F423447

General Info

Members Datasets Scaffolds Average Seq Length
364 239 364 155

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0000039|Ga0496102_0000039_159674_160195
Length 173
Sequence LPGAGAPEAVADRLDWAAMASVEVQGVEGMQAVIGQEIGPSEWRPVTQDDINAFAELSGDHQWIHVDVERAKNESPFGTTIAHGNLTLSLVDGFRGELIDATGFALGVNYGWDKIRFPAPVPVDSKVRARAEVVSVEEKGGGWYQVVTRFTIEVEGSDKPCFVGDSVTRVMAP

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
130 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
236 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
237 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
238 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0
Rhizoplane 9.62
Rhizosphere 85.44
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005942 3300001979 Bacteria 5110
2 JGI24034J26672_10000104 3300002239 Bacteria 13847
3 Ga0070683_100003871 3300005329 Bacteria 12238
4 Ga0070683_100019566 3300005329 Bacteria 6015
5 Ga0070683_100070694 3300005329 Bacteria 3256
6 Ga0070670_100070148 3300005331 Bacteria 3009
7 Ga0070677_10000004 3300005333 Bacteria 81101
8 Ga0070666_10076243 3300005335 Bacteria 2287
9 Ga0070691_10192855 3300005341 Bacteria 1067
10 Ga0070661_100000023 3300005344 Bacteria 123104
11 Ga0070692_10209913 3300005345 Bacteria 1145
12 Ga0070668_100025413 3300005347 Bacteria 4490
13 Ga0070675_100000101 3300005354 Bacteria 50140
14 Ga0070671_101021113 3300005355 Bacteria 725
15 Ga0070674_100000008 3300005356 Bacteria 143844
16 Ga0070674_100019260 3300005356 Bacteria 4333
17 Ga0070673_100003790 3300005364 Bacteria 9488
18 Ga0070688_100002163 3300005365 Bacteria 9906
19 Ga0070667_100006509 3300005367 Bacteria 9712
20 Ga0070667_100176137 3300005367 Bacteria 1890
21 Ga0070714_100853365 3300005435 Bacteria 883
22 Ga0070714_101442416 3300005435 Bacteria 672
23 Ga0070701_10519251 3300005438 Bacteria 776
24 Ga0070694_100903855 3300005444 Bacteria 729
25 Ga0070678_100002401 3300005456 Bacteria 10255
26 Ga0070681_10008992 3300005458 Bacteria 9822
27 Ga0068867_100003840 3300005459 Bacteria 10558
28 Ga0068867_100087137 3300005459 Bacteria 2363
29 Ga0070685_10000127 3300005466 Bacteria 48844
30 Ga0070679_100000388 3300005530 Bacteria 37491
31 Ga0070684_100029222 3300005535 Bacteria 4670
32 Ga0070684_100142518 3300005535 Bacteria 2168
33 Ga0068853_100019448 3300005539 Bacteria 5630
34 Ga0070672_100000027 3300005543 Bacteria 67016
35 Ga0070686_100433092 3300005544 Bacteria 1007
36 Ga0070665_100000106 3300005548 Bacteria 157315
37 Ga0070665_100071875 3300005548 Bacteria 3467
38 Ga0070665_100106782 3300005548 Bacteria 2802
39 Ga0070704_100184774 3300005549 Bacteria 1670
40 Ga0070704_100301423 3300005549 Bacteria 1335
41 Ga0070664_100221268 3300005564 Bacteria 1694
42 Ga0068857_100927813 3300005577 Bacteria 836
43 Ga0068854_100038451 3300005578 Bacteria 3365
44 Ga0068856_100000577 3300005614 Bacteria 40018
45 Ga0068856_100001983 3300005614 Bacteria 21342
46 Ga0068856_100201243 3300005614 Bacteria 2006
47 Ga0068852_100000156 3300005616 Bacteria 45492
48 Ga0068852_100045492 3300005616 Bacteria 3734
49 Ga0068866_10000031 3300005718 Bacteria 56943
50 Ga0068851_10012772 3300005834 Bacteria 3967
51 Ga0068863_100341471 3300005841 Bacteria 1457
52 Ga0068858_100000216 3300005842 Bacteria 62188
53 Ga0068858_100002989 3300005842 Bacteria 16955
54 Ga0068858_100073944 3300005842 Bacteria 3164
55 Ga0068860_100022494 3300005843 Bacteria 6097
56 Ga0068862_100000973 3300005844 Bacteria 27530
57 Ga0081455_10094209 3300005937 Bacteria 2419
58 Ga0081539_10017380 3300005985 Bacteria 5054
59 Ga0075365_10045437 3300006038 Bacteria 2881
60 Ga0075368_10075457 3300006042 Bacteria 1367
61 Ga0075364_10012976 3300006051 Bacteria 5113
62 Ga0070712_100153811 3300006175 Bacteria 1769
63 Ga0097621_100075314 3300006237 Bacteria 2797
64 Ga0068871_100180037 3300006358 Bacteria 1816
65 Ga0068871_100210104 3300006358 Bacteria 1683
66 Ga0075430_101431747 3300006846 Bacteria 568
67 Ga0075431_100374469 3300006847 Bacteria 1429
68 Ga0105250_10272521 3300009092 Bacteria 727
69 Ga0105245_10000016 3300009098 Bacteria 204372
70 Ga0105245_10002273 3300009098 Bacteria 17380
71 Ga0105245_10002516 3300009098 Bacteria 16526
72 Ga0105245_10041043 3300009098 Bacteria 4124
73 Ga0105247_10000393 3300009101 Bacteria 37140
74 Ga0105247_10026982 3300009101 Bacteria 3472
75 Ga0114129_10550437 3300009147 Bacteria 1500
76 Ga0114129_10933648 3300009147 Bacteria 1097
77 Ga0105243_10061927 3300009148 Bacteria 2994
78 Ga0105243_10559038 3300009148 Bacteria 1094
79 Ga0105242_10000893 3300009176 Bacteria 23179
80 Ga0105242_10016681 3300009176 Bacteria 5713
81 Ga0105242_10284841 3300009176 Bacteria 1502
82 Ga0105242_11590899 3300009176 Bacteria 687
83 Ga0105249_10000068 3300009553 Bacteria 148594
84 Ga0105249_10073937 3300009553 Bacteria 3154
85 Ga0105033_103659 3300009986 Bacteria 1298
86 Ga0105239_10503225 3300010375 Bacteria 1377
87 Ga0105239_11094898 3300010375 Bacteria 917
88 Ga0105246_10560908 3300011119 Bacteria 980
89 Ga0157373_10912814 3300013100 Bacteria 652
90 Ga0157370_10819718 3300013104 Bacteria 846
91 Ga0157369_10000110 3300013105 Bacteria 115514
92 Ga0157378_10012156 3300013297 Bacteria 7538
93 Ga0163162_10385727 3300013306 Bacteria 1534
94 Ga0163162_12096304 3300013306 Bacteria 649
95 Ga0157375_10000112 3300013308 Bacteria 79146
