F422265

General Info

Members Datasets Scaffolds Average Seq Length
361 154 722 156

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10089429|Ga0265316_100894293
Length 190
Sequence MNLFGLMETSGSAMEAERMRAEVVAANMANAETTRTAVGGPYRRQEVVFAANGGDAGFLDAMNGSVNGSATESLNTTTASDGIGLAGVGPMGWGNSGSPALPPLLPLPGAANVAPGVHIVQVVEDPSLPLKRYDPGHPDAGQDGYVAYPDINPLTEMVDLMGATRAYGLNGSAVQAEKGMITSALEIAKT

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 2.22
Rhizosphere 95.84
Stem 0
Stem Tuber 0
Unclassified 16.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10089429 3300031344 Bacteria 2350
2 JGI24740J21852_10108990 3300001979 Bacteria 700
3 rootH1_10121046 3300003316 Bacteria 4377
4 rootH2_10032253 3300003320 Bacteria 1685
5 rootL2_10195766 3300003322 Bacteria 1256
6 Ga0070658_10000007 3300005327 Bacteria 349444
7 Ga0070658_10072675 3300005327 Unclassified 2819
8 Ga0070658_10414332 3300005327 Bacteria 1158
9 Ga0070683_100054605 3300005329 Bacteria 3704
10 Ga0070683_100143994 3300005329 Bacteria 2258
11 Ga0070683_100365450 3300005329 Unclassified 1374
12 Ga0070683_100856716 3300005329 Bacteria 871
13 Ga0070666_10035538 3300005335 Bacteria 3305
14 Ga0070666_10090632 3300005335 Bacteria 2100
15 Ga0070680_101052348 3300005336 Unclassified 703
16 Ga0070682_100155655 3300005337 Bacteria 1573
17 Ga0070682_100157705 3300005337 Bacteria 1564
18 Ga0068868_100183223 3300005338 Bacteria 1738
19 Ga0068868_100409213 3300005338 Unclassified 1172
20 Ga0070660_100167487 3300005339 Bacteria 1773
21 Ga0070660_100638655 3300005339 Bacteria 891
22 Ga0070661_100000713 3300005344 Bacteria 24364
23 Ga0070661_100017707 3300005344 Bacteria 5057
24 Ga0070668_100139859 3300005347 Bacteria 1950
25 Ga0070671_100002429 3300005355 Bacteria 14402
26 Ga0070671_100103798 3300005355 Bacteria 2385
27 Ga0070671_100290384 3300005355 Bacteria 1392
28 Ga0070659_100498939 3300005366 Unclassified 1037
29 Ga0070659_101719524 3300005366 Unclassified 561
30 Ga0070667_100163641 3300005367 Bacteria 1961
31 Ga0070709_10476360 3300005434 Bacteria 944
32 Ga0070713_100178063 3300005436 Bacteria 1909
33 Ga0070713_101302118 3300005436 Unclassified 704
34 Ga0070663_100001552 3300005455 Bacteria 12656
35 Ga0070663_100137450 3300005455 Bacteria 1862
36 Ga0070663_100150845 3300005455 Bacteria 1782
37 Ga0070678_100823259 3300005456 Bacteria 844
38 Ga0070679_100009317 3300005530 Bacteria 9283
39 Ga0070679_100263379 3300005530 Bacteria 1679
40 Ga0070684_100003452 3300005535 Bacteria 11863
41 Ga0070684_100081752 3300005535 Bacteria 2859
42 Ga0070684_100138967 3300005535 Bacteria 2196
43 Ga0070684_100153390 3300005535 Bacteria 2088
44 Ga0068853_100000050 3300005539 Bacteria 90103
45 Ga0068853_100255570 3300005539 Bacteria 1609
46 Ga0068853_100309422 3300005539 Bacteria 1462
47 Ga0068853_100565183 3300005539 Unclassified 1078
