F422479

General Info

Members Datasets Scaffolds Average Seq Length
362 195 724 198

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100108901|Ga0070670_1001089013
Length 211
Sequence MDISLSKLPWYAQVGAFVALAAGAVGAFVYYYEMPMRAEMAVRQGTLKSLRRDVDKGHETARKLPEFRAQVDELEGRLTSLRAVLPEEKDVADLLRRMQTLATQSNLVITSFKPAPVVTKELHAEWPITIELNGTYHNLATFFDRLGKFTRIVNISALDVKGKEKDKQDPSITIGASAVATTFVLLDKPAPPKAGGKPGAKPAPAAAKKVA

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
134 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
135 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
154 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.87
Rhizosphere 95.58
Stem 0
Stem Tuber 0
Unclassified 27.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100108901 3300005331 Bacteria 2387
2 Ga0065712_10006457 3300005290 Bacteria 4463
3 Ga0065712_10388912 3300005290 Unclassified 744
4 Ga0065715_10175167 3300005293 Unclassified 1517
5 Ga0065715_10364810 3300005293 Bacteria 930
6 Ga0070676_10003214 3300005328 Bacteria 8469
7 Ga0070690_100004693 3300005330 Bacteria 7613
8 Ga0070690_100168723 3300005330 Unclassified 1505
9 Ga0070690_100169644 3300005330 Archaea 1501
10 Ga0070690_100329392 3300005330 Bacteria 1103
11 Ga0070670_100135852 3300005331 Bacteria 2125
12 Ga0070670_100157843 3300005331 Unclassified 1965
13 Ga0070670_100559391 3300005331 Bacteria 1021
14 Ga0070677_10184849 3300005333 Unclassified 995
15 Ga0068869_100429859 3300005334 Bacteria 1091
16 Ga0070666_10134637 3300005335 Unclassified 1719
17 Ga0068868_100175880 3300005338 Bacteria 1774
18 Ga0068868_100328555 3300005338 Unclassified 1304
19 Ga0070689_100030369 3300005340 Bacteria 4102
20 Ga0070689_100033737 3300005340 Bacteria 3902
21 Ga0070691_10001877 3300005341 Bacteria 9186
22 Ga0070687_100039208 3300005343 Unclassified 2379
23 Ga0070661_100303364 3300005344 Viruses 1244
24 Ga0070692_10344638 3300005345 Bacteria 924
25 Ga0070668_100012677 3300005347 Bacteria 6275
26 Ga0070668_100591646 3300005347 Bacteria 970
27 Ga0070669_100065796 3300005353 Bacteria 2670
28 Ga0070669_100098866 3300005353 Unclassified 2198
29 Ga0070669_100162160 3300005353 Bacteria 1738
30 Ga0070669_100506854 3300005353 Bacteria 1002
31 Ga0070675_100000055 3300005354 Bacteria 68147
32 Ga0070675_100008120 3300005354 Bacteria 8139
33 Ga0070675_100056743 3300005354 Bacteria 3228
34 Ga0070675_100078884 3300005354 Unclassified 2743
35 Ga0070671_100084601 3300005355 Bacteria 2653
36 Ga0070671_100225740 3300005355 Unclassified 1589
37 Ga0070674_100001908 3300005356 Bacteria 11335
38 Ga0070674_100003104 3300005356 Bacteria 9248
39 Ga0070674_100204009 3300005356 Unclassified 1528
40 Ga0070673_100006683 3300005364 Bacteria 7518
41 Ga0070673_101176019 3300005364 Unclassified 718
42 Ga0070688_100020867 3300005365 Bacteria 3818
43 Ga0070688_100062018 3300005365 Bacteria 2366
44 Ga0070688_100142932 3300005365 Unclassified 1627
45 Ga0070659_100433214 3300005366 Bacteria 1113
46 Ga0070659_101010595 3300005366 Bacteria 730
47 Ga0070709_10235040 3300005434 Bacteria 1313
48 Ga0070714_100004607 3300005435 Bacteria 10396
49 Ga0070701_10006436 3300005438 Bacteria 4942
50 Ga0070701_10317491 3300005438 Bacteria 963
51 Ga0070701_10599813 3300005438 Bacteria 729
52 Ga0070705_100033245 3300005440 Bacteria 2874
53 Ga0070705_100133861 3300005440 Unclassified 1621
54 Ga0070700_100015959 3300005441 Bacteria 4269
55 Ga0070700_100019055 3300005441 Bacteria 3955