96 Ga0157375_10013392 3300013308 Bacteria 7296
97 Ga0163163_11562365 3300014325 Bacteria 721
98 Ga0157380_10000093 3300014326 Bacteria 48915
99 Ga0157380_10000408 3300014326 Bacteria 26076
100 Ga0157377_11047363 3300014745 Bacteria 621
101 Ga0157379_10011898 3300014968 Bacteria 7603
102 Ga0157379_10081052 3300014968 Bacteria 2907
103 Ga0157379_10913928 3300014968 Bacteria 833
104 Ga0163161_10168060 3300017792 Bacteria 1676
105 Ga0163161_10432419 3300017792 Bacteria 1061
106 Ga0206356_10271379 3300020070 Bacteria 4405
107 Ga0207656_10001033 3300025321 Bacteria 9088
108 Ga0207682_10000031 3300025893 Bacteria 57806
109 Ga0207642_10057799 3300025899 Bacteria 1786
110 Ga0207710_10001665 3300025900 Bacteria 10816
111 Ga0207710_10017087 3300025900 Bacteria 3075
112 Ga0207680_10002602 3300025903 Bacteria 8417
113 Ga0207684_11037080 3300025910 Bacteria 685
114 Ga0207707_10081222 3300025912 Bacteria 2830
115 Ga0207693_10007557 3300025915 Bacteria 8931
116 Ga0207660_10165358 3300025917 Bacteria 1709
117 Ga0207649_10000063 3300025920 Bacteria 96360
118 Ga0207652_10000349 3300025921 Bacteria 47896
119 Ga0207650_10169990 3300025925 Bacteria 1732
120 Ga0207659_10000010 3300025926 Bacteria 286639
121 Ga0207687_10000007 3300025927 Bacteria 604185
122 Ga0207687_10000018 3300025927 Bacteria 236159
123 Ga0207687_10000177 3300025927 Bacteria 42164
124 Ga0207687_11268819 3300025927 Bacteria 633
125 Ga0207664_10502348 3300025929 Bacteria 1086
126 Ga0207644_10633404 3300025931 Bacteria 889
127 Ga0207690_10431558 3300025932 Bacteria 1056
128 Ga0207686_10000033 3300025934 Bacteria 143602
129 Ga0207686_10000505 3300025934 Bacteria 25546
130 Ga0207686_10025200 3300025934 Bacteria 3456
131 Ga0207686_10210749 3300025934 Unclassified 1397
132 Ga0207709_10033982 3300025935 Bacteria 3000
133 Ga0207709_11045128 3300025935 Bacteria 669
134 Ga0207670_10567530 3300025936 Bacteria 929
135 Ga0207669_10000004 3300025937 Bacteria 196828
136 Ga0207704_10000236 3300025938 Bacteria 27317
137 Ga0207711_10410955 3300025941 Bacteria 1258
138 Ga0207661_10000095 3300025944 Bacteria 56458
139 Ga0207661_10001779 3300025944 Bacteria 14743
140 Ga0207661_10010418 3300025944 Bacteria 6691
141 Ga0207661_10050985 3300025944 Bacteria 3300
142 Ga0207679_10495576 3300025945 Bacteria 1089
143 Ga0207667_10719070 3300025949 Bacteria 1000
144 Ga0207651_10000460 3300025960 Bacteria 17106
145 Ga0207712_10000007 3300025961 Bacteria 539589
146 Ga0207712_10188583 3300025961 Bacteria 1626
147 Ga0207712_10394225 3300025961 Bacteria 1162
148 Ga0207668_10013681 3300025972 Bacteria 5006
149 Ga0207640_10034680 3300025981 Bacteria 3151
150 Ga0207658_10102136 3300025986 Bacteria 2248
151 Ga0207703_10000023 3300026035 Bacteria 222018
152 Ga0207703_10000040 3300026035 Bacteria 168191
153 Ga0207703_10248322 3300026035 Bacteria 1603
154 Ga0207639_10046572 3300026041 Bacteria 3273
155 Ga0207702_10000060 3300026078 Bacteria 125473
156 Ga0207702_10005811 3300026078 Bacteria 10731
157 Ga0207702_10164937 3300026078 Bacteria 2026
158 Ga0207702_10212290 3300026078 Unclassified 1800
159 Ga0207641_10355352 3300026088 Bacteria 1397
160 Ga0207648_10000766 3300026089 Bacteria 36117
161 Ga0207648_10098838 3300026089 Bacteria 2555
162 Ga0207648_10460910 3300026089 Bacteria 1158
163 Ga0207683_10111693 3300026121 Bacteria 2447
164 Ga0207698_10000012 3300026142 Bacteria 260061
165 Ga0207698_10014991 3300026142 Bacteria 5175
166 Ga0268266_10000047 3300028379 Bacteria 310996
167 Ga0268266_10022322 3300028379 Bacteria 5394
168 Ga0268266_10036577 3300028379 Bacteria 4180
169 Ga0268266_10077557 3300028379 Bacteria 2889
170 Ga0268266_10253266 3300028379 Bacteria 1629
171 Ga0268266_11667964 3300028379 Bacteria 613
172 Ga0268265_10001017 3300028380 Bacteria 25271
173 Ga0268265_11291589 3300028380 Bacteria 730
174 Ga0268264_10162342 3300028381 Bacteria 2014
175 Ga0265319_1000025 3300028563 Bacteria 142639
176 Ga0265338_10000473 3300028800 Bacteria 71777
177 Ga0307511_10064940 3300030521 Bacteria 2738
178 Ga0265325_10045392 3300031241 Bacteria 2283
179 Ga0265331_10042078 3300031250 Bacteria 2217
180 Ga0265327_10300504 3300031251 Bacteria 707
181 Ga0307415_100074049 3300032126 Bacteria 2405
182 Ga0316583_10094205 3300032133 Bacteria 1044
183 Ga0316583_10199743 3300032133 Bacteria 694
184 Ga0373957_0254598 3300035120 Bacteria 739
185 Ga0373955_0658970 3300035172 Bacteria 642
186 Ga0373933_0216470 3300035724 Bacteria 1228
187 Ga0373937_0342227 3300036401 Bacteria 1416
188 Ga0395900_0444789 3300037418 Bacteria 1253
189 Ga0436364_1239672 3300037853 Bacteria 705
190 Ga0451833_0680149 3300041491 Bacteria 1384
191 Ga0451839_0851673 3300041496 Bacteria 3544
192 Ga0451853_3015507 3300041512 Bacteria 1495
193 Ga0451853_3469497 3300041512 Bacteria 1485
194 Ga0466963_0089795 3300044694 Bacteria 2091
195 Ga0466957_0011141 3300044842 Bacteria 5178
196 Ga0466967_0000065 3300045976 Bacteria 39018
197 Ga0495592_0000036 3300046454 Bacteria 125461
198 Ga0495592_0098344 3300046454 Bacteria 2089
199 Ga0495592_0229994 3300046454 Bacteria 1235
200 Ga0495603_0009565 3300046455 Bacteria 5858
201 Ga0495590_0341302 3300046457 Bacteria 568
202 Ga0495629_0001591 3300046459 Bacteria 17859
203 Ga0495629_0002306 3300046459 Bacteria 14717
204 Ga0495638_0011100 3300046460 Bacteria 6227