48 Ga0068853_101203399 3300005539 Unclassified 731
49 Ga0070693_100226766 3300005547 Unclassified 1227
50 Ga0070665_100004409 3300005548 Bacteria 14793
51 Ga0070665_100013202 3300005548 Bacteria 8321
52 Ga0070665_100101363 3300005548 Bacteria 2883
53 Ga0070665_101901187 3300005548 Unclassified 601
54 Ga0068855_100001092 3300005563 Bacteria 33724
55 Ga0068855_100010471 3300005563 Bacteria 11190
56 Ga0068855_100038086 3300005563 Bacteria 5715
57 Ga0068855_100320718 3300005563 Bacteria 1713
58 Ga0068855_101255921 3300005563 Unclassified 768
59 Ga0070664_101415495 3300005564 Unclassified 657
60 Ga0068857_100018621 3300005577 Bacteria 6093
61 Ga0068857_100788031 3300005577 Unclassified 907
62 Ga0068854_100016926 3300005578 Bacteria 4870
63 Ga0068856_100002119 3300005614 Bacteria 20598
64 Ga0068856_100006755 3300005614 Bacteria 11233
65 Ga0068856_100007379 3300005614 Bacteria 10731
66 Ga0068856_100194144 3300005614 Unclassified 2044
67 Ga0068856_100197043 3300005614 Bacteria 2028
68 Ga0068856_100358723 3300005614 Bacteria 1476
69 Ga0068856_100811358 3300005614 Unclassified 955
70 Ga0068852_100000070 3300005616 Bacteria 70652
71 Ga0068852_100008264 3300005616 Bacteria 7657
72 Ga0068852_100451004 3300005616 Bacteria 1273
73 Ga0068852_100471958 3300005616 Bacteria 1245
74 Ga0068852_100744357 3300005616 Unclassified 992
75 Ga0068859_100373151 3300005617 Unclassified 1522
76 Ga0068851_10011554 3300005834 Bacteria 4144
77 Ga0068851_10061099 3300005834 Bacteria 1931
78 Ga0068851_10092291 3300005834 Bacteria 1595
79 Ga0068851_10131823 3300005834 Bacteria 1352
80 Ga0068863_100090524 3300005841 Bacteria 2901
81 Ga0068858_100897391 3300005842 Bacteria 867
82 Ga0070717_10628209 3300006028 Bacteria 975
83 Ga0097621_100498654 3300006237 Unclassified 1103
84 Ga0097621_100767817 3300006237 Unclassified 891
85 Ga0068871_100052476 3300006358 Bacteria 3302
86 Ga0097620_100373158 3300006931 Unclassified 1522
87 Ga0105240_10000828 3300009093 Bacteria 55952
88 Ga0105240_10001319 3300009093 Bacteria 42818
89 Ga0105240_10035083 3300009093 Bacteria 6468
90 Ga0105240_10041995 3300009093 Bacteria 5831
91 Ga0105240_10110157 3300009093 Bacteria 3333
92 Ga0105240_10148859 3300009093 Bacteria 2790
93 Ga0105240_10293603 3300009093 Bacteria 1862
94 Ga0105240_10370310 3300009093 Unclassified 1620
95 Ga0105240_10517306 3300009093 Bacteria 1325
96 Ga0105240_10593733 3300009093 Unclassified 1220
97 Ga0105240_10783571 3300009093 Bacteria 1034
98 Ga0105240_11311273 3300009093 Unclassified 763
99 Ga0105245_10005864 3300009098 Bacteria 10787
100 Ga0105245_10032841 3300009098 Bacteria 4597
101 Ga0105247_10556183 3300009101 Unclassified 844
102 Ga0105243_10556378 3300009148 Unclassified 1097
103 Ga0105241_10000064 3300009174 Bacteria 80199
104 Ga0105241_10007952 3300009174 Bacteria 7799
