F423292

General Info

Members Datasets Scaffolds Average Seq Length
364 188 728 140

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10028291|Ga0105243_100282912
Length 162
Sequence MAGNEEIFGKKICTLSYSNVTLCSVMESNTTLDRSPAELGELELSIMQLIWKQNAESGTPVSAEQVREELGRPLKDSTIRTVLRRLEEKGYLTHTVENRTYLYRPAEARQMVAGRAVKRIIDWFCDGSVEALLVGMVDSAVLDRKELQRLAERIAVAKKGTK

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
124 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.75
Rhizosphere 96.15
Stem 0
Stem Tuber 0
Unclassified 30.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10028291 3300009148 Bacteria 4302
2 rootH2_10081194 3300003320 Bacteria 4519
3 Ga0070658_10097984 3300005327 Unclassified 2421
4 Ga0070676_10058787 3300005328 Bacteria 2279
5 Ga0070683_100009206 3300005329 Bacteria 8434
6 Ga0070683_100499459 3300005329 Bacteria 1162
7 Ga0070683_100874555 3300005329 Unclassified 862
8 Ga0070670_100002154 3300005331 Bacteria 16170
9 Ga0068869_100066701 3300005334 Unclassified 2652
10 Ga0070666_10003898 3300005335 Bacteria 9060
11 Ga0070680_100021009 3300005336 Bacteria 5183
12 Ga0070680_100025527 3300005336 Bacteria 4724
13 Ga0070680_101010612 3300005336 Unclassified 718
14 Ga0070682_100222669 3300005337 Unclassified 1344
15 Ga0068868_101384985 3300005338 Bacteria 655
16 Ga0070660_100331236 3300005339 Bacteria 1252
17 Ga0070661_100023167 3300005344 Bacteria 4449
18 Ga0070661_100132784 3300005344 Unclassified 1871
19 Ga0070669_100043087 3300005353 Bacteria 3286
20 Ga0070675_100064408 3300005354 Unclassified 3030
21 Ga0070671_100008997 3300005355 Bacteria 8014
22 Ga0070671_100013185 3300005355 Bacteria 6658
23 Ga0070667_100000615 3300005367 Bacteria 34719
24 Ga0070709_10232670 3300005434 Unclassified 1319
25 Ga0070714_100000096 3300005435 Bacteria 74616
26 Ga0070714_100011971 3300005435 Bacteria 6900
27 Ga0070714_102018206 3300005435 Unclassified 562
28 Ga0070713_100299737 3300005436 Unclassified 1479
29 Ga0070713_100465461 3300005436 Unclassified 1189
30 Ga0070713_100478126 3300005436 Bacteria 1173
31 Ga0070713_100572418 3300005436 Bacteria 1071
32 Ga0070710_10131361 3300005437 Bacteria 1527
33 Ga0070711_100310207 3300005439 Bacteria 1257
34 Ga0070700_100603394 3300005441 Bacteria 860
35 Ga0070663_100011738 3300005455 Bacteria 5513
36 Ga0070678_100334707 3300005456 Bacteria 1297
37 Ga0070662_100045459 3300005457 Bacteria 3151
38 Ga0070681_10471196 3300005458 Unclassified 1168
39 Ga0070707_101239172 3300005468 Unclassified 712
40 Ga0070679_100324839 3300005530 Unclassified 1488
41 Ga0070684_100125024 3300005535 Bacteria 2316
42 Ga0068853_100000147 3300005539 Bacteria 48276
43 Ga0070672_100597991 3300005543 Unclassified 960
44 Ga0070665_100005874 3300005548 Bacteria 12580
45 Ga0070665_100123501 3300005548 Unclassified 2591
46 Ga0068855_100000525 3300005563 Bacteria 47021
47 Ga0068855_100175179 3300005563 Bacteria 2428
48 Ga0068855_100233646 3300005563 Unclassified 2057
49 Ga0068855_100637761 3300005563 Unclassified 1145
50 Ga0068855_101280155 3300005563 Bacteria 760
51 Ga0070664_100199784 3300005564 Bacteria 1784
52 Ga0070664_100514614 3300005564 Bacteria 1104
53 Ga0068857_100009341 3300005577 Bacteria 8513
54 Ga0068857_100018267 3300005577 Bacteria 6152
55 Ga0068857_100472103 3300005577 Unclassified 1175
56 Ga0068854_100015572 3300005578 Bacteria 5041
57 Ga0068856_100001832 3300005614 Bacteria 22244
58 Ga0068856_100006573 3300005614 Bacteria 11403
59 Ga0068856_100023922 3300005614 Bacteria 5940
60 Ga0068856_100040755 3300005614 Bacteria 4562