205 Ga0495641_0000044 3300046461 Bacteria 77415
206 Ga0495641_0089564 3300046461 Bacteria 1375
207 Ga0495641_0136955 3300046461 Bacteria 1093
208 Ga0495651_0056753 3300046462 Bacteria 3007
209 Ga0495653_0065815 3300046463 Bacteria 2727
210 Ga0495662_0012288 3300046476 Bacteria 4181
211 Ga0495664_0899471 3300046477 Bacteria 518
212 Ga0495596_0183127 3300046500 Bacteria 814
213 Ga0495606_0000752 3300046507 Bacteria 50099
214 Ga0495620_0000144 3300046515 Bacteria 58204
215 Ga0495628_0001219 3300046516 Bacteria 23555
216 Ga0495628_0002850 3300046516 Bacteria 15497
217 Ga0495628_0063493 3300046516 Bacteria 2893
218 Ga0495630_0000056 3300046517 Bacteria 91477
219 Ga0495630_0004181 3300046517 Bacteria 10108
220 Ga0495630_0020497 3300046517 Bacteria 4875
221 Ga0495637_0184269 3300046520 Bacteria 773
222 Ga0495644_0000985 3300046523 Bacteria 11830
223 Ga0495652_0000019 3300046529 Bacteria 190248
224 Ga0495652_0658865 3300046529 Bacteria 708
225 Ga0495640_0009074 3300046533 Bacteria 7758
226 Ga0495640_0009622 3300046533 Bacteria 7518
227 Ga0495587_0033929 3300046536 Bacteria 3079
228 Ga0495598_0016264 3300046537 Bacteria 1895
229 Ga0495645_0184023 3300046543 Bacteria 1429
230 Ga0495645_0426074 3300046543 Bacteria 841
231 Ga0495667_0133595 3300046559 Bacteria 1600
232 Ga0495656_0339121 3300046615 Bacteria 777
233 Ga0495634_0094136 3300046642 Bacteria 1942
234 Ga0495634_0233676 3300046642 Bacteria 1130
235 Ga0495625_0000766 3300046660 Bacteria 44778
236 Ga0495635_0000016 3300046663 Bacteria 214088
237 Ga0495635_0010919 3300046663 Bacteria 6367
238 Ga0495588_0000165 3300046674 Bacteria 85841
239 Ga0495647_0000008 3300046681 Bacteria 101193
240 Ga0495647_0000511 3300046681 Bacteria 11317
241 Ga0495647_0056561 3300046681 Bacteria 1538
242 Ga0495658_0003907 3300046683 Bacteria 7364
243 Ga0495669_0000088 3300046684 Bacteria 61314
244 Ga0495669_0403423 3300046684 Bacteria 663
245 Ga0495613_0000203 3300046689 Bacteria 58232
246 Ga0495613_0040417 3300046689 Bacteria 3456
247 Ga0495613_0179642 3300046689 Bacteria 1499
248 Ga0495624_0000267 3300046690 Bacteria 41318
249 Ga0495624_0465935 3300046690 Bacteria 757
250 Ga0495649_0000554 3300046694 Bacteria 31688
251 Ga0495600_0232695 3300046809 Bacteria 1176
252 Ga0495604_0000019 3300047317 Bacteria 175064
253 Ga0495674_0000251 3300047319 Bacteria 45351
254 Ga0495672_0067403 3300047320 Bacteria 2039
255 Ga0495672_0226053 3300047320 Bacteria 921
256 Ga0495676_0000299 3300047321 Bacteria 40098
257 Ga0495676_0002794 3300047321 Bacteria 15713
258 Ga0495676_0028453 3300047321 Bacteria 4771
259 Ga0495676_0053466 3300047321 Bacteria 3218
260 Ga0495676_0071460 3300047321 Bacteria 2668
261 Ga0495676_0146628 3300047321 Bacteria 1685
262 Ga0495680_0003349 3300047322 Bacteria 15838
263 Ga0495680_0072561 3300047322 Bacteria 2618
264 Ga0495680_0202820 3300047322 Bacteria 1422
265 Ga0495675_0011895 3300047444 Bacteria 5469
266 Ga0495679_014302 3300047446 Bacteria 2946
267 Ga0495686_0083069 3300047472 Bacteria 1954
268 Ga0495593_0022777 3300047673 Bacteria 3485
269 Ga0495593_0183209 3300047673 Bacteria 1054
270 Ga0495602_0069036 3300048088 Bacteria 3032
271 Ga0495602_0268488 3300048088 Bacteria 1262
272 Ga0496100_0000002 3300048903 Bacteria 489057
273 Ga0496100_0000018 3300048903 Bacteria 162451
274 Ga0496101_0000001 3300048904 Bacteria 489057
275 Ga0496101_0000062 3300048904 Bacteria 126595
276 Ga0496102_0000039 3300048905 Bacteria 198306
277 Ga0496102_0107249 3300048905 Bacteria 2601
278 Ga0496102_0775855 3300048905 Bacteria 881
279 Ga0496103_0000008 3300048906 Bacteria 340474
280 Ga0496103_0123816 3300048906 Bacteria 1648
281 Ga0496104_0000009 3300048907 Bacteria 488055
282 Ga0496105_0000027 3300048908 Bacteria 148197
283 Ga0496106_0000098 3300048909 Bacteria 66098
284 Ga0496106_0000145 3300048909 Bacteria 52447
285 Ga0496107_0000006 3300048910 Bacteria 258746
286 Ga0496107_0000013 3300048910 Bacteria 178284
287 Ga0496107_0646248 3300048910 Bacteria 780
288 Ga0496108_0000062 3300048911 Bacteria 122391
289 Ga0496108_0001785 3300048911 Bacteria 17141
290 Ga0496108_0001921 3300048911 Bacteria 16645
291 Ga0496108_0002120 3300048911 Bacteria 15892
292 Ga0496109_0000007 3300048912 Bacteria 247554
293 Ga0496109_0000168 3300048912 Bacteria 64462
294 Ga0496109_0003727 3300048912 Bacteria 12737
295 Ga0496109_0159050 3300048912 Bacteria 2116
296 Ga0496110_0005580 3300048913 Bacteria 9877
297 Ga0496110_0208823 3300048913 Bacteria 1775
298 Ga0496110_0557756 3300048913 Bacteria 1041
299 Ga0496111_0034618 3300048914 Bacteria 3607
300 Ga0496111_0637852 3300048914 Bacteria 778
301 Ga0496113_0004279 3300048916 Bacteria 8748
302 Ga0496114_0000014 3300048917 Bacteria 297902
303 Ga0496114_0036910 3300048917 Bacteria 4040
304 Ga0496114_0610730 3300048917 Bacteria 961
305 Ga0496115_0000003 3300048918 Bacteria 354994
306 Ga0496115_0000125 3300048918 Bacteria 69936
307 Ga0496116_0251226 3300048919 Bacteria 880
308 Ga0501031_0372047 3300049568 Bacteria 924
309 Ga0501032_0079729 3300049569 Bacteria 2179
310 Ga0501033_0037099 3300049570 Bacteria 3649
311 Ga0501034_0488046 3300049571 Bacteria 1147
312 Ga0501036_0623693 3300049572 Bacteria 893
313 Ga0501037_0147619 3300049573 Bacteria 1681
314 Ga0501038_0519694 3300049574 Bacteria 908