56 Ga0070708_100512986 3300005445 Bacteria 1131
57 Ga0070678_100044789 3300005456 Bacteria 3162
58 Ga0070678_100119204 3300005456 Unclassified 2078
59 Ga0070662_100063627 3300005457 Bacteria 2699
60 Ga0068867_100013963 3300005459 Bacteria 5686
61 Ga0070685_10029597 3300005466 Bacteria 3044
62 Ga0070707_100318306 3300005468 Bacteria 1512
63 Ga0070698_100119268 3300005471 Bacteria 2599
64 Ga0070698_100166780 3300005471 Unclassified 2145
65 Ga0070699_100109694 3300005518 Bacteria 2422
66 Ga0070684_100745274 3300005535 Unclassified 914
67 Ga0070697_100209026 3300005536 Unclassified 1661
68 Ga0070697_100618217 3300005536 Unclassified 953
69 Ga0068853_100342314 3300005539 Unclassified 1390
70 Ga0068853_100991853 3300005539 Unclassified 808
71 Ga0070672_100014950 3300005543 Bacteria 5513
72 Ga0070672_100036016 3300005543 Bacteria 3766
73 Ga0070672_100529151 3300005543 Unclassified 1022
74 Ga0070686_100002283 3300005544 Bacteria 10588
75 Ga0070686_100337338 3300005544 Bacteria 1129
76 Ga0070686_100422473 3300005544 Bacteria 1019
77 Ga0070686_100683708 3300005544 Unclassified 817
78 Ga0070695_100053005 3300005545 Bacteria 2608
79 Ga0070695_100514365 3300005545 Bacteria 928
80 Ga0070696_100024768 3300005546 Bacteria 4079
81 Ga0070704_100028213 3300005549 Bacteria 3732
82 Ga0070664_100444812 3300005564 Unclassified 1189
83 Ga0068857_100121834 3300005577 Bacteria 2349
84 Ga0068854_100042303 3300005578 Bacteria 3224
85 Ga0070702_100028873 3300005615 Bacteria 3010
86 Ga0070702_100093577 3300005615 Bacteria 1828
87 Ga0068859_100061229 3300005617 Bacteria 3793
88 Ga0068859_100069229 3300005617 Bacteria 3563
89 Ga0068859_100698787 3300005617 Unclassified 1105
90 Ga0068859_100887048 3300005617 Bacteria 977
91 Ga0068864_100006425 3300005618 Bacteria 9634
92 Ga0068864_101104453 3300005618 Bacteria 789
93 Ga0068861_100005216 3300005719 Bacteria 8753
94 Ga0068861_100177201 3300005719 Bacteria 1771
95 Ga0068861_100991005 3300005719 Bacteria 801
96 Ga0068863_100017618 3300005841 Bacteria 6843
97 Ga0068858_100038174 3300005842 Bacteria 4454
98 Ga0068858_100041782 3300005842 Bacteria 4251
99 Ga0068858_100271735 3300005842 Bacteria 1613
100 Ga0068858_100288188 3300005842 Bacteria 1565
101 Ga0068860_100092076 3300005843 Bacteria 2888
102 Ga0068860_100546304 3300005843 Bacteria 1160
103 Ga0068860_100918033 3300005843 Bacteria 892
104 Ga0068860_101321715 3300005843 Bacteria 742
105 Ga0068862_100023648 3300005844 Bacteria 5150
106 Ga0068862_100061873 3300005844 Bacteria 3218
107 Ga0081455_10112817 3300005937 Bacteria 2157
108 Ga0081455_10179833 3300005937 Bacteria 1602
109 Ga0081539_10016120 3300005985 Bacteria 5366
110 Ga0075432_10042772 3300006058 Bacteria 1586
111 Ga0070715_10157428 3300006163 Unclassified 1119
112 Ga0097621_100017472 3300006237 Bacteria 5447
113 Ga0097621_100145767 3300006237 Bacteria 2027
114 Ga0097621_100150038 3300006237 Bacteria 1999
115 Ga0097621_100532772 3300006237 Bacteria 1067
116 Ga0068871_100020475 3300006358 Bacteria 5068
117 Ga0068871_100023465 3300006358 Bacteria 4773
118 Ga0075428_100070610 3300006844 Bacteria 3817
119 Ga0075428_100090250 3300006844 Bacteria 3342
120 Ga0075428_100564076 3300006844 Unclassified 1217
121 Ga0075431_100129137 3300006847 Bacteria 2608
122 Ga0075433_10017177 3300006852 Bacteria 5987
123 Ga0075434_100000260 3300006871 Bacteria 37408
124 Ga0075434_100165522 3300006871 Unclassified 2231
125 Ga0075434_100213980 3300006871 Unclassified 1947