105 Ga0105241_10012410 3300009174 Bacteria 6245
106 Ga0105241_10024249 3300009174 Bacteria 4505
107 Ga0105242_10465450 3300009176 Bacteria 1195
108 Ga0105248_10008161 3300009177 Bacteria 11502
109 Ga0105248_10011531 3300009177 Bacteria 9743
110 Ga0105237_10000242 3300009545 Bacteria 77727
111 Ga0105237_10038533 3300009545 Bacteria 4827
112 Ga0105237_10088868 3300009545 Bacteria 3079
113 Ga0105237_10336617 3300009545 Bacteria 1513
114 Ga0105238_10000080 3300009551 Bacteria 109312
115 Ga0105238_10003244 3300009551 Bacteria 16244
116 Ga0105238_10008255 3300009551 Bacteria 10417
117 Ga0105238_10012324 3300009551 Bacteria 8621
118 Ga0105238_10016150 3300009551 Bacteria 7554
119 Ga0105238_10059533 3300009551 Bacteria 3826
120 Ga0105238_10108507 3300009551 Bacteria 2757
121 Ga0105239_10000571 3300010375 Bacteria 52864
122 Ga0105239_10003058 3300010375 Bacteria 20792
123 Ga0105239_10204782 3300010375 Bacteria 2211
124 Ga0105239_10604892 3300010375 Bacteria 1251
125 Ga0105239_10637920 3300010375 Bacteria 1216
126 Ga0105239_10679022 3300010375 Unclassified 1177
127 Ga0105239_12592312 3300010375 Unclassified 591
128 Ga0157373_10132146 3300013100 Bacteria 1755
129 Ga0157371_10315387 3300013102 Unclassified 1134
130 Ga0157371_10595018 3300013102 Bacteria 822
131 Ga0157370_10003018 3300013104 Bacteria 19982
132 Ga0157370_10271473 3300013104 Bacteria 1567
133 Ga0157370_11317083 3300013104 Unclassified 651
134 Ga0157369_10000212 3300013105 Bacteria 81198
135 Ga0157369_10002792 3300013105 Bacteria 20846
136 Ga0157369_10005306 3300013105 Bacteria 15019
137 Ga0157369_10007428 3300013105 Bacteria 12623
138 Ga0157369_10010733 3300013105 Bacteria 10425
139 Ga0157374_10004485 3300013296 Bacteria 11724
140 Ga0157374_10007127 3300013296 Bacteria 9523
141 Ga0157374_10008188 3300013296 Bacteria 8934
142 Ga0157374_10020184 3300013296 Bacteria 5909
143 Ga0157374_11232635 3300013296 Unclassified 770
144 Ga0157378_10006109 3300013297 Bacteria 10545
145 Ga0157378_10028379 3300013297 Bacteria 4937
146 Ga0157378_11225107 3300013297 Unclassified 790
147 Ga0163162_10163184 3300013306 Bacteria 2351
148 Ga0157372_10001434 3300013307 Bacteria 25759
149 Ga0157372_10002974 3300013307 Bacteria 18260
150 Ga0157372_10019036 3300013307 Bacteria 7391
151 Ga0157372_10020304 3300013307 Bacteria 7166
152 Ga0157372_10021169 3300013307 Bacteria 7025
153 Ga0157372_10479417 3300013307 Bacteria 1450
154 Ga0157372_11981135 3300013307 Bacteria 669
155 Ga0157375_10119268 3300013308 Bacteria 2746
156 Ga0157375_11651217 3300013308 Bacteria 758
157 Ga0157375_12670008 3300013308 Unclassified 597
158 Ga0163163_10120531 3300014325 Bacteria 2657
159 Ga0157379_10412593 3300014968 Bacteria 1243
160 Ga0157376_10008439 3300014969 Bacteria 7435
161 Ga0157376_10032231 3300014969 Bacteria 4206
162 Ga0157376_10061386 3300014969 Bacteria 3160