315 Ga0501039_0263914 3300049575 Bacteria 1353
316 Ga0501039_1006808 3300049575 Bacteria 647
317 Ga0501040_0119344 3300049576 Bacteria 1850
318 Ga0501040_0519663 3300049576 Bacteria 858
319 Ga0501042_0016287 3300049578 Bacteria 5102
320 Ga0501042_0169040 3300049578 Bacteria 1578
321 Ga0501043_0248210 3300049579 Bacteria 1372
322 Ga0501046_0433476 3300049580 Bacteria 946
323 Ga0501047_0582467 3300049581 Bacteria 941
324 Ga0501048_0057489 3300049582 Bacteria 2759
325 Ga0501048_0567343 3300049582 Bacteria 814
326 Ga0501068_0080902 3300049584 Bacteria 1994
327 Ga0501068_0460255 3300049584 Bacteria 823
328 Ga0501069_0420241 3300049585 Bacteria 792
329 Ga0501070_0004059 3300049586 Bacteria 12581
330 Ga0501070_0393511 3300049586 Bacteria 1121
331 Ga0501071_0286749 3300049587 Bacteria 1246
332 Ga0501072_0088574 3300049588 Bacteria 2456
333 Ga0501073_0320979 3300049589 Bacteria 1069
334 Ga0501073_0614409 3300049589 Bacteria 750
335 Ga0501074_0746071 3300049590 Bacteria 690
336 Ga0501075_0036263 3300049591 Bacteria 3680
337 Ga0501076_0170789 3300049592 Bacteria 1772
338 Ga0501079_0967876 3300049741 Bacteria 670
339 Ga0501080_0024675 3300049742 Bacteria 5576
340 Ga0501035_0009143 3300049822 Bacteria 9215
341 Ga0501044_0011985 3300049823 Bacteria 9392
342 Ga0501045_0021708 3300049824 Bacteria 4595
343 nmdc:mga00v17_22597_c1 3300050491 Bacteria 3630
344 nmdc:mga0yw44_126845_c1 3300050492 Bacteria 1649
345 nmdc:mga0yw44_7714_c1 3300050492 Bacteria 5313
346 nmdc:mga04h51_116590_c1 3300050495 Bacteria 990
347 nmdc:mga05p37_445709_c1 3300050507 Bacteria 1500
348 nmdc:mga05p37_493983_c1 3300050507 Bacteria 1406
349 nmdc:mga06r32_1033331_c1 3300050510 Bacteria 773
350 nmdc:mga08y16_246485_c1 3300050511 Unclassified 1846
351 Ga0495601_0000326 3300053077 Bacteria 25282
352 Ga0495612_0000915 3300053078 Bacteria 12062
353 Ga0495612_0009906 3300053078 Bacteria 3860
354 Ga0495612_0144758 3300053078 Bacteria 1032
355 Ga0495655_0000001 3300053083 Bacteria 419518
356 Ga0495595_0000172 3300053084 Bacteria 25608
357 Ga0495619_0000021 3300053085 Bacteria 187095
358 Ga0495619_0000589 3300053085 Bacteria 24114
359 Ga0495619_0001139 3300053085 Bacteria 17465
360 Ga0500566_0009974 3300053094 Bacteria 5608
361 Ga0500641_0040526 3300053096 Bacteria 1881
362 Ga0500614_000324 3300053123 Bacteria 12378
363 Ga0500628_000010 3300053129 Bacteria 122210
364 Ga0501082_0921127 3300060353 Bacteria 764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047673 Ga0495593_0022777 Ga0495593_0022777_502_975 131
2 3300047673 Ga0495593_0183209 Ga0495593_0183209_570_1043 131
3 3300047322 Ga0495680_0202820 Ga0495680_0202820_538_1011 132
4 3300053078 Ga0495612_0000915 Ga0495612_0000915_5624_6097 132
5 3300009147 Ga0114129_10550437 Ga0114129_105504372 133
6 3300028379 Ga0268266_11667964 Ga0268266_116679641 133
7 3300050507 nmdc:mga05p37_445709_c1 nmdc:mga05p37_445709_c1_266_739 133
8 3300005578 Ga0068854_100038451 Ga0068854_1000384513 136
9 3300005614 Ga0068856_100201243 Ga0068856_1002012432 136
10 3300025981 Ga0207640_10034680 Ga0207640_100346803 136
11 3300026078 Ga0207702_10164937 Ga0207702_101649372 136
12 3300041496 Ga0451839_0851673 Ga0451839_0851673_451_924 136
13 3300046684 Ga0495669_0000088 Ga0495669_0000088_56831_57304 136
14 3300009092 Ga0105250_10272521 Ga0105250_102725212 142
15 3300006038 Ga0075365_10045437 Ga0075365_100454373 143
16 3300006042 Ga0075368_10075457 Ga0075368_100754572 143
17 3300006051 Ga0075364_10012976 Ga0075364_100129763 143
18 3300026089 Ga0207648_10460910 Ga0207648_104609101 143
19 3300046615 Ga0495656_0339121 Ga0495656_0339121_246_713 143
20 3300049568 Ga0501031_0372047 Ga0501031_0372047_155_622 143
21 3300049569 Ga0501032_0079729 Ga0501032_0079729_1520_1987 143
22 3300049570 Ga0501033_0037099 Ga0501033_0037099_139_606 143
23 3300049571 Ga0501034_0488046 Ga0501034_0488046_299_766 143
24 3300049572 Ga0501036_0623693 Ga0501036_0623693_124_591 143
25 3300049573 Ga0501037_0147619 Ga0501037_0147619_136_603 143
26 3300049574 Ga0501038_0519694 Ga0501038_0519694_303_770 143
27 3300049575 Ga0501039_0263914 Ga0501039_0263914_805_1272 143
28 3300049576 Ga0501040_0519663 Ga0501040_0519663_126_593 143
29 3300049579 Ga0501043_0248210 Ga0501043_0248210_775_1242 143
30 3300049580 Ga0501046_0433476 Ga0501046_0433476_177_644 143
31 3300049581 Ga0501047_0582467 Ga0501047_0582467_303_770 143
32 3300049582 Ga0501048_0567343 Ga0501048_0567343_188_655 143
33 3300049584 Ga0501068_0460255 Ga0501068_0460255_252_719 143
34 3300049585 Ga0501069_0420241 Ga0501069_0420241_133_600 143
35 3300049586 Ga0501070_0393511 Ga0501070_0393511_352_819 143
36 3300049587 Ga0501071_0286749 Ga0501071_0286749_744_1211 143
37 3300049589 Ga0501073_0614409 Ga0501073_0614409_36_503 143
38 3300049590 Ga0501074_0746071 Ga0501074_0746071_113_580 143
39 3300049741 Ga0501079_0967876 Ga0501079_0967876_113_580 143
40 3300049742 Ga0501080_0024675 Ga0501080_0024675_66_533 143
41 3300049822 Ga0501035_0009143 Ga0501035_0009143_303_770 143
42 3300049823 Ga0501044_0011985 Ga0501044_0011985_303_770 143
43 3300049824 Ga0501045_0021708 Ga0501045_0021708_137_604 143
44 3300050491 nmdc:mga00v17_22597_c1 nmdc:mga00v17_22597_c1_1992_2459 143
45 3300050492 nmdc:mga0yw44_126845_c1 nmdc:mga0yw44_126845_c1_942_1409 143