126 Ga0075434_100240878 3300006871 Unclassified 1829
127 Ga0075434_100520781 3300006871 Bacteria 1209
128 Ga0075434_100580058 3300006871 Bacteria 1141
129 Ga0075434_101376837 3300006871 Bacteria 716
130 Ga0068865_100343228 3300006881 Unclassified 1207
131 Ga0068865_100345357 3300006881 Bacteria 1204
132 Ga0075436_100055284 3300006914 Bacteria 2741
133 Ga0075436_100138536 3300006914 Unclassified 1709
134 Ga0075436_100280210 3300006914 Unclassified 1192
135 Ga0097620_100061228 3300006931 Bacteria 3793
136 Ga0097620_100069226 3300006931 Bacteria 3563
137 Ga0097620_100698658 3300006931 Unclassified 1105
138 Ga0097620_100887193 3300006931 Bacteria 977
139 Ga0075435_100000064 3300007076 Bacteria 54706
140 Ga0075435_100000956 3300007076 Bacteria 18244
141 Ga0075435_100004297 3300007076 Bacteria 9790
142 Ga0075435_100009317 3300007076 Bacteria 7100
143 Ga0075435_100108204 3300007076 Bacteria 2309
144 Ga0075435_100559439 3300007076 Bacteria 991
145 Ga0105240_10021294 3300009093 Bacteria 8625
146 Ga0111539_10002176 3300009094 Bacteria 26185
147 Ga0111539_10110111 3300009094 Bacteria 3232
148 Ga0111539_10573731 3300009094 Bacteria 1314
149 Ga0111539_10701494 3300009094 Bacteria 1178
150 Ga0105245_10007999 3300009098 Bacteria 9247
151 Ga0105245_11269845 3300009098 Unclassified 785
152 Ga0114129_10012810 3300009147 Bacteria 11935
153 Ga0114129_10023049 3300009147 Bacteria 8833
154 Ga0114129_10053976 3300009147 Bacteria 5636
155 Ga0114129_10620057 3300009147 Bacteria 1399
156 Ga0105243_10008686 3300009148 Bacteria 7788
157 Ga0105241_10119780 3300009174 Bacteria 2118
158 Ga0105242_10091657 3300009176 Unclassified 2559
159 Ga0105242_10107357 3300009176 Bacteria 2374
160 Ga0105242_10159423 3300009176 Bacteria 1973
161 Ga0105242_10270167 3300009176 Unclassified 1540
162 Ga0105242_11237815 3300009176 Bacteria 767
163 Ga0105248_10006365 3300009177 Bacteria 12954
164 Ga0105248_10061545 3300009177 Bacteria 4215
165 Ga0105248_10119052 3300009177 Bacteria 2979
166 Ga0105248_10175635 3300009177 Bacteria 2414
167 Ga0105248_10226984 3300009177 Bacteria 2102
168 Ga0105248_10566103 3300009177 Unclassified 1282
169 Ga0105248_10792397 3300009177 Bacteria 1070
170 Ga0105248_10879589 3300009177 Bacteria 1011
171 Ga0105238_10221142 3300009551 Unclassified 1870
172 Ga0157374_10739420 3300013296 Unclassified 998
173 Ga0157378_10750579 3300013297 Bacteria 999
174 Ga0163162_10062425 3300013306 Bacteria 3766
175 Ga0163162_10849579 3300013306 Unclassified 1028
176 Ga0157375_10560286 3300013308 Bacteria 1304
177 Ga0163163_10558253 3300014325 Bacteria 1208
178 Ga0157380_10362988 3300014326 Bacteria 1360
179 Ga0157380_10775244 3300014326 Bacteria 973
180 Ga0157377_10066802 3300014745 Unclassified 2069
181 Ga0157379_10155639 3300014968 Unclassified 2062
182 Ga0157376_10079596 3300014969 Bacteria 2809
183 Ga0213876_10198001 3300021384 Unclassified 1068
184 Ga0207697_10027602 3300025315 Bacteria 2321
185 Ga0207682_10053108 3300025893 Unclassified 1680
186 Ga0207642_10251369 3300025899 Bacteria 1003
187 Ga0207688_10033020 3300025901 Bacteria 2861
188 Ga0207688_10347604 3300025901 Unclassified 913
189 Ga0207680_10009434 3300025903 Bacteria 4841
190 Ga0207680_10062129 3300025903 Bacteria 2280
191 Ga0207645_10000802 3300025907 Bacteria 26290
192 Ga0207645_10671558 3300025907 Bacteria 704
193 Ga0207654_10073127 3300025911 Unclassified 2042
194 Ga0207695_10026582 3300025913 Bacteria 6459