163 Ga0163161_11360447 3300017792 Bacteria 619
164 Ga0207656_10020922 3300025321 Bacteria 2606
165 Ga0207656_10054150 3300025321 Bacteria 1743
166 Ga0207656_10217770 3300025321 Unclassified 927
167 Ga0207680_10049417 3300025903 Bacteria 2503
168 Ga0207680_10173822 3300025903 Bacteria 1452
169 Ga0207647_10003211 3300025904 Bacteria 12267
170 Ga0207647_10095669 3300025904 Bacteria 1768
171 Ga0207705_10000013 3300025909 Bacteria 451680
172 Ga0207705_10058022 3300025909 Bacteria 2793
173 Ga0207705_10124821 3300025909 Bacteria 1912
174 Ga0207654_10000357 3300025911 Bacteria 27032
175 Ga0207654_10009328 3300025911 Bacteria 4981
176 Ga0207654_10040224 3300025911 Bacteria 2633
177 Ga0207654_10090044 3300025911 Unclassified 1868
178 Ga0207695_10000063 3300025913 Bacteria 349527
179 Ga0207695_10000144 3300025913 Bacteria 211125
180 Ga0207695_10011673 3300025913 Bacteria 10617
181 Ga0207695_10043516 3300025913 Bacteria 4785
182 Ga0207695_10092046 3300025913 Bacteria 3044
183 Ga0207695_10162375 3300025913 Bacteria 2165
184 Ga0207671_10001117 3300025914 Bacteria 32349
185 Ga0207671_10395635 3300025914 Bacteria 1099
186 Ga0207671_10411887 3300025914 Unclassified 1075
187 Ga0207671_11010151 3300025914 Bacteria 655
188 Ga0207660_10063325 3300025917 Bacteria 2666
189 Ga0207649_10003299 3300025920 Bacteria 8834
190 Ga0207652_10018119 3300025921 Bacteria 5772
191 Ga0207694_10000028 3300025924 Bacteria 242395
192 Ga0207694_10000673 3300025924 Bacteria 30672
193 Ga0207694_10144094 3300025924 Bacteria 1917
194 Ga0207694_10160702 3300025924 Bacteria 1814
195 Ga0207687_10022555 3300025927 Bacteria 4191
196 Ga0207700_10132556 3300025928 Bacteria 2037
197 Ga0207700_10468068 3300025928 Bacteria 1113
198 Ga0207700_11060234 3300025928 Bacteria 725
199 Ga0207644_10008792 3300025931 Bacteria 6611
200 Ga0207644_10068791 3300025931 Bacteria 2584
201 Ga0207709_10323487 3300025935 Unclassified 1155
202 Ga0207711_10025580 3300025941 Bacteria 4951
203 Ga0207711_10432352 3300025941 Bacteria 1225
204 Ga0207661_10039481 3300025944 Bacteria 3705
205 Ga0207661_10045826 3300025944 Bacteria 3464
206 Ga0207661_10053479 3300025944 Bacteria 3231
207 Ga0207661_10115031 3300025944 Bacteria 2282
208 Ga0207667_10000712 3300025949 Bacteria 43137
209 Ga0207667_10020711 3300025949 Bacteria 7308
210 Ga0207667_10021216 3300025949 Bacteria 7200
211 Ga0207667_10031308 3300025949 Bacteria 5743
212 Ga0207667_10755913 3300025949 Bacteria 971
213 Ga0207668_10322530 3300025972 Bacteria 1282
214 Ga0207658_10164104 3300025986 Bacteria 1823
215 Ga0207677_10365024 3300026023 Bacteria 1214
216 Ga0207677_10462061 3300026023 Bacteria 1090
217 Ga0207703_10950168 3300026035 Bacteria 824
218 Ga0207639_10000291 3300026041 Bacteria 35686
219 Ga0207639_10027344 3300026041 Bacteria 4155
220 Ga0207639_10166952 3300026041 Bacteria 1860