46 3300050492 nmdc:mga0yw44_7714_c1 nmdc:mga0yw44_7714_c1_3132_3599 143
47 3300050495 nmdc:mga04h51_116590_c1 nmdc:mga04h51_116590_c1_364_831 143
48 3300060353 Ga0501082_0921127 Ga0501082_0921127_121_588 143
49 3300005341 Ga0070691_10192855 Ga0070691_101928552 144
50 3300005347 Ga0070668_100025413 Ga0070668_1000254133 144
51 3300005356 Ga0070674_100019260 Ga0070674_1000192604 144
52 3300005438 Ga0070701_10519251 Ga0070701_105192511 144
53 3300005444 Ga0070694_100903855 Ga0070694_1009038551 144
54 3300005459 Ga0068867_100087137 Ga0068867_1000871372 144
55 3300005985 Ga0081539_10017380 Ga0081539_100173804 144
56 3300006846 Ga0075430_101431747 Ga0075430_1014317471 144
57 3300006847 Ga0075431_100374469 Ga0075431_1003744692 144
58 3300009147 Ga0114129_10933648 Ga0114129_109336481 144
59 3300009148 Ga0105243_10559038 Ga0105243_105590382 144
60 3300009176 Ga0105242_11590899 Ga0105242_115908991 144
61 3300009553 Ga0105249_10073937 Ga0105249_100739374 144
62 3300009986 Ga0105033_103659 Ga0105033_1036591 144
63 3300013297 Ga0157378_10012156 Ga0157378_100121564 144
64 3300013306 Ga0163162_12096304 Ga0163162_120963042 144
65 3300017792 Ga0163161_10432419 Ga0163161_104324192 144
66 3300025899 Ga0207642_10057799 Ga0207642_100577992 144
67 3300025910 Ga0207684_11037080 Ga0207684_110370801 144
68 3300025927 Ga0207687_11268819 Ga0207687_112688191 144
69 3300025935 Ga0207709_11045128 Ga0207709_110451281 144
70 3300025936 Ga0207670_10567530 Ga0207670_105675302 144
71 3300025961 Ga0207712_10188583 Ga0207712_101885832 144
72 3300025961 Ga0207712_10394225 Ga0207712_103942252 144
73 3300025972 Ga0207668_10013681 Ga0207668_100136813 144
74 3300026089 Ga0207648_10098838 Ga0207648_100988384 144
75 3300028380 Ga0268265_11291589 Ga0268265_112915891 144
76 3300032126 Ga0307415_100074049 Ga0307415_1000740494 144
77 3300037418 Ga0395900_0444789 Ga0395900_0444789_72_539 144
78 3300046500 Ga0495596_0183127 Ga0495596_0183127_31_498 144
79 3300048905 Ga0496102_0000039 Ga0496102_0000039_159674_160195 144
80 3300048905 Ga0496102_0775855 Ga0496102_0775855_230_697 144
81 3300048906 Ga0496103_0000008 Ga0496103_0000008_280929_281450 144
82 3300048910 Ga0496107_0646248 Ga0496107_0646248_110_577 144
83 3300048911 Ga0496108_0000062 Ga0496108_0000062_38122_38556 144
84 3300048912 Ga0496109_0000007 Ga0496109_0000007_68282_68716 144
85 3300048913 Ga0496110_0208823 Ga0496110_0208823_230_697 144
86 3300048914 Ga0496111_0034618 Ga0496111_0034618_153_620 144
87 3300049589 Ga0501073_0320979 Ga0501073_0320979_196_660 144
88 3300050507 nmdc:mga05p37_493983_c1 nmdc:mga05p37_493983_c1_828_1295 144
89 3300050510 nmdc:mga06r32_1033331_c1 nmdc:mga06r32_1033331_c1_279_746 144
90 3300050511 nmdc:mga08y16_246485_c1 nmdc:mga08y16_246485_c1_736_1203 144
91 3300005331 Ga0070670_100070148 Ga0070670_1000701484 145
92 3300005344 Ga0070661_100000023 Ga0070661_10000002355 145
93 3300005345 Ga0070692_10209913 Ga0070692_102099132 145
94 3300005354 Ga0070675_100000101 Ga0070675_10000010142 145
95 3300005355 Ga0070671_101021113 Ga0070671_1010211131 145
96 3300005365 Ga0070688_100002163 Ga0070688_1000021637 145
97 3300005459 Ga0068867_100003840 Ga0068867_10000384013 145
98 3300005466 Ga0070685_10000127 Ga0070685_1000012742 145
99 3300005543 Ga0070672_100000027 Ga0070672_10000002717 145
100 3300005549 Ga0070704_100184774 Ga0070704_1001847742 145
101 3300005616 Ga0068852_100000156 Ga0068852_10000015646 145
102 3300005616 Ga0068852_100045492 Ga0068852_1000454923 145
103 3300005841 Ga0068863_100341471 Ga0068863_1003414711 145
104 3300005842 Ga0068858_100073944 Ga0068858_1000739444 145
105 3300006175 Ga0070712_100153811 Ga0070712_1001538113 145
106 3300009098 Ga0105245_10002516 Ga0105245_1000251615 145
107 3300010375 Ga0105239_10503225 Ga0105239_105032252 145
108 3300013100 Ga0157373_10912814 Ga0157373_109128141 145
109 3300013104 Ga0157370_10819718 Ga0157370_108197182 145
110 3300013105 Ga0157369_10000110 Ga0157369_1000011048 145
111 3300014325 Ga0163163_11562365 Ga0163163_115623652 145
112 3300025915 Ga0207693_10007557 Ga0207693_1000755713 145
113 3300025920 Ga0207649_10000063 Ga0207649_1000006330 145
114 3300025925 Ga0207650_10169990 Ga0207650_101699903 145
115 3300025926 Ga0207659_10000010 Ga0207659_10000010160 145
116 3300025927 Ga0207687_10000007 Ga0207687_10000007327 145
117 3300025931 Ga0207644_10633404 Ga0207644_106334042 145
118 3300026035 Ga0207703_10248322 Ga0207703_102483222 145
119 3300026078 Ga0207702_10005811 Ga0207702_100058115 145
120 3300026088 Ga0207641_10355352 Ga0207641_103553521 145
121 3300026089 Ga0207648_10000766 Ga0207648_1000076620 145
122 3300026142 Ga0207698_10000012 Ga0207698_1000001245 145
123 3300026142 Ga0207698_10014991 Ga0207698_100149917 145
124 3300028379 Ga0268266_10022322 Ga0268266_100223222 145
125 3300037853 Ga0436364_1239672 Ga0436364_1239672_220_690 145
126 3300045976 Ga0466967_0000065 Ga0466967_0000065_14839_15306 145
127 3300046457 Ga0495590_0341302 Ga0495590_0341302_61_531 145
128 3300046459 Ga0495629_0001591 Ga0495629_0001591_14369_14806 145
129 3300046459 Ga0495629_0002306 Ga0495629_0002306_9665_10135 145
130 3300046520 Ga0495637_0184269 Ga0495637_0184269_279_716 145
131 3300046660 Ga0495625_0000766 Ga0495625_0000766_39275_39742 145
132 3300046674 Ga0495588_0000165 Ga0495588_0000165_80003_80473 145