195 Ga0207662_10050007 3300025918 Unclassified 2482
196 Ga0207646_10071355 3300025922 Bacteria 3102
197 Ga0207681_10016170 3300025923 Bacteria 4661
198 Ga0207681_10081944 3300025923 Bacteria 2279
199 Ga0207659_10001218 3300025926 Bacteria 15394
200 Ga0207659_10228459 3300025926 Archaea 1500
201 Ga0207659_10509120 3300025926 Unclassified 1020
202 Ga0207687_10011164 3300025927 Bacteria 5868
203 Ga0207687_10181886 3300025927 Unclassified 1629
204 Ga0207700_10177102 3300025928 Bacteria 1783
205 Ga0207664_10026082 3300025929 Bacteria 4412
206 Ga0207644_10115584 3300025931 Unclassified 2035
207 Ga0207690_10446348 3300025932 Bacteria 1039
208 Ga0207690_10931173 3300025932 Bacteria 721
209 Ga0207706_10386769 3300025933 Bacteria 1214
210 Ga0207686_10013730 3300025934 Bacteria 4490
211 Ga0207686_10066134 3300025934 Unclassified 2308
212 Ga0207686_10090311 3300025934 Bacteria 2021
213 Ga0207686_10554821 3300025934 Unclassified 899
214 Ga0207709_10017989 3300025935 Bacteria 3952
215 Ga0207709_10355810 3300025935 Unclassified 1107
216 Ga0207670_10031763 3300025936 Bacteria 3388
217 Ga0207669_10019497 3300025937 Unclassified 3533
218 Ga0207704_10009507 3300025938 Bacteria 4693
219 Ga0207704_10016932 3300025938 Bacteria 3763
220 Ga0207691_10016837 3300025940 Bacteria 6936
221 Ga0207691_10028289 3300025940 Bacteria 5250
222 Ga0207691_10203579 3300025940 Unclassified 1722
223 Ga0207711_10015740 3300025941 Bacteria 6274
224 Ga0207711_10056566 3300025941 Unclassified 3371
225 Ga0207711_10063899 3300025941 Bacteria 3178
226 Ga0207711_10186745 3300025941 Bacteria 1887
227 Ga0207711_10320913 3300025941 Unclassified 1431
228 Ga0207711_10397377 3300025941 Unclassified 1280
229 Ga0207689_10169698 3300025942 Bacteria 1798
230 Ga0207651_10088699 3300025960 Bacteria 2255
231 Ga0207651_10493905 3300025960 Unclassified 1057
232 Ga0207668_10055519 3300025972 Bacteria 2754
233 Ga0207640_10031709 3300025981 Bacteria 3269
234 Ga0207640_10327757 3300025981 Unclassified 1222
235 Ga0207658_10100424 3300025986 Bacteria 2265
236 Ga0207677_10009590 3300026023 Bacteria 5449
237 Ga0207677_10068145 3300026023 Bacteria 2496
238 Ga0207677_10101270 3300026023 Bacteria 2120
239 Ga0207703_10029099 3300026035 Bacteria 4358
240 Ga0207703_10187392 3300026035 Unclassified 1830
241 Ga0207639_10224820 3300026041 Unclassified 1623
242 Ga0207708_10021086 3300026075 Bacteria 4916
243 Ga0207708_10032808 3300026075 Bacteria 3943
244 Ga0207708_10225868 3300026075 Bacteria 1502
245 Ga0207641_10004712 3300026088 Bacteria 11761
246 Ga0207641_10347106 3300026088 Unclassified 1414
247 Ga0207648_10184928 3300026089 Bacteria 1845
248 Ga0207648_10618658 3300026089 Bacteria 999
249 Ga0207676_10024759 3300026095 Bacteria 4445
250 Ga0207676_10152689 3300026095 Unclassified 1991
251 Ga0207674_10108502 3300026116 Bacteria 2752
252 Ga0207675_100005666 3300026118 Bacteria 11956
253 Ga0207675_100113015 3300026118 Unclassified 2564
254 Ga0207675_100144727 3300026118 Unclassified 2259
255 Ga0207675_100290732 3300026118 Bacteria 1590
256 Ga0207683_10032921 3300026121 Bacteria 4503
257 Ga0207683_10118679 3300026121 Unclassified 2373
258 Ga0207683_10170080 3300026121 Unclassified 1973
259 Ga0207683_10451541 3300026121 Unclassified 1185
260 Ga0207683_10750237 3300026121 Bacteria 905
261 Ga0207428_10013656 3300027907 Bacteria 7085
262 Ga0207428_10033622 3300027907 Bacteria 4209
263 Ga0268266_10038090 3300028379 Bacteria 4094
