113_0075107 Ga0496113_0075107_1002_1526 172
337 3300048917 Ga0496114_0051097 Ga0496114_0051097_1175_1699 172
338 3300048917 Ga0496114_0230768 Ga0496114_0230768_949_1506 172
339 3300048918 Ga0496115_0009006 Ga0496115_0009006_1768_2292 172
340 3300048918 Ga0496115_0030186 Ga0496115_0030186_2692_3249 172
341 3300049574 Ga0501038_0503975 Ga0501038_0503975_367_894 172
342 3300049587 Ga0501071_0022376 Ga0501071_0022376_751_1278 172
343 3300049591 Ga0501075_0366928 Ga0501075_0366928_127_654 172
344 3300049742 Ga0501080_0329571 Ga0501080_0329571_561_1097 172
345 3300049824 Ga0501045_0437160 Ga0501045_0437160_300_827 172
346 3300050493 nmdc:mga0k408_326489_c1 nmdc:mga0k408_326489_c1_243_770 172
347 3300050494 nmdc:mga06z11_109337_c1 nmdc:mga06z11_109337_c1_765_1292 172
348 3300050494 nmdc:mga06z11_631035_c1 nmdc:mga06z11_631035_c1_114_641 172
349 3300050496 nmdc:mga07m45_39595_c1 nmdc:mga07m45_39595_c1_1601_2128 172
350 3300050507 nmdc:mga05p37_588124_c1 nmdc:mga05p37_588124_c1_138_683 172
351 3300050511 nmdc:mga08y16_109349_c1 nmdc:mga08y16_109349_c1_1356_1901 172
352 3300050512 nmdc:mga0n895_14300_c1 nmdc:mga0n895_14300_c1_1544_2071 172
353 3300050513 nmdc:mga0rr50_254225_c1 nmdc:mga0rr50_254225_c1_252_779 172
354 3300050515 nmdc:mga0a205_162822_c1 nmdc:mga0a205_162822_c1_343_888 172
355 3300053077 Ga0495601_0000001 Ga0495601_0000001_438343_438870 172
356 3300053077 Ga0495601_0004017 Ga0495601_0004017_5205_5732 172
357 3300053078 Ga0495612_0000017 Ga0495612_0000017_30128_30655 172
358 3300053078 Ga0495612_0003891 Ga0495612_0003891_5197_5724 172
359 3300053084 Ga0495595_0000010 Ga0495595_0000010_57606_58133 172
360 3300053084 Ga0495595_0001565 Ga0495595_0001565_5195_5722 172
361 3300053085 Ga0495619_0000004 Ga0495619_0000004_438380_438907 172
362 3300053085 Ga0495619_0000945 Ga0495619_0000945_9596_10123 172
363 3300053153 Ga0500616_0000408 Ga0500616_0000408_5234_5761 172
364 3300060353 Ga0501082_1319088 Ga0501082_1319088_84_611 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

18

151

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9626 5 142
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9549 5 141
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9484 5 142
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9264 5 141
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9261 5 142
ID Description Score Start End Superfamily
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.901 6 140 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8868 7 140 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8798 7 141 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8642 6 140 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8626 8 142 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V9GUH8-F1-model_v4 Protein-tyrosine-phosphatase 0.9875 5 161 GO:0046685
AF-A0A2D6BEZ2-F1-model_v4 deleted 0.9872 17 160
AF-A0A2G2G4D1-F1-model_v4 ArsR family transcriptional regulator 0.9869 2 159 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-K9GRJ3-F1-model_v4 Arsenate reductase 0.9811 1 162 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A3D3BC67-F1-model_v4 ArsR family transcriptional regulator 0.9811 19 161 GO:0004726
GO:0030946
GO:0046685
GO:0140793

Feature Viewer

pLDDT pTM Quality
87.42 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map