133 3300046809 Ga0495600_0232695 Ga0495600_0232695_619_1089 145
134 3300047321 Ga0495676_0002794 Ga0495676_0002794_8705_9175 145
135 3300048088 Ga0495602_0069036 Ga0495602_0069036_2470_2937 145
136 3300048903 Ga0496100_0000018 Ga0496100_0000018_72163_72633 145
137 3300048904 Ga0496101_0000062 Ga0496101_0000062_120594_121064 145
138 3300048905 Ga0496102_0107249 Ga0496102_0107249_376_846 145
139 3300048906 Ga0496103_0123816 Ga0496103_0123816_66_536 145
140 3300048909 Ga0496106_0000145 Ga0496106_0000145_51865_52335 145
141 3300048910 Ga0496107_0000006 Ga0496107_0000006_141086_141556 145
142 3300048911 Ga0496108_0001785 Ga0496108_0001785_11166_11603 145
143 3300048911 Ga0496108_0001921 Ga0496108_0001921_5929_6399 145
144 3300048912 Ga0496109_0000168 Ga0496109_0000168_5957_6427 145
145 3300048912 Ga0496109_0003727 Ga0496109_0003727_6730_7167 145
146 3300048919 Ga0496116_0251226 Ga0496116_0251226_172_642 145
147 3300049586 Ga0501070_0004059 Ga0501070_0004059_937_1407 145
148 3300049592 Ga0501076_0170789 Ga0501076_0170789_364_837 145
149 3300053094 Ga0500566_0009974 Ga0500566_0009974_2461_2931 145
150 3300002239 JGI24034J26672_10000104 JGI24034J26672_100001042 146
151 3300005329 Ga0070683_100003871 Ga0070683_10000387114 146
152 3300005329 Ga0070683_100019566 Ga0070683_1000195663 146
153 3300005329 Ga0070683_100070694 Ga0070683_1000706945 146
154 3300005335 Ga0070666_10076243 Ga0070666_100762432 146
155 3300005356 Ga0070674_100000008 Ga0070674_10000000848 146
156 3300005364 Ga0070673_100003790 Ga0070673_10000379010 146
157 3300005367 Ga0070667_100006509 Ga0070667_1000065094 146
158 3300005367 Ga0070667_100176137 Ga0070667_1001761372 146
159 3300005435 Ga0070714_100853365 Ga0070714_1008533651 146
160 3300005456 Ga0070678_100002401 Ga0070678_10000240112 146
161 3300005458 Ga0070681_10008992 Ga0070681_100089929 146
162 3300005530 Ga0070679_100000388 Ga0070679_1000003885 146
163 3300005535 Ga0070684_100029222 Ga0070684_1000292224 146
164 3300005535 Ga0070684_100142518 Ga0070684_1001425181 146
165 3300005539 Ga0068853_100019448 Ga0068853_1000194482 146
166 3300005544 Ga0070686_100433092 Ga0070686_1004330922 146
167 3300005548 Ga0070665_100000106 Ga0070665_100000106147 146
168 3300005548 Ga0070665_100071875 Ga0070665_1000718754 146
169 3300005548 Ga0070665_100106782 Ga0070665_1001067822 146
170 3300005549 Ga0070704_100301423 Ga0070704_1003014231 146
171 3300005564 Ga0070664_100221268 Ga0070664_1002212682 146
172 3300005577 Ga0068857_100927813 Ga0068857_1009278132 146
173 3300005614 Ga0068856_100001983 Ga0068856_1000019838 146
174 3300005718 Ga0068866_10000031 Ga0068866_1000003118 146
175 3300005834 Ga0068851_10012772 Ga0068851_100127725 146
176 3300005842 Ga0068858_100000216 Ga0068858_10000021663 146
177 3300005842 Ga0068858_100002989 Ga0068858_10000298912 146
178 3300005843 Ga0068860_100022494 Ga0068860_1000224947 146
179 3300005844 Ga0068862_100000973 Ga0068862_10000097317 146
180 3300005937 Ga0081455_10094209 Ga0081455_100942093 146
181 3300006358 Ga0068871_100210104 Ga0068871_1002101042 146
182 3300009098 Ga0105245_10002273 Ga0105245_100022737 146
183 3300009098 Ga0105245_10041043 Ga0105245_100410435 146
184 3300009101 Ga0105247_10026982 Ga0105247_100269823 146
185 3300009148 Ga0105243_10061927 Ga0105243_100619276 146
186 3300009176 Ga0105242_10000893 Ga0105242_1000089314 146
187 3300009176 Ga0105242_10016681 Ga0105242_100166819 146
188 3300009176 Ga0105242_10284841 Ga0105242_102848412 146
189 3300009553 Ga0105249_10000068 Ga0105249_10000068118 146
190 3300010375 Ga0105239_11094898 Ga0105239_110948982 146
191 3300011119 Ga0105246_10560908 Ga0105246_105609082 146
192 3300013306 Ga0163162_10385727 Ga0163162_103857271 146
193 3300013308 Ga0157375_10000112 Ga0157375_1000011213 146
194 3300013308 Ga0157375_10013392 Ga0157375_100133928 146
195 3300014326 Ga0157380_10000093 Ga0157380_1000009348 146
196 3300014326 Ga0157380_10000408 Ga0157380_1000040817 146
197 3300014745 Ga0157377_11047363 Ga0157377_110473631 146
198 3300014968 Ga0157379_10081052 Ga0157379_100810522 146
199 3300014968 Ga0157379_10913928 Ga0157379_109139281 146
200 3300017792 Ga0163161_10168060 Ga0163161_101680602 146
201 3300020070 Ga0206356_10271379 Ga0206356_102713795 146
202 3300025321 Ga0207656_10001033 Ga0207656_1000103312 146
203 3300025900 Ga0207710_10017087 Ga0207710_100170873 146
204 3300025903 Ga0207680_10002602 Ga0207680_100026022 146
205 3300025912 Ga0207707_10081222 Ga0207707_100812222 146
206 3300025917 Ga0207660_10165358 Ga0207660_101653583 146
207 3300025921 Ga0207652_10000349 Ga0207652_1000034914 146
208 3300025927 Ga0207687_10000177 Ga0207687_1000017719 146
209 3300025929 Ga0207664_10502348 Ga0207664_105023482 146
210 3300025932 Ga0207690_10431558 Ga0207690_104315582 146
211 3300025934 Ga0207686_10000033 Ga0207686_1000003378 146
212 3300025934 Ga0207686_10025200 Ga0207686_100252003 146
213 3300025934 Ga0207686_10210749 Ga0207686_102107492 146
214 3300025935 Ga0207709_10033982 Ga0207709_100339823 146
215 3300025937 Ga0207669_10000004 Ga0207669_10000004160 146
216 3300025938 Ga0207704_10000236 Ga0207704_1000023619 146
217 3300025941 Ga0207711_10410955 Ga0207711_104109553 146
218 3300025944 Ga0207661_10000095 Ga0207661_1000009551 146
219 3300025944 Ga0207661_10001779 Ga0207661_100017799 146