264 Ga0268265_10104647 3300028380 Unclassified 2294
265 Ga0268265_10272709 3300028380 Bacteria 1510
266 Ga0268265_10314465 3300028380 Unclassified 1415
267 Ga0268264_10029034 3300028381 Bacteria 4529
268 Ga0268264_10257131 3300028381 Unclassified 1625
269 Ga0268264_10773927 3300028381 Bacteria 957
270 Ga0307416_100236440 3300032002 Bacteria 1766
271 Ga0307416_100707985 3300032002 Bacteria 1097
272 Ga0373930_0000775 3300034816 Bacteria 4549
273 Ga0373950_0000619 3300034818 Bacteria 4404
274 Ga0373958_0009218 3300034819 Unclassified 1620
275 Ga0373926_0049598 3300035083 Unclassified 1512
276 Ga0373929_0000268 3300035085 Bacteria 9647
277 Ga0373929_0083762 3300035085 Bacteria 781
278 Ga0373940_0000335 3300035088 Bacteria 6952
279 Ga0373949_0000608 3300035090 Bacteria 11690
280 Ga0373951_0001375 3300035091 Bacteria 6381
281 Ga0373952_0004242 3300035092 Bacteria 2592
282 Ga0373923_0192362 3300035111 Bacteria 941
283 Ga0373932_0000945 3300035112 Bacteria 8512
284 Ga0373941_0231058 3300035115 Bacteria 715
285 Ga0373960_0072929 3300035121 Unclassified 1066
286 Ga0373955_0067205 3300035172 Unclassified 1995
287 Ga0373955_0101053 3300035172 Unclassified 1656
288 Ga0373961_0001097 3300035241 Bacteria 8607
289 Ga0373931_0000769 3300035691 Bacteria 13414
290 Ga0373931_0507429 3300035691 Bacteria 779
291 Ga0373935_0156767 3300035692 Unclassified 1549
292 Ga0373937_0066157 3300036401 Bacteria 3328
293 Ga0373925_0011900 3300037068 Bacteria 6298
294 Ga0436365_1831975 3300039437 Bacteria 4820
295 Ga0450920_016023 3300042122 Unclassified 1427
296 Ga0450923_014466 3300042125 Bacteria 1465
297 Ga0453684_0159124 3300044712 Bacteria 2673
298 Ga0495592_0135819 3300046454 Unclassified 1716
299 Ga0495592_0532531 3300046454 Bacteria 725
300 Ga0495629_0277421 3300046459 Unclassified 1151
301 Ga0495618_0566501 3300046514 Unclassified 679
302 Ga0495628_0188988 3300046516 Bacteria 1556
303 Ga0495628_0317092 3300046516 Unclassified 1151
304 Ga0495652_0139059 3300046529 Unclassified 1912
305 Ga0495633_0217929 3300046558 Bacteria 874
306 Ga0495633_0340575 3300046558 Bacteria 680
307 Ga0495635_0532965 3300046663 Unclassified 771
308 Ga0495599_0268643 3300046678 Unclassified 1035
309 Ga0495647_0179398 3300046681 Bacteria 921
310 Ga0495658_0043565 3300046683 Unclassified 2511
311 Ga0495658_0192003 3300046683 Unclassified 1270
312 Ga0495674_0831174 3300047319 Unclassified 717
313 Ga0495684_0207119 3300047471 Unclassified 1444
314 Ga0496100_0004497 3300048903 Bacteria 7399
315 Ga0496101_0000222 3300048904 Bacteria 42490
316 Ga0496102_1038298 3300048905 Bacteria 740
317 Ga0496104_0026075 3300048907 Bacteria 5392
318 Ga0496105_0030097 3300048908 Bacteria 4448
319 Ga0496105_0321069 3300048908 Bacteria 1241
320 Ga0496106_0098231 3300048909 Unclassified 2268
321 Ga0496107_0035412 3300048910 Bacteria 3579
322 Ga0496108_0139774 3300048911 Bacteria 2086
323 Ga0496109_0150994 3300048912 Bacteria 2175
324 Ga0496112_0168893 3300048915 Bacteria 2153
325 Ga0496113_0581817 3300048916 Bacteria 897
326 Ga0496114_0000409 3300048917 Bacteria 31807
327 Ga0496115_0097793 3300048918 Bacteria 2404
328 Ga0501034_0066294 3300049571 Bacteria 3623
329 Ga0501047_0138643 3300049581 Bacteria 2311
330 Ga0501079_0315794 3300049741 Unclassified 1223
331 Ga0501083_0059604 3300049744 Bacteria 2553
332 Ga0501044_0109099 3300049823 Bacteria 2777
333 nmdc:mga05p37_17849_c1 3300050507 Bacteria 8565