61 Ga0068856_100287209 3300005614 Unclassified 1662
62 Ga0068856_100982717 3300005614 Bacteria 863
63 Ga0068852_100000164 3300005616 Bacteria 44546
64 Ga0068852_100012717 3300005616 Bacteria 6408
65 Ga0068852_100020236 3300005616 Bacteria 5289
66 Ga0068852_100027180 3300005616 Unclassified 4660
67 Ga0068852_101154837 3300005616 Unclassified 795
68 Ga0068859_100226018 3300005617 Bacteria 1960
69 Ga0068864_100004117 3300005618 Bacteria 11935
70 Ga0068866_10616400 3300005718 Bacteria 735
71 Ga0068861_100567013 3300005719 Bacteria 1037
72 Ga0068851_10005599 3300005834 Bacteria 5701
73 Ga0068851_10017846 3300005834 Bacteria 3415
74 Ga0068851_10248172 3300005834 Bacteria 1009
75 Ga0068863_100001402 3300005841 Bacteria 23901
76 Ga0068863_100466248 3300005841 Bacteria 1241
77 Ga0068858_100001299 3300005842 Bacteria 25808
78 Ga0068858_100091493 3300005842 Bacteria 2831
79 Ga0068858_101359518 3300005842 Bacteria 699
80 Ga0068860_100000248 3300005843 Bacteria 80612
81 Ga0068862_100080618 3300005844 Unclassified 2822
82 Ga0081540_1003308 3300005983 Bacteria 12786
83 Ga0081539_10117803 3300005985 Unclassified 1324
84 Ga0070717_10039518 3300006028 Unclassified 3839
85 Ga0070717_10045269 3300006028 Bacteria 3597
86 Ga0070717_10657946 3300006028 Bacteria 951
87 Ga0070717_10822618 3300006028 Bacteria 845
88 Ga0075432_10395256 3300006058 Bacteria 596
89 Ga0097621_100001213 3300006237 Bacteria 17844
90 Ga0097621_100110797 3300006237 Bacteria 2319
91 Ga0068871_100008671 3300006358 Bacteria 7314
92 Ga0075433_11264244 3300006852 Bacteria 640
93 Ga0068865_100066701 3300006881 Bacteria 2540
94 Ga0097620_100226028 3300006931 Bacteria 1960
95 Ga0105240_10000296 3300009093 Bacteria 96854
96 Ga0105240_10002920 3300009093 Bacteria 26976
97 Ga0105240_10009959 3300009093 Bacteria 13397
98 Ga0105240_10016634 3300009093 Bacteria 9947
99 Ga0105240_10018640 3300009093 Bacteria 9304
100 Ga0105240_10162716 3300009093 Bacteria 2649
101 Ga0105240_10315095 3300009093 Bacteria 1785
102 Ga0111539_10019813 3300009094 Bacteria 8291
103 Ga0105245_10003458 3300009098 Bacteria 14151
104 Ga0105245_10044715 3300009098 Unclassified 3954
105 Ga0105245_10051480 3300009098 Bacteria 3691
106 Ga0105247_10003539 3300009101 Bacteria 10150
107 Ga0105247_10038139 3300009101 Unclassified 2932
108 Ga0105247_10474430 3300009101 Unclassified 907
109 Ga0105241_10000033 3300009174 Bacteria 118315
110 Ga0105241_10002688 3300009174 Bacteria 13325
111 Ga0105241_10007097 3300009174 Bacteria 8249
112 Ga0105241_10025704 3300009174 Unclassified 4377
113 Ga0105241_10863331 3300009174 Unclassified 838
114 Ga0105242_10142124 3300009176 Unclassified 2084
115 Ga0105242_11754211 3300009176 Bacteria 658
116 Ga0105248_10001860 3300009177 Bacteria 23401
117 Ga0105248_10005054 3300009177 Bacteria 14566
118 Ga0105248_10471880 3300009177 Unclassified 1414
119 Ga0105237_10003829 3300009545 Bacteria 17685
120 Ga0105237_10097475 3300009545 Unclassified 2931
121 Ga0105237_10405385 3300009545 Bacteria 1368
122 Ga0105237_10699864 3300009545 Bacteria 1020
123 Ga0105238_10000171 3300009551 Bacteria 70810
124 Ga0105238_10001174 3300009551 Bacteria 26323
125 Ga0105238_10001679 3300009551 Bacteria 22254
126 Ga0105238_10014595 3300009551 Bacteria 7943
127 Ga0105238_10025800 3300009551 Bacteria 5991
128 Ga0105238_10127582 3300009551 Bacteria 2522
129 Ga0105249_10025262 3300009553 Bacteria 5346
130 Ga0105239_10001391 3300010375 Bacteria 32418
131 Ga0105239_10002062 3300010375 Bacteria 26041
132 Ga0105239_10047025 3300010375 Bacteria 4728
133 Ga0105239_11309871 3300010375 Bacteria 836