220 3300025944 Ga0207661_10010418 Ga0207661_100104185 146
221 3300025944 Ga0207661_10050985 Ga0207661_100509853 146
222 3300025945 Ga0207679_10495576 Ga0207679_104955761 146
223 3300025949 Ga0207667_10719070 Ga0207667_107190702 146
224 3300025960 Ga0207651_10000460 Ga0207651_1000046013 146
225 3300025961 Ga0207712_10000007 Ga0207712_10000007270 146
226 3300025986 Ga0207658_10102136 Ga0207658_101021363 146
227 3300026035 Ga0207703_10000023 Ga0207703_10000023209 146
228 3300026035 Ga0207703_10000040 Ga0207703_10000040160 146
229 3300026041 Ga0207639_10046572 Ga0207639_100465724 146
230 3300026078 Ga0207702_10212290 Ga0207702_102122902 146
231 3300026121 Ga0207683_10111693 Ga0207683_101116933 146
232 3300028379 Ga0268266_10000047 Ga0268266_10000047299 146
233 3300028379 Ga0268266_10036577 Ga0268266_100365775 146
234 3300028379 Ga0268266_10077557 Ga0268266_100775574 146
235 3300028379 Ga0268266_10253266 Ga0268266_102532662 146
236 3300028380 Ga0268265_10001017 Ga0268265_1000101712 146
237 3300028381 Ga0268264_10162342 Ga0268264_101623423 146
238 3300028563 Ga0265319_1000025 Ga0265319_100002542 146
239 3300028800 Ga0265338_10000473 Ga0265338_1000047335 146
240 3300030521 Ga0307511_10064940 Ga0307511_100649403 146
241 3300031241 Ga0265325_10045392 Ga0265325_100453922 146
242 3300031250 Ga0265331_10042078 Ga0265331_100420784 146
243 3300031251 Ga0265327_10300504 Ga0265327_103005041 146
244 3300032133 Ga0316583_10094205 Ga0316583_100942052 146
245 3300032133 Ga0316583_10199743 Ga0316583_101997432 146
246 3300035120 Ga0373957_0254598 Ga0373957_0254598_128_601 146
247 3300035172 Ga0373955_0658970 Ga0373955_0658970_134_607 146
248 3300035724 Ga0373933_0216470 Ga0373933_0216470_666_1139 146
249 3300036401 Ga0373937_0342227 Ga0373937_0342227_871_1344 146
250 3300041491 Ga0451833_0680149 Ga0451833_0680149_721_1194 146
251 3300041512 Ga0451853_3015507 Ga0451853_3015507_688_1161 146
252 3300041512 Ga0451853_3469497 Ga0451853_3469497_72_545 146
253 3300044694 Ga0466963_0089795 Ga0466963_0089795_14_454 146
254 3300046454 Ga0495592_0000036 Ga0495592_0000036_107043_107483 146
255 3300046454 Ga0495592_0098344 Ga0495592_0098344_1446_1886 146
256 3300046454 Ga0495592_0229994 Ga0495592_0229994_425_898 146
257 3300046455 Ga0495603_0009565 Ga0495603_0009565_2119_2592 146
258 3300046460 Ga0495638_0011100 Ga0495638_0011100_1554_1994 146
259 3300046461 Ga0495641_0000044 Ga0495641_0000044_26892_27365 146
260 3300046461 Ga0495641_0136955 Ga0495641_0136955_384_824 146
261 3300046462 Ga0495651_0056753 Ga0495651_0056753_2338_2811 146
262 3300046463 Ga0495653_0065815 Ga0495653_0065815_1436_1909 146
263 3300046476 Ga0495662_0012288 Ga0495662_0012288_2565_3038 146
264 3300046477 Ga0495664_0899471 Ga0495664_0899471_20_493 146
265 3300046507 Ga0495606_0000752 Ga0495606_0000752_42524_42997 146
266 3300046515 Ga0495620_0000144 Ga0495620_0000144_50089_50562 146
267 3300046516 Ga0495628_0001219 Ga0495628_0001219_1907_2380 146
268 3300046516 Ga0495628_0002850 Ga0495628_0002850_3743_4216 146
269 3300046516 Ga0495628_0063493 Ga0495628_0063493_245_718 146
270 3300046517 Ga0495630_0000056 Ga0495630_0000056_22941_23381 146
271 3300046517 Ga0495630_0004181 Ga0495630_0004181_1720_2193 146
272 3300046517 Ga0495630_0020497 Ga0495630_0020497_3482_3955 146
273 3300046523 Ga0495644_0000985 Ga0495644_0000985_8941_9414 146
274 3300046529 Ga0495652_0000019 Ga0495652_0000019_51284_51757 146
275 3300046533 Ga0495640_0009074 Ga0495640_0009074_6057_6530 146
276 3300046533 Ga0495640_0009622 Ga0495640_0009622_2441_2914 146
277 3300046536 Ga0495587_0033929 Ga0495587_0033929_2127_2600 146
278 3300046543 Ga0495645_0184023 Ga0495645_0184023_721_1194 146
279 3300046543 Ga0495645_0426074 Ga0495645_0426074_186_659 146
280 3300046559 Ga0495667_0133595 Ga0495667_0133595_746_1219 146
281 3300046642 Ga0495634_0094136 Ga0495634_0094136_319_792 146
282 3300046642 Ga0495634_0233676 Ga0495634_0233676_670_1110 146
283 3300046663 Ga0495635_0000016 Ga0495635_0000016_116037_116510 146
284 3300046663 Ga0495635_0010919 Ga0495635_0010919_323_796 146
285 3300046681 Ga0495647_0000008 Ga0495647_0000008_90409_90882 146
286 3300046681 Ga0495647_0056561 Ga0495647_0056561_393_866 146
287 3300046684 Ga0495669_0403423 Ga0495669_0403423_106_576 146
288 3300046689 Ga0495613_0000203 Ga0495613_0000203_4289_4762 146
289 3300046689 Ga0495613_0040417 Ga0495613_0040417_631_1104 146
290 3300046690 Ga0495624_0000267 Ga0495624_0000267_6036_6476 146
291 3300046690 Ga0495624_0465935 Ga0495624_0465935_264_737 146
292 3300046694 Ga0495649_0000554 Ga0495649_0000554_8088_8561 146
293 3300047317 Ga0495604_0000019 Ga0495604_0000019_109661_110134 146
294 3300047319 Ga0495674_0000251 Ga0495674_0000251_37849_38322 146
295 3300047320 Ga0495672_0067403 Ga0495672_0067403_145_585 146
296 3300047320 Ga0495672_0226053 Ga0495672_0226053_215_688 146
297 3300047321 Ga0495676_0000299 Ga0495676_0000299_31083_31562 146
298 3300047321 Ga0495676_0028453 Ga0495676_0028453_2632_3105 146
299 3300047321 Ga0495676_0053466 Ga0495676_0053466_1194_1634 146
300 3300047321 Ga0495676_0146628 Ga0495676_0146628_824_1297 146
301 3300047322 Ga0495680_0003349 Ga0495680_0003349_6336_6809 146
302 3300047322 Ga0495680_0072561 Ga0495680_0072561_326_799 146
303 3300047444 Ga0495675_0011895 Ga0495675_0011895_4355_4828 146