334 nmdc:mga05p37_313000_c1 3300050507 Bacteria 1860
335 nmdc:mga05p37_65672_c1 3300050507 Bacteria 4464
336 nmdc:mga05p37_664975_c1 3300050507 Bacteria 1164
337 nmdc:mga06r32_120723_c1 3300050510 Bacteria 2585
338 nmdc:mga08y16_171640_c1 3300050511 Bacteria 2252
339 nmdc:mga08y16_367653_c1 3300050511 Bacteria 1476
340 nmdc:mga08y16_548333_c1 3300050511 Bacteria 1170
341 nmdc:mga08y16_82721_c1 3300050511 Bacteria 3347
342 nmdc:mga08y16_9590_c1 3300050511 Bacteria 10164
343 nmdc:mga0n895_130_c1 3300050512 Bacteria 44769
344 nmdc:mga0n895_23161_c1 3300050512 Bacteria 5834
345 nmdc:mga0n895_241774_c1 3300050512 Bacteria 1832
346 nmdc:mga0n895_28636_c1 3300050512 Bacteria 5301
347 nmdc:mga0n895_358041_c1 3300050512 Bacteria 1478
348 nmdc:mga0rr50_43673_c1 3300050513 Unclassified 3282
349 nmdc:mga0rr50_504_c1 3300050513 Bacteria 20788
350 nmdc:mga0rr50_516810_c1 3300050513 Bacteria 1016
351 nmdc:mga0rr50_5366_c1 3300050513 Bacteria 7639
352 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
353 nmdc:mga0rr50_87559_c1 3300050513 Unclassified 2418
354 nmdc:mga08x19_15408_c1 3300050514 Bacteria 4652
355 nmdc:mga08x19_270_c1 3300050514 Bacteria 39380
356 nmdc:mga08x19_417714_c1 3300050514 Bacteria 942
357 nmdc:mga08x19_523060_c1 3300050514 Bacteria 838
358 nmdc:mga0a205_52607_c1 3300050515 Bacteria 3930
359 Ga0495601_0170711 3300053077 Bacteria 1422
360 Ga0495595_0381088 3300053084 Bacteria 714
361 Ga0495619_0054318 3300053085 Unclassified 2651
362 Ga0495619_0098708 3300053085 Unclassified 1986
363 Ga0070670_100108901
364 Ga0065712_10006457
365 Ga0065712_10388912
366 Ga0065715_10175167
367 Ga0065715_10364810
368 Ga0070676_10003214
369 Ga0070690_100004693
370 Ga0070690_100168723
371 Ga0070690_100169644
372 Ga0070690_100329392
373 Ga0070670_100135852
374 Ga0070670_100157843
375 Ga0070670_100559391
376 Ga0070677_10184849
377 Ga0068869_100429859
378 Ga0070666_10134637
379 Ga0068868_100175880
380 Ga0068868_100328555
381 Ga0070689_100030369
382 Ga0070689_100033737
383 Ga0070691_10001877
384 Ga0070687_100039208
385 Ga0070661_100303364
386 Ga0070692_10344638
387 Ga0070668_100012677
388 Ga0070668_100591646
389 Ga0070669_100065796
390 Ga0070669_100098866
391 Ga0070669_100162160
392 Ga0070669_100506854
393 Ga0070675_100000055
394 Ga0070675_100008120
395 Ga0070675_100056743
396 Ga0070675_100078884
397 Ga0070671_100084601
398 Ga0070671_100225740
399 Ga0070674_100001908
400 Ga0070674_100003104
401 Ga0070674_100204009
402 Ga0070673_100006683
403 Ga0070673_101176019
404 Ga0070688_100020867
405 Ga0070688_100062018
406 Ga0070688_100142932
407 Ga0070659_100433214
408 Ga0070659_101010595
409 Ga0070709_10235040
410 Ga0070714_100004607
411 Ga0070701_10006436
412 Ga0070701_10317491
413 Ga0070701_10599813
414 Ga0070705_100033245
415 Ga0070705_100133861
416 Ga0070700_100015959
417 Ga0070700_100019055
418 Ga0070708_100512986
419 Ga0070678_100044789
420 Ga0070678_100119204
421 Ga0070662_100063627
422 Ga0068867_100013963
423 Ga0070685_10029597
424 Ga0070707_100318306
425 Ga0070698_100119268
426 Ga0070698_100166780
427 Ga0070699_100109694
428 Ga0070684_100745274
429 Ga0070697_100209026
430 Ga0070697_100618217
431 Ga0068853_100342314
432 Ga0068853_100991853
433 Ga0070672_100014950
434 Ga0070672_100036016
435 Ga0070672_100529151
436 Ga0070686_100002283
437 Ga0070686_100337338
438 Ga0070686_100422473
439 Ga0070686_100683708
440 Ga0070695_100053005
441 Ga0070695_100514365