134 Ga0105239_12378314 3300010375 Unclassified 617
135 Ga0105246_11179102 3300011119 Unclassified 704
136 Ga0157373_10196337 3300013100 Unclassified 1422
137 Ga0157373_10907200 3300013100 Bacteria 654
138 Ga0157371_10132967 3300013102 Unclassified 1770
139 Ga0157370_10136418 3300013104 Bacteria 2287
140 Ga0157370_10290262 3300013104 Unclassified 1511
141 Ga0157370_11577243 3300013104 Unclassified 590
142 Ga0157369_10000716 3300013105 Bacteria 42666
143 Ga0157369_10008591 3300013105 Bacteria 11716
144 Ga0157369_10018102 3300013105 Bacteria 7902
145 Ga0157369_10028014 3300013105 Bacteria 6239
146 Ga0157369_10041967 3300013105 Unclassified 4992
147 Ga0157369_10107107 3300013105 Bacteria 2974
148 Ga0157369_10286311 3300013105 Bacteria 1716
149 Ga0157369_10306977 3300013105 Unclassified 1650
150 Ga0157369_10327278 3300013105 Unclassified 1592
151 Ga0157369_10745552 3300013105 Bacteria 1008
152 Ga0157369_12083727 3300013105 Unclassified 575
153 Ga0157374_10011999 3300013296 Bacteria 7523
154 Ga0157374_10013991 3300013296 Bacteria 7013
155 Ga0157374_10368965 3300013296 Bacteria 1428
156 Ga0157378_10005805 3300013297 Bacteria 10819
157 Ga0157378_10021380 3300013297 Bacteria 5689
158 Ga0157378_10044236 3300013297 Bacteria 3954
159 Ga0163162_10023484 3300013306 Bacteria 6085
160 Ga0163162_10207855 3300013306 Bacteria 2087
161 Ga0163162_10876641 3300013306 Bacteria 1012
162 Ga0163162_12514429 3300013306 Unclassified 592
163 Ga0157372_10001952 3300013307 Bacteria 22395
164 Ga0157372_10009227 3300013307 Bacteria 10487
165 Ga0157372_10019942 3300013307 Bacteria 7227
166 Ga0157372_10278055 3300013307 Unclassified 1946
167 Ga0157372_10621350 3300013307 Unclassified 1259
168 Ga0157372_10946691 3300013307 Unclassified 998
169 Ga0157375_10001970 3300013308 Bacteria 17706
170 Ga0157375_10715077 3300013308 Bacteria 1155
171 Ga0163163_10001714 3300014325 Bacteria 18490
172 Ga0157379_10001339 3300014968 Bacteria 20120
173 Ga0157379_10040145 3300014968 Bacteria 4176
174 Ga0157379_10121827 3300014968 Unclassified 2346
175 Ga0157379_10760230 3300014968 Bacteria 913
176 Ga0157376_10012991 3300014969 Bacteria 6203
177 Ga0157376_10040381 3300014969 Bacteria 3813
178 Ga0157376_10763244 3300014969 Bacteria 977
179 Ga0213872_10000754 3300021361 Bacteria 23974
180 Ga0213872_10036864 3300021361 Bacteria 2233
181 Ga0213872_10077738 3300021361 Bacteria 1491
182 Ga0213871_10099970 3300021441 Bacteria 848
183 Ga0207656_10045776 3300025321 Unclassified 1874
184 Ga0207656_10696886 3300025321 Unclassified 520
185 Ga0207710_10002684 3300025900 Bacteria 8174
186 Ga0207710_10223613 3300025900 Bacteria 935
187 Ga0207680_10362651 3300025903 Bacteria 1019
188 Ga0207647_10030980 3300025904 Bacteria 3447
189 Ga0207699_10452830 3300025906 Unclassified 921
190 Ga0207705_10075457 3300025909 Unclassified 2449
191 Ga0207705_10707423 3300025909 Bacteria 783
192 Ga0207654_10000170 3300025911 Bacteria 41057
193 Ga0207654_10000368 3300025911 Bacteria 26431
194 Ga0207654_10052405 3300025911 Unclassified 2352
195 Ga0207654_10283204 3300025911 Bacteria 1122
196 Ga0207654_10477796 3300025911 Unclassified 877
197 Ga0207695_10000030 3300025913 Bacteria 533735
198 Ga0207695_10000314 3300025913 Bacteria 116506
199 Ga0207695_10000877 3300025913 Bacteria 54740
200 Ga0207695_10127632 3300025913 Unclassified 2504
201 Ga0207695_10347551 3300025913 Bacteria 1371
202 Ga0207671_10000246 3300025914 Bacteria 81042
203 Ga0207671_10002235 3300025914 Bacteria 20984
204 Ga0207671_10196480 3300025914 Unclassified 1574