304 3300047446 Ga0495679_014302 Ga0495679_014302_762_1235 146
305 3300047472 Ga0495686_0083069 Ga0495686_0083069_172_612 146
306 3300048088 Ga0495602_0268488 Ga0495602_0268488_286_759 146
307 3300048911 Ga0496108_0002120 Ga0496108_0002120_10516_10989 146
308 3300048912 Ga0496109_0159050 Ga0496109_0159050_723_1196 146
309 3300048913 Ga0496110_0005580 Ga0496110_0005580_4521_4994 146
310 3300048913 Ga0496110_0557756 Ga0496110_0557756_471_944 146
311 3300048914 Ga0496111_0637852 Ga0496111_0637852_106_579 146
312 3300048916 Ga0496113_0004279 Ga0496113_0004279_4234_4707 146
313 3300048917 Ga0496114_0000014 Ga0496114_0000014_200560_201033 146
314 3300048917 Ga0496114_0036910 Ga0496114_0036910_2974_3447 146
315 3300048917 Ga0496114_0610730 Ga0496114_0610730_424_897 146
316 3300048918 Ga0496115_0000003 Ga0496115_0000003_249887_250360 146
317 3300048918 Ga0496115_0000125 Ga0496115_0000125_22219_22692 146
318 3300049575 Ga0501039_1006808 Ga0501039_1006808_13_453 146
319 3300049576 Ga0501040_0119344 Ga0501040_0119344_144_620 146
320 3300049578 Ga0501042_0169040 Ga0501042_0169040_1059_1532 146
321 3300049582 Ga0501048_0057489 Ga0501048_0057489_512_988 146
322 3300049584 Ga0501068_0080902 Ga0501068_0080902_936_1376 146
323 3300049588 Ga0501072_0088574 Ga0501072_0088574_1507_1983 146
324 3300049591 Ga0501075_0036263 Ga0501075_0036263_974_1447 146
325 3300053077 Ga0495601_0000326 Ga0495601_0000326_125_598 146
326 3300053078 Ga0495612_0009906 Ga0495612_0009906_155_595 146
327 3300053078 Ga0495612_0144758 Ga0495612_0144758_547_1020 146
328 3300053083 Ga0495655_0000001 Ga0495655_0000001_130891_131364 146
329 3300053084 Ga0495595_0000172 Ga0495595_0000172_15150_15623 146
330 3300053085 Ga0495619_0000021 Ga0495619_0000021_169348_169821 146
331 3300053085 Ga0495619_0000589 Ga0495619_0000589_21998_22471 146
332 3300053085 Ga0495619_0001139 Ga0495619_0001139_14606_15079 146
333 3300053096 Ga0500641_0040526 Ga0500641_0040526_896_1369 146
334 3300053123 Ga0500614_000324 Ga0500614_000324_10231_10704 146
335 3300053129 Ga0500628_000010 Ga0500628_000010_5092_5565 146
336 3300001979 JGI24740J21852_10005942 JGI24740J21852_100059426 147
337 3300005333 Ga0070677_10000004 Ga0070677_1000000413 147
338 3300005435 Ga0070714_101442416 Ga0070714_1014424162 147
339 3300005614 Ga0068856_100000577 Ga0068856_10000057721 147
340 3300006237 Ga0097621_100075314 Ga0097621_1000753143 147
341 3300006358 Ga0068871_100180037 Ga0068871_1001800373 147
342 3300009098 Ga0105245_10000016 Ga0105245_1000001680 147
343 3300009101 Ga0105247_10000393 Ga0105247_1000039315 147
344 3300014968 Ga0157379_10011898 Ga0157379_100118987 147
345 3300025893 Ga0207682_10000031 Ga0207682_1000003154 147
346 3300025900 Ga0207710_10001665 Ga0207710_1000166515 147
347 3300025927 Ga0207687_10000018 Ga0207687_10000018144 147
348 3300025934 Ga0207686_10000505 Ga0207686_1000050538 147
349 3300026078 Ga0207702_10000060 Ga0207702_1000006081 147
350 3300044842 Ga0466957_0011141 Ga0466957_0011141_270_746 147
351 3300046461 Ga0495641_0089564 Ga0495641_0089564_88_564 147
352 3300046529 Ga0495652_0658865 Ga0495652_0658865_10_489 147
353 3300046537 Ga0495598_0016264 Ga0495598_0016264_116_592 147
354 3300046681 Ga0495647_0000511 Ga0495647_0000511_2961_3434 147
355 3300046683 Ga0495658_0003907 Ga0495658_0003907_4241_4714 147
356 3300046689 Ga0495613_0179642 Ga0495613_0179642_385_861 147
357 3300047321 Ga0495676_0071460 Ga0495676_0071460_1406_1852 147
358 3300048903 Ga0496100_0000002 Ga0496100_0000002_262041_262526 147
359 3300048904 Ga0496101_0000001 Ga0496101_0000001_262041_262526 147
360 3300048907 Ga0496104_0000009 Ga0496104_0000009_142897_143373 147
361 3300048908 Ga0496105_0000027 Ga0496105_0000027_5152_5628 147
362 3300048909 Ga0496106_0000098 Ga0496106_0000098_1548_2033 147
363 3300048910 Ga0496107_0000013 Ga0496107_0000013_89763_90248 147
364 3300049578 Ga0501042_0016287 Ga0501042_0016287_637_1110 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

29

155

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.9366 2 142
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.8883 2 142
4ffu-assembly2.cif.gz_K crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8659 9 139
4e3e-assembly1.cif.gz_A crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl 0.8508 5 144
1q6w-assembly2.cif.gz_C x-ray structure of monoamine oxidase regulatory protein from archaeoglobus fulgius 0.8492 5 145
ID Description Score Start End Superfamily
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9581 1 141 3.10.129.10
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9353 2 142 3.10.129.10
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9139 1 141 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8739 5 143 3.10.129.10
4ffuK00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8626 9 139 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A538IFD0-F1-model_v4 MaoC family dehydratase 0.997 3 144
AF-A0A7V9GS93-F1-model_v4 MaoC family dehydratase 0.9927 3 144
AF-A0A2T2ZNJ6-F1-model_v4 Dehydratase 0.9823 2 142
AF-A0A1A2D8V3-F1-model_v4 Dehydratase 0.9811 2 142
AF-A0A1R0UQA5-F1-model_v4 Dehydratase 0.9809 2 142

Feature Viewer

pLDDT pTM Quality
95.23 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map