442 Ga0070696_100024768
443 Ga0070704_100028213
444 Ga0070664_100444812
445 Ga0068857_100121834
446 Ga0068854_100042303
447 Ga0070702_100028873
448 Ga0070702_100093577
449 Ga0068859_100061229
450 Ga0068859_100069229
451 Ga0068859_100698787
452 Ga0068859_100887048
453 Ga0068864_100006425
454 Ga0068864_101104453
455 Ga0068861_100005216
456 Ga0068861_100177201
457 Ga0068861_100991005
458 Ga0068863_100017618
459 Ga0068858_100038174
460 Ga0068858_100041782
461 Ga0068858_100271735
462 Ga0068858_100288188
463 Ga0068860_100092076
464 Ga0068860_100546304
465 Ga0068860_100918033
466 Ga0068860_101321715
467 Ga0068862_100023648
468 Ga0068862_100061873
469 Ga0081455_10112817
470 Ga0081455_10179833
471 Ga0081539_10016120
472 Ga0075432_10042772
473 Ga0070715_10157428
474 Ga0097621_100017472
475 Ga0097621_100145767
476 Ga0097621_100150038
477 Ga0097621_100532772
478 Ga0068871_100020475
479 Ga0068871_100023465
480 Ga0075428_100070610
481 Ga0075428_100090250
482 Ga0075428_100564076
483 Ga0075431_100129137
484 Ga0075433_10017177
485 Ga0075434_100000260
486 Ga0075434_100165522
487 Ga0075434_100213980
488 Ga0075434_100240878
489 Ga0075434_100520781
490 Ga0075434_100580058
491 Ga0075434_101376837
492 Ga0068865_100343228
493 Ga0068865_100345357
494 Ga0075436_100055284
495 Ga0075436_100138536
496 Ga0075436_100280210
497 Ga0097620_100061228
498 Ga0097620_100069226
499 Ga0097620_100698658
500 Ga0097620_100887193
501 Ga0075435_100000064
502 Ga0075435_100000956
503 Ga0075435_100004297
504 Ga0075435_100009317
505 Ga0075435_100108204
506 Ga0075435_100559439
507 Ga0105240_10021294
508 Ga0111539_10002176
509 Ga0111539_10110111
510 Ga0111539_10573731
511 Ga0111539_10701494
512 Ga0105245_10007999
513 Ga0105245_11269845
514 Ga0114129_10012810
515 Ga0114129_10023049
516 Ga0114129_10053976
517 Ga0114129_10620057
518 Ga0105243_10008686
519 Ga0105241_10119780
520 Ga0105242_10091657
521 Ga0105242_10107357
522 Ga0105242_10159423
523 Ga0105242_10270167
524 Ga0105242_11237815
525 Ga0105248_10006365
526 Ga0105248_10061545
527 Ga0105248_10119052
528 Ga0105248_10175635
529 Ga0105248_10226984
530 Ga0105248_10566103
531 Ga0105248_10792397
532 Ga0105248_10879589
533 Ga0105238_10221142
534 Ga0157374_10739420
535 Ga0157378_10750579
536 Ga0163162_10062425
537 Ga0163162_10849579
538 Ga0157375_10560286
539 Ga0163163_10558253
540 Ga0157380_10362988
541 Ga0157380_10775244
542 Ga0157377_10066802
543 Ga0157379_10155639
544 Ga0157376_10079596
545 Ga0213876_10198001
546 Ga0207697_10027602
547 Ga0207682_10053108
548 Ga0207642_10251369
549 Ga0207688_10033020
550 Ga0207688_10347604
551 Ga0207680_10009434
552 Ga0207680_10062129
553 Ga0207645_10000802
554 Ga0207645_10671558
555 Ga0207654_10073127
556 Ga0207695_10026582
557 Ga0207662_10050007
558 Ga0207646_10071355
559 Ga0207681_10016170
560 Ga0207681_10081944
561 Ga0207659_10001218
562 Ga0207659_10228459
563 Ga0207659_10509120
564 Ga0207687_10011164
565 Ga0207687_10181886
566 Ga0207700_10177102
567 Ga0207664_10026082
568 Ga0207644_10115584
569 Ga0207690_10446348
570 Ga0207690_10931173
571 Ga0207706_10386769
572 Ga0207686_10013730
573 Ga0207686_10066134
574 Ga0207686_10090311
575 Ga0207686_10554821
576 Ga0207709_10017989
577 Ga0207709_10355810
578 Ga0207670_10031763
579 Ga0207669_10019497
580 Ga0207704_10009507
581 Ga0207704_10016932
582 Ga0207691_10016837
583 Ga0207691_10028289
584 Ga0207691_10203579
585 Ga0207711_10015740
586 Ga0207711_10056566
587 Ga0207711_10063899