205 Ga0207660_10404522 3300025917 Bacteria 1100
206 Ga0207660_10955306 3300025917 Bacteria 699
207 Ga0207649_10000537 3300025920 Bacteria 26293
208 Ga0207649_10038980 3300025920 Unclassified 2879
209 Ga0207649_10740238 3300025920 Unclassified 764
210 Ga0207652_10158663 3300025921 Unclassified 2027
211 Ga0207694_10000181 3300025924 Bacteria 65011
212 Ga0207694_10000731 3300025924 Bacteria 29493
213 Ga0207694_10044395 3300025924 Bacteria 3432
214 Ga0207694_10059340 3300025924 Unclassified 2975
215 Ga0207694_10060535 3300025924 Bacteria 2947
216 Ga0207694_10129559 3300025924 Bacteria 2021
217 Ga0207650_10001453 3300025925 Bacteria 17060
218 Ga0207687_10001448 3300025927 Bacteria 16259
219 Ga0207700_10118800 3300025928 Bacteria 2140
220 Ga0207700_10190990 3300025928 Bacteria 1721
221 Ga0207700_10677889 3300025928 Unclassified 920
222 Ga0207664_10000087 3300025929 Bacteria 88607
223 Ga0207664_10930165 3300025929 Unclassified 780
224 Ga0207664_11119901 3300025929 Bacteria 703
225 Ga0207644_10020736 3300025931 Unclassified 4471
226 Ga0207644_10032596 3300025931 Bacteria 3636
227 Ga0207706_10025691 3300025933 Bacteria 5276
228 Ga0207704_10544568 3300025938 Bacteria 942
229 Ga0207691_10042804 3300025940 Bacteria 4174
230 Ga0207711_10001374 3300025941 Bacteria 22912
231 Ga0207711_10004865 3300025941 Bacteria 11402
232 Ga0207711_10405307 3300025941 Unclassified 1267
233 Ga0207689_10000748 3300025942 Bacteria 31163
234 Ga0207689_10129514 3300025942 Bacteria 2076
235 Ga0207661_10776245 3300025944 Unclassified 882
236 Ga0207679_10206422 3300025945 Bacteria 1645
237 Ga0207667_10012191 3300025949 Bacteria 9929
238 Ga0207667_10213682 3300025949 Unclassified 1977
239 Ga0207667_10412978 3300025949 Unclassified 1374
240 Ga0207667_10542174 3300025949 Unclassified 1177
241 Ga0207712_10040909 3300025961 Unclassified 3183
242 Ga0207640_11485708 3300025981 Unclassified 608
243 Ga0207658_10000386 3300025986 Bacteria 42878
244 Ga0207658_10522660 3300025986 Unclassified 1059
245 Ga0207658_10586275 3300025986 Unclassified 1000
246 Ga0207677_10000104 3300026023 Bacteria 70036
247 Ga0207703_10003836 3300026035 Bacteria 12490
248 Ga0207639_10000101 3300026041 Bacteria 70638
249 Ga0207639_10065584 3300026041 Bacteria 2819
250 Ga0207678_10022237 3300026067 Bacteria 5555
251 Ga0207702_10000633 3300026078 Bacteria 38531
252 Ga0207702_10007708 3300026078 Bacteria 9145
253 Ga0207702_10098934 3300026078 Bacteria 2570
254 Ga0207702_10360494 3300026078 Bacteria 1393
255 Ga0207702_12434883 3300026078 Bacteria 510
256 Ga0207641_10000609 3300026088 Bacteria 39264
257 Ga0207641_10811933 3300026088 Bacteria 926
258 Ga0207676_10001024 3300026095 Bacteria 21388
259 Ga0207676_10273467 3300026095 Bacteria 1531
260 Ga0207674_10006656 3300026116 Bacteria 13574
261 Ga0207674_10007031 3300026116 Bacteria 13157
262 Ga0207674_10160470 3300026116 Bacteria 2203
263 Ga0207683_10000600 3300026121 Bacteria 33247
264 Ga0207698_10000263 3300026142 Bacteria 32215
265 Ga0207698_10027251 3300026142 Bacteria 4054
266 Ga0207698_10075839 3300026142 Bacteria 2689
267 Ga0207698_10273304 3300026142 Unclassified 1559
268 Ga0207698_10394419 3300026142 Bacteria 1321
269 Ga0207698_10994490 3300026142 Bacteria 849
270 Ga0265354_1000334 3300028016 Bacteria 8305
271 Ga0265356_1003393 3300028017 Bacteria 2016
272 Ga0268266_10207008 3300028379 Unclassified 1798
273 Ga0268264_10001257 3300028381 Bacteria 24137
274 Ga0265334_10056473 3300028573 Bacteria 1491
275 Ga0265338_10087893 3300028800 Bacteria 2581
276 Ga0265338_10269375 3300028800 Unclassified 1248