221 Ga0207639_10181998 3300026041 Bacteria 1788
222 Ga0207678_10000102 3300026067 Bacteria 69930
223 Ga0207678_10517497 3300026067 Bacteria 1041
224 Ga0207702_10001563 3300026078 Bacteria 22664
225 Ga0207702_10159032 3300026078 Unclassified 2062
226 Ga0207702_10404835 3300026078 Bacteria 1317
227 Ga0207641_10105918 3300026088 Bacteria 2484
228 Ga0207676_10533161 3300026095 Bacteria 1119
229 Ga0207674_10003255 3300026116 Bacteria 19989
230 Ga0207674_10201245 3300026116 Bacteria 1941
231 Ga0207674_10767492 3300026116 Bacteria 931
232 Ga0207698_10000047 3300026142 Bacteria 90840
233 Ga0207698_10006609 3300026142 Bacteria 7252
234 Ga0207698_10192235 3300026142 Bacteria 1819
235 Ga0207698_10408255 3300026142 Bacteria 1300
236 Ga0207698_10632385 3300026142 Unclassified 1058
237 Ga0268266_10032405 3300028379 Bacteria 4440
238 Ga0268266_10033348 3300028379 Bacteria 4377
239 Ga0268266_10066358 3300028379 Bacteria 3121
240 Ga0268266_10066536 3300028379 Bacteria 3117
241 Ga0268266_10653801 3300028379 Bacteria 1012
242 Ga0268266_11189894 3300028379 Unclassified 737
243 Ga0265318_10012119 3300028577 Bacteria 3681
244 Ga0265336_10005665 3300028666 Bacteria 4582
245 Ga0265338_10003648 3300028800 Bacteria 21446
246 Ga0265338_10003948 3300028800 Bacteria 20440
247 Ga0265338_10009837 3300028800 Bacteria 11330
248 Ga0265338_10323948 3300028800 Bacteria 1115
249 Ga0265762_1027590 3300030760 Unclassified 1066
250 Ga0265770_1021146 3300030878 Bacteria 1032
251 Ga0265330_10000235 3300031235 Bacteria 41720
252 Ga0265330_10013889 3300031235 Bacteria 3744
253 Ga0265330_10034519 3300031235 Bacteria 2259
254 Ga0265330_10337496 3300031235 Bacteria 636
255 Ga0265332_10061094 3300031238 Bacteria 1611
256 Ga0265328_10005363 3300031239 Bacteria 5491
257 Ga0265328_10023576 3300031239 Bacteria 2333
258 Ga0265328_10107374 3300031239 Bacteria 1036
259 Ga0265320_10110070 3300031240 Bacteria 1262
260 Ga0265320_10111991 3300031240 Unclassified 1250
261 Ga0265325_10000341 3300031241 Bacteria 32989
262 Ga0265325_10001538 3300031241 Bacteria 16144
263 Ga0265325_10019213 3300031241 Bacteria 3782
264 Ga0265325_10022814 3300031241 Bacteria 3424
265 Ga0265325_10041954 3300031241 Bacteria 2395
266 Ga0265325_10044834 3300031241 Bacteria 2301
267 Ga0265325_10047770 3300031241 Bacteria 2215
268 Ga0265329_10012083 3300031242 Bacteria 3118
269 Ga0265340_10006098 3300031247 Bacteria 6647
270 Ga0265340_10012479 3300031247 Bacteria 4487
271 Ga0265340_10040768 3300031247 Bacteria 2286
272 Ga0265340_10244471 3300031247 Unclassified 800
273 Ga0265340_10291567 3300031247 Unclassified 724
274 Ga0265339_10000040 3300031249 Bacteria 120556
275 Ga0265339_10001213 3300031249 Bacteria 19443
276 Ga0265339_10002181 3300031249 Bacteria 14200
277 Ga0265339_10002344 3300031249 Bacteria 13612