588 Ga0207711_10186745
589 Ga0207711_10320913
590 Ga0207711_10397377
591 Ga0207689_10169698
592 Ga0207651_10088699
593 Ga0207651_10493905
594 Ga0207668_10055519
595 Ga0207640_10031709
596 Ga0207640_10327757
597 Ga0207658_10100424
598 Ga0207677_10009590
599 Ga0207677_10068145
600 Ga0207677_10101270
601 Ga0207703_10029099
602 Ga0207703_10187392
603 Ga0207639_10224820
604 Ga0207708_10021086
605 Ga0207708_10032808
606 Ga0207708_10225868
607 Ga0207641_10004712
608 Ga0207641_10347106
609 Ga0207648_10184928
610 Ga0207648_10618658
611 Ga0207676_10024759
612 Ga0207676_10152689
613 Ga0207674_10108502
614 Ga0207675_100005666
615 Ga0207675_100113015
616 Ga0207675_100144727
617 Ga0207675_100290732
618 Ga0207683_10032921
619 Ga0207683_10118679
620 Ga0207683_10170080
621 Ga0207683_10451541
622 Ga0207683_10750237
623 Ga0207428_10013656
624 Ga0207428_10033622
625 Ga0268266_10038090
626 Ga0268265_10104647
627 Ga0268265_10272709
628 Ga0268265_10314465
629 Ga0268264_10029034
630 Ga0268264_10257131
631 Ga0268264_10773927
632 Ga0307416_100236440
633 Ga0307416_100707985
634 Ga0373930_0000775
635 Ga0373950_0000619
636 Ga0373958_0009218
637 Ga0373926_0049598
638 Ga0373929_0000268
639 Ga0373929_0083762
640 Ga0373940_0000335
641 Ga0373949_0000608
642 Ga0373951_0001375
643 Ga0373952_0004242
644 Ga0373923_0192362
645 Ga0373932_0000945
646 Ga0373941_0231058
647 Ga0373960_0072929
648 Ga0373955_0067205
649 Ga0373955_0101053
650 Ga0373961_0001097
651 Ga0373931_0000769
652 Ga0373931_0507429
653 Ga0373935_0156767
654 Ga0373937_0066157
655 Ga0373925_0011900
656 Ga0436365_1831975
657 Ga0450920_016023
658 Ga0450923_014466
659 Ga0453684_0159124
660 Ga0495592_0135819
661 Ga0495592_0532531
662 Ga0495629_0277421
663 Ga0495618_0566501
664 Ga0495628_0188988
665 Ga0495628_0317092
666 Ga0495652_0139059
667 Ga0495633_0217929
668 Ga0495633_0340575
669 Ga0495635_0532965
670 Ga0495599_0268643
671 Ga0495647_0179398
672 Ga0495658_0043565
673 Ga0495658_0192003
674 Ga0495674_0831174
675 Ga0495684_0207119
676 Ga0496100_0004497
677 Ga0496101_0000222
678 Ga0496102_1038298
679 Ga0496104_0026075
680 Ga0496105_0030097
681 Ga0496105_0321069
682 Ga0496106_0098231
683 Ga0496107_0035412
684 Ga0496108_0139774
685 Ga0496109_0150994
686 Ga0496112_0168893
687 Ga0496113_0581817
688 Ga0496114_0000409
689 Ga0496115_0097793
690 Ga0501034_0066294
691 Ga0501047_0138643
692 Ga0501079_0315794
693 Ga0501083_0059604
694 Ga0501044_0109099
695 nmdc:mga05p37_17849_c1
696 nmdc:mga05p37_313000_c1
697 nmdc:mga05p37_65672_c1
698 nmdc:mga05p37_664975_c1
699 nmdc:mga06r32_120723_c1
700 nmdc:mga08y16_171640_c1
701 nmdc:mga08y16_367653_c1
702 nmdc:mga08y16_548333_c1
703 nmdc:mga08y16_82721_c1
704 nmdc:mga08y16_9590_c1
705 nmdc:mga0n895_130_c1
706 nmdc:mga0n895_23161_c1
707 nmdc:mga0n895_241774_c1
708 nmdc:mga0n895_28636_c1
709 nmdc:mga0n895_358041_c1
710 nmdc:mga0rr50_43673_c1
711 nmdc:mga0rr50_504_c1
712 nmdc:mga0rr50_516810_c1
713 nmdc:mga0rr50_5366_c1
714 nmdc:mga0rr50_5_c1
715 nmdc:mga0rr50_87559_c1
716 nmdc:mga08x19_15408_c1
717 nmdc:mga08x19_270_c1
718 nmdc:mga08x19_417714_c1
719 nmdc:mga08x19_523060_c1
720 nmdc:mga0a205_52607_c1
721 Ga0495601_0170711
722 Ga0495595_0381088
723 Ga0495619_0054318
724 Ga0495619_0098708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04350

PilO

Pilus assembly protein, PilO

40

187

0.94

PF10741

T2SSM_b

Type II secretion system (T2SS), protein M subtype b

69

183

0.87

Map