277 Ga0265338_10380635 3300028800 Bacteria 1009
278 Ga0265770_1000975 3300030878 Bacteria 3957
279 Ga0265765_1008457 3300030879 Bacteria 1121
280 Ga0265760_10001129 3300031090 Bacteria 7763
281 Ga0265760_10022989 3300031090 Bacteria 1809
282 Ga0265330_10000761 3300031235 Bacteria 20237
283 Ga0265328_10009233 3300031239 Unclassified 4024
284 Ga0265320_10058256 3300031240 Bacteria 1850
285 Ga0265320_10293386 3300031240 Bacteria 719
286 Ga0265325_10003964 3300031241 Bacteria 9473
287 Ga0265325_10031216 3300031241 Bacteria 2853
288 Ga0265329_10075831 3300031242 Bacteria 1064
289 Ga0265340_10013690 3300031247 Unclassified 4255
290 Ga0265340_10024335 3300031247 Bacteria 3077
291 Ga0265339_10000102 3300031249 Bacteria 68868
292 Ga0265339_10004668 3300031249 Bacteria 9306
293 Ga0265339_10069806 3300031249 Unclassified 1875
294 Ga0265339_10131637 3300031249 Bacteria 1278
295 Ga0265316_10001159 3300031344 Bacteria 28527
296 Ga0265316_10024600 3300031344 Bacteria 5040
297 Ga0265316_10104968 3300031344 Bacteria 2144
298 Ga0265316_10300340 3300031344 Unclassified 1169
299 Ga0265313_10010338 3300031595 Bacteria 5919
300 Ga0265314_10085183 3300031711 Bacteria 2073
301 Ga0265314_10154122 3300031711 Unclassified 1405
302 Ga0265342_10008789 3300031712 Bacteria 7201
303 Ga0265342_10063350 3300031712 Bacteria 2173
304 Ga0316212_1014097 3300033547 Bacteria 1134
305 Ga0373944_0279797 3300035089 Bacteria 622
306 Ga0373953_0207846 3300035117 Bacteria 847
307 Ga0373937_0473100 3300036401 Bacteria 1190
308 Ga0373937_1127811 3300036401 Unclassified 733
309 Ga0373925_0695922 3300037068 Unclassified 838
310 Ga0395898_0968885 3300037466 Unclassified 787
311 Ga0395898_1839432 3300037466 Unclassified 526
312 Ga0436360_0372557 3300039438 Bacteria 2763
313 Ga0436360_0549948 3300039438 Bacteria 4508
314 Ga0436360_1028651 3300039438 Bacteria 871
315 Ga0436361_0121766 3300039447 Unclassified 1054
316 Ga0436361_0134810 3300039447 Unclassified 592
317 Ga0436361_0306788 3300039447 Bacteria 5929
318 Ga0436361_0432488 3300039447 Bacteria 12852
319 Ga0436361_0562248 3300039447 Unclassified 762
320 Ga0436361_1197548 3300039447 Bacteria 5985
321 Ga0451839_1380045 3300041496 Bacteria 923
322 Ga0439448_0131738 3300042005 Unclassified 862
323 Ga0466969_0168356 3300044656 Unclassified 1005
324 Ga0466966_0661333 3300044684 Bacteria 629
325 Ga0466961_0403505 3300044693 Unclassified 829
326 Ga0466963_0020734 3300044694 Bacteria 4136
327 Ga0466957_0421555 3300044842 Bacteria 916
328 Ga0466957_1164854 3300044842 Bacteria 557
329 Ga0466967_0002031 3300045976 Bacteria 12348
330 Ga0495629_0074931 3300046459 Bacteria 2363
331 Ga0495629_0579362 3300046459 Unclassified 752
332 Ga0495651_0172673 3300046462 Unclassified 1538
333 Ga0495580_0038411 3300046472 Unclassified 3429
334 Ga0495582_0155557 3300046473 Unclassified 1299
335 Ga0495652_0973507 3300046529 Unclassified 556
336 Ga0495665_0118297 3300046531 Bacteria 1388
337 Ga0495645_0067518 3300046543 Bacteria 2582
338 Ga0495645_0116530 3300046543 Bacteria 1885
339 Ga0495635_0284737 3300046663 Unclassified 1110
340 Ga0495657_0404960 3300046675 Unclassified 802
341 Ga0495599_0097499 3300046678 Unclassified 1833
342 Ga0495623_0341145 3300046679 Unclassified 818
343 Ga0495623_0471691 3300046679 Unclassified 666
344 Ga0495646_0139820 3300046680 Unclassified 1355
345 Ga0495613_0063408 3300046689 Unclassified 2704
346 Ga0495600_0166805 3300046809 Bacteria 1422
347 Ga0495600_0354307 3300046809 Unclassified 919
348 Ga0495684_0658809 3300047471 Unclassified 699