278 Ga0265339_10153766 3300031249 Bacteria 1161
279 Ga0265339_10182026 3300031249 Bacteria 1046
280 Ga0265316_10000912 3300031344 Bacteria 32124
281 Ga0265316_10016339 3300031344 Bacteria 6441
282 Ga0265316_10021227 3300031344 Bacteria 5508
283 Ga0265316_10088518 3300031344 Bacteria 2364
284 Ga0265316_10131080 3300031344 Bacteria 1888
285 Ga0265316_10194296 3300031344 Bacteria 1506
286 Ga0265316_10864260 3300031344 Unclassified 633
287 Ga0265313_10001791 3300031595 Bacteria 19621
288 Ga0265313_10002848 3300031595 Bacteria 14510
289 Ga0265313_10160330 3300031595 Unclassified 956
290 Ga0265314_10000081 3300031711 Bacteria 143776
291 Ga0265314_10022144 3300031711 Bacteria 4871
292 Ga0265314_10224608 3300031711 Bacteria 1093
293 Ga0265342_10001522 3300031712 Bacteria 21432
294 Ga0265342_10004607 3300031712 Bacteria 10757
295 Ga0265342_10005508 3300031712 Bacteria 9625
296 Ga0265342_10093345 3300031712 Bacteria 1723
297 Ga0265342_10134482 3300031712 Bacteria 1383
298 Ga0265342_10191469 3300031712 Bacteria 1116
299 Ga0265342_10240160 3300031712 Unclassified 970
300 Ga0265342_10289231 3300031712 Bacteria 866
301 Ga0265342_10519315 3300031712 Unclassified 606
302 Ga0307510_10113600 3300033180 Unclassified 2441
303 Ga0373955_0310909 3300035172 Bacteria 951
304 Ga0373933_0089457 3300035724 Unclassified 1898
305 Ga0373933_0429150 3300035724 Bacteria 864
306 Ga0373933_0613414 3300035724 Bacteria 715
307 Ga0373937_0003128 3300036401 Bacteria 13847
308 Ga0439448_0120913 3300042005 Bacteria 899
309 Ga0466969_0221361 3300044656 Unclassified 861
310 Ga0466961_0013229 3300044693 Bacteria 5281
311 Ga0495603_0041283 3300046455 Bacteria 2759
312 Ga0495629_0089612 3300046459 Bacteria 2146
313 Ga0495629_0115664 3300046459 Bacteria 1869
314 Ga0495629_0121073 3300046459 Bacteria 1823
315 Ga0495629_0123200 3300046459 Bacteria 1806
316 Ga0495651_0251819 3300046462 Bacteria 1206
317 Ga0495650_0000010 3300046471 Bacteria 645599
318 Ga0495580_0167026 3300046472 Bacteria 1522
319 Ga0495582_0076556 3300046473 Unclassified 1855
320 Ga0495582_0573947 3300046473 Bacteria 652
321 Ga0495594_0000565 3300046499 Bacteria 19006
322 Ga0495594_0007994 3300046499 Bacteria 5437
323 Ga0495596_0028106 3300046500 Bacteria 2259
324 Ga0495583_0074267 3300046506 Bacteria 1489
325 Ga0495583_0097687 3300046506 Bacteria 1257
326 Ga0495606_0033938 3300046507 Bacteria 3511
327 Ga0495606_0229236 3300046507 Bacteria 1042
328 Ga0495643_0057098 3300046522 Bacteria 2081
329 Ga0495644_0000186 3300046523 Bacteria 29113
330 Ga0495652_0236683 3300046529 Bacteria 1362
331 Ga0495665_0066887 3300046531 Bacteria 1896
332 Ga0495665_0271883 3300046531 Unclassified 870
333 Ga0495665_0428995 3300046531 Bacteria 669
334 Ga0495645_0269012 3300046543 Unclassified 1125
335 Ga0495611_0227641 3300046648 Bacteria 867