349 Ga0496101_0511401 3300048904 Unclassified 949
350 Ga0496102_0789529 3300048905 Unclassified 872
351 Ga0496104_0310624 3300048907 Unclassified 1489
352 Ga0496105_0766528 3300048908 Unclassified 736
353 Ga0496106_0130078 3300048909 Unclassified 1974
354 Ga0496107_0124854 3300048910 Bacteria 1898
355 Ga0496107_0828533 3300048910 Unclassified 676
356 Ga0496113_1139087 3300048916 Bacteria 611
357 Ga0496114_0241824 3300048917 Unclassified 1587
358 Ga0496115_0119593 3300048918 Bacteria 2167
359 Ga0496126_0401305 3300048929 Bacteria 1112
360 nmdc:mga0qj67_986229_c1 3300050509 Bacteria 661
361 nmdc:mga08y16_234631_c1 3300050511 Bacteria 1897
362 nmdc:mga0a205_1376037_c1 3300050515 Bacteria 553
363 Ga0495595_0229696 3300053084 Bacteria 927
364 Ga0495619_1159581 3300053085 Unclassified 513
365 Ga0105243_10028291
366 rootH2_10081194
367 Ga0070658_10097984
368 Ga0070676_10058787
369 Ga0070683_100009206
370 Ga0070683_100499459
371 Ga0070683_100874555
372 Ga0070670_100002154
373 Ga0068869_100066701
374 Ga0070666_10003898
375 Ga0070680_100021009
376 Ga0070680_100025527
377 Ga0070680_101010612
378 Ga0070682_100222669
379 Ga0068868_101384985
380 Ga0070660_100331236
381 Ga0070661_100023167
382 Ga0070661_100132784
383 Ga0070669_100043087
384 Ga0070675_100064408
385 Ga0070671_100008997
386 Ga0070671_100013185
387 Ga0070667_100000615
388 Ga0070709_10232670
389 Ga0070714_100000096
390 Ga0070714_100011971
391 Ga0070714_102018206
392 Ga0070713_100299737
393 Ga0070713_100465461
394 Ga0070713_100478126
395 Ga0070713_100572418
396 Ga0070710_10131361
397 Ga0070711_100310207
398 Ga0070700_100603394
399 Ga0070663_100011738
400 Ga0070678_100334707
401 Ga0070662_100045459
402 Ga0070681_10471196
403 Ga0070707_101239172
404 Ga0070679_100324839
405 Ga0070684_100125024
406 Ga0068853_100000147
407 Ga0070672_100597991
408 Ga0070665_100005874
409 Ga0070665_100123501
410 Ga0068855_100000525
411 Ga0068855_100175179
412 Ga0068855_100233646
413 Ga0068855_100637761
414 Ga0068855_101280155
415 Ga0070664_100199784
416 Ga0070664_100514614
417 Ga0068857_100009341
418 Ga0068857_100018267
419 Ga0068857_100472103
420 Ga0068854_100015572
421 Ga0068856_100001832
422 Ga0068856_100006573
423 Ga0068856_100023922
424 Ga0068856_100040755
425 Ga0068856_100287209
426 Ga0068856_100982717
427 Ga0068852_100000164
428 Ga0068852_100012717
429 Ga0068852_100020236
430 Ga0068852_100027180
431 Ga0068852_101154837
432 Ga0068859_100226018
433 Ga0068864_100004117
434 Ga0068866_10616400
435 Ga0068861_100567013
436 Ga0068851_10005599
437 Ga0068851_10017846
438 Ga0068851_10248172
439 Ga0068863_100001402
440 Ga0068863_100466248
441 Ga0068858_100001299
442 Ga0068858_100091493
443 Ga0068858_101359518
444 Ga0068860_100000248
445 Ga0068862_100080618
446 Ga0081540_1003308
447 Ga0081539_10117803
448 Ga0070717_10039518
449 Ga0070717_10045269
450 Ga0070717_10657946
451 Ga0070717_10822618
452 Ga0075432_10395256
453 Ga0097621_100001213
454 Ga0097621_100110797
455 Ga0068871_100008671
456 Ga0075433_11264244
457 Ga0068865_100066701
458 Ga0097620_100226028
459 Ga0105240_10000296
460 Ga0105240_10002920
461 Ga0105240_10009959
462 Ga0105240_10016634
463 Ga0105240_10018640
464 Ga0105240_10162716
465 Ga0105240_10315095
466 Ga0111539_10019813
467 Ga0105245_10003458
468 Ga0105245_10044715
469 Ga0105245_10051480
470 Ga0105247_10003539
471 Ga0105247_10038139
472 Ga0105247_10474430
473 Ga0105241_10000033
474 Ga0105241_10002688
475 Ga0105241_10007097
476 Ga0105241_10025704
477 Ga0105241_10863331
478 Ga0105242_10142124
479 Ga0105242_11754211
480 Ga0105248_10001860