336 Ga0495669_0011792 3300046684 Bacteria 3716
337 Ga0495613_0008056 3300046689 Bacteria 7835
338 Ga0495670_0158586 3300046691 Bacteria 1188
339 Ga0495604_0286849 3300047317 Bacteria 1110
340 Ga0495683_0187951 3300047323 Bacteria 939
341 Ga0495687_057935 3300047443 Bacteria 1609
342 Ga0495677_0067443 3300047445 Bacteria 1331
343 Ga0495673_0106228 3300047469 Bacteria 1128
344 Ga0495684_0415864 3300047471 Bacteria 941
345 Ga0495684_0457149 3300047471 Bacteria 886
346 Ga0495686_0010928 3300047472 Bacteria 6427
347 Ga0495602_0293266 3300048088 Unclassified 1193
348 Ga0495602_0746909 3300048088 Unclassified 661
349 Ga0496100_0147973 3300048903 Bacteria 1672
350 Ga0496104_0116641 3300048907 Unclassified 2562
351 Ga0496105_0149531 3300048908 Bacteria 1920
352 Ga0496106_0752981 3300048909 Bacteria 774
353 Ga0496107_0131413 3300048910 Bacteria 1848
354 Ga0496112_1074448 3300048915 Bacteria 723
355 Ga0496115_0081856 3300048918 Unclassified 2629
356 Ga0496115_0317919 3300048918 Bacteria 1274
357 Ga0496126_0017020 3300048929 Bacteria 7253
358 Ga0496126_0592052 3300048929 Bacteria 875
359 Ga0495601_0062814 3300053077 Bacteria 2360
360 Ga0495619_0475155 3300053085 Unclassified 861
361 Ga0500643_025611 3300053087 Bacteria 1858
362 Ga0265316_10089429
363 JGI24740J21852_10108990
364 rootH1_10121046
365 rootH2_10032253
366 rootL2_10195766
367 Ga0070658_10000007
368 Ga0070658_10072675
369 Ga0070658_10414332
370 Ga0070683_100054605
371 Ga0070683_100143994
372 Ga0070683_100365450
373 Ga0070683_100856716
374 Ga0070666_10035538
375 Ga0070666_10090632
376 Ga0070680_101052348
377 Ga0070682_100155655
378 Ga0070682_100157705
379 Ga0068868_100183223
380 Ga0068868_100409213
381 Ga0070660_100167487
382 Ga0070660_100638655
383 Ga0070661_100000713
384 Ga0070661_100017707
385 Ga0070668_100139859
386 Ga0070671_100002429
387 Ga0070671_100103798
388 Ga0070671_100290384
389 Ga0070659_100498939
390 Ga0070659_101719524
391 Ga0070667_100163641
392 Ga0070709_10476360
393 Ga0070713_100178063
394 Ga0070713_101302118
395 Ga0070663_100001552
396 Ga0070663_100137450
397 Ga0070663_100150845
398 Ga0070678_100823259
399 Ga0070679_100009317
400 Ga0070679_100263379
401 Ga0070684_100003452
402 Ga0070684_100081752
403 Ga0070684_100138967
404 Ga0070684_100153390
405 Ga0068853_100000050
406 Ga0068853_100255570
407 Ga0068853_100309422
408 Ga0068853_100565183
409 Ga0068853_101203399
410 Ga0070693_100226766
411 Ga0070665_100004409
412 Ga0070665_100013202
413 Ga0070665_100101363
414 Ga0070665_101901187
415 Ga0068855_100001092
416 Ga0068855_100010471
417 Ga0068855_100038086
418 Ga0068855_100320718
419 Ga0068855_101255921
420 Ga0070664_101415495
421 Ga0068857_100018621
422 Ga0068857_100788031
423 Ga0068854_100016926
424 Ga0068856_100002119
425 Ga0068856_100006755
426 Ga0068856_100007379
427 Ga0068856_100194144
428 Ga0068