481 Ga0105248_10005054
482 Ga0105248_10471880
483 Ga0105237_10003829
484 Ga0105237_10097475
485 Ga0105237_10405385
486 Ga0105237_10699864
487 Ga0105238_10000171
488 Ga0105238_10001174
489 Ga0105238_10001679
490 Ga0105238_10014595
491 Ga0105238_10025800
492 Ga0105238_10127582
493 Ga0105249_10025262
494 Ga0105239_10001391
495 Ga0105239_10002062
496 Ga0105239_10047025
497 Ga0105239_11309871
498 Ga0105239_12378314
499 Ga0105246_11179102
500 Ga0157373_10196337
501 Ga0157373_10907200
502 Ga0157371_10132967
503 Ga0157370_10136418
504 Ga0157370_10290262
505 Ga0157370_11577243
506 Ga0157369_10000716
507 Ga0157369_10008591
508 Ga0157369_10018102
509 Ga0157369_10028014
510 Ga0157369_10041967
511 Ga0157369_10107107
512 Ga0157369_10286311
513 Ga0157369_10306977
514 Ga0157369_10327278
515 Ga0157369_10745552
516 Ga0157369_12083727
517 Ga0157374_10011999
518 Ga0157374_10013991
519 Ga0157374_10368965
520 Ga0157378_10005805
521 Ga0157378_10021380
522 Ga0157378_10044236
523 Ga0163162_10023484
524 Ga0163162_10207855
525 Ga0163162_10876641
526 Ga0163162_12514429
527 Ga0157372_10001952
528 Ga0157372_10009227
529 Ga0157372_10019942
530 Ga0157372_10278055
531 Ga0157372_10621350
532 Ga0157372_10946691
533 Ga0157375_10001970
534 Ga0157375_10715077
535 Ga0163163_10001714
536 Ga0157379_10001339
537 Ga0157379_10040145
538 Ga0157379_10121827
539 Ga0157379_10760230
540 Ga0157376_10012991
541 Ga0157376_10040381
542 Ga0157376_10763244
543 Ga0213872_10000754
544 Ga0213872_10036864
545 Ga0213872_10077738
546 Ga0213871_10099970
547 Ga0207656_10045776
548 Ga0207656_10696886
549 Ga0207710_10002684
550 Ga0207710_10223613
551 Ga0207680_10362651
552 Ga0207647_10030980
553 Ga0207699_10452830
554 Ga0207705_10075457
555 Ga0207705_10707423
556 Ga0207654_10000170
557 Ga0207654_10000368
558 Ga0207654_10052405
559 Ga0207654_10283204
560 Ga0207654_10477796
561 Ga0207695_10000030
562 Ga0207695_10000314
563 Ga0207695_10000877
564 Ga0207695_10127632
565 Ga0207695_10347551
566 Ga0207671_10000246
567 Ga0207671_10002235
568 Ga0207671_10196480
569 Ga0207660_10404522
570 Ga0207660_10955306
571 Ga0207649_10000537
572 Ga0207649_10038980
573 Ga0207649_10740238
574 Ga0207652_10158663
575 Ga0207694_10000181
576 Ga0207694_10000731
577 Ga0207694_10044395
578 Ga0207694_10059340
579 Ga0207694_10060535
580 Ga0207694_10129559
581 Ga0207650_10001453
582 Ga0207687_10001448
583 Ga0207700_10118800
584 Ga0207700_10190990
585 Ga0207700_10677889
586 Ga0207664_10000087
587 Ga0207664_10930165
588 Ga0207664_11119901
589 Ga0207644_10020736
590 Ga0207644_10032596
591 Ga0207706_10025691
592 Ga0207704_10544568
593 Ga0207691_10042804
594 Ga0207711_10001374
595 Ga0207711_10004865
596 Ga0207711_10405307
597 Ga0207689_10000748
598 Ga0207689_10129514
599 Ga0207661_10776245
600 Ga0207679_10206422
601 Ga0207667_10012191
602 Ga0207667_10213682
603 Ga0207667_10412978
604 Ga0207667_10542174
605 Ga0207712_10040909
606 Ga0207640_11485708
607 Ga0207658_10000386
608 Ga0207658_10522660
609 Ga0207658_10586275
610 Ga0207677_10000104
611 Ga0207703_10003836
612 Ga0207639_10000101
613 Ga0207639_10065584
614 Ga0207678_10022237
615 Ga0207702_10000633
616 Ga0207702_10007708
617 Ga0207702_10098934
618 Ga0207702_10360494
619 Ga0207702_12434883
620 Ga0207641_10000609
621 Ga0207641_10811933
622 Ga0207676_10001024
623 Ga0207676_10273467
624 Ga0207674_10006656
625 Ga0207674_10007031
626 Ga0207674_10160470
627 Ga0207683_10000600
628 Ga0207698_10000263
629 Ga0207698_10027251
630 Ga0207698_10075839
631 Ga0207698_10273304
632 Ga0207698_10394419
633 Ga0207698_10994490
634 Ga0265354_1000334
635 Ga0265356_1003393
636 Ga0268266_10207008
637 Ga0268264_10001257
638 Ga0265334_10056473
639 Ga0265338_10087893
640 Ga0265338_10269375
641 Ga0265338_10380635
642 Ga0265770_1000975
643 Ga0265765_1008457
644 Ga0265760_10001129
645 Ga0265760_10022989
646 Ga0265330_10000761
647 Ga0265328_10009233
648 Ga0265320_10058256
649 Ga0265320_10293386
650 Ga0265325_10003964
651 Ga0265325_10031216
652 Ga0265329_10075831
653 Ga0265340_10013690
654 Ga0265340_10024335
655 Ga0265339_10000102
656 Ga0265339_10004668
657 Ga0265339_10069806
658 Ga0265339_10131637
659 Ga0265316_10001159
660 Ga0265316_10024600
661 Ga0265316_10104968
662 Ga0265316_10300340
663 Ga0265313_10010338
664 Ga0265314_10085183
665 Ga0265314_10154122
666 Ga0265342_10008789
667 Ga0265342_10063350
668 Ga0316212_1014097
669 Ga0373944_0279797
670 Ga0373953_0207846
671 Ga0373937_0473100
672 Ga0373937_1127811
673 Ga0373925_0695922
674 Ga0395898_0968885
675 Ga0395898_1839432
676 Ga0436360_0372557
677 Ga0436360_0549948
678 Ga0436360_1028651
679 Ga0436361_0121766
680 Ga0436361_0134810
681 Ga0436361_0306788
682 Ga0436361_0432488
683 Ga0436361_0562248
684 Ga0436361_1197548
685 Ga0451839_1380045
686 Ga0439448_0131738
687 Ga0466969_0168356
688 Ga0466966_0661333
689 Ga0466961_0403505
690 Ga0466963_0020734
691 Ga0466957_0421555
692 Ga0466957_1164854
693 Ga0466967_0002031
694 Ga0495629_0074931
695 Ga0495629_0579362
696 Ga0495651_0172673
697 Ga0495580_0038411
698 Ga0495582_0155557
699 Ga0495652_0973507
700 Ga0495665_0118297
701 Ga0495645_0067518
702 Ga0495645_0116530
703 Ga0495635_0284737
704 Ga0495657_0404960
705 Ga0495599_0097499
706 Ga0495623_0341145
707 Ga0495623_0471691
708 Ga0495646_0139820
709 Ga0495613_0063408
710 Ga0495600_0166805
711 Ga0495600_0354307
712 Ga0495684_0658809
713 Ga0496101_0511401
714 Ga0496102_0789529
715 Ga0496104_0310624
716 Ga0496105_0766528
717 Ga0496106_0130078
718 Ga0496107_0124854
719 Ga0496107_0828533
720 Ga0496113_1139087
721 Ga0496114_0241824
722 Ga0496115_0119593
723 Ga0496126_0401305
724 nmdc:mga0qj67_986229_c1
725 nmdc:mga08y16_234631_c1
726 nmdc:mga0a205_1376037_c1
727 Ga0495595_0229696
728 Ga0495619_1159581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

39

156

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zme-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.896 16 76
3cuq-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.8926 16 76
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.8918 16 72
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8871 18 75
2l02-assembly1.cif.gz_A solution nmr structure of protein bt2368 from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr375 0.8824 18 75
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9291 14 74 1.10.10.10
2xigA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9187 16 77 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.918 16 77 1.10.10.10
af_Q5A246_13_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9027 13 73 1.10.10.10
af_P0C0A2_317_386_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9022 16 76 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0K8NV68-F1-model_v4 Uncharacterized protein 0.9821 14 78
AF-A0A2S5SWH3-F1-model_v4 Uncharacterized protein 0.9594 13 79
AF-A0A162T783-F1-model_v4 Uncharacterized protein 0.9515 13 79
AF-A0A660ZMZ7-F1-model_v4 HTH arsR-type domain-containing protein 0.9475 13 75 GO:0003700
AF-A0A848ENM3-F1-model_v4 pyruvate, water dikinase (EC 2.7.9.2) (Pyruvate, water dikinase) 0.9101 14 75 GO:0005524
GO:0006090
GO:0006094
GO:0008986
GO:0046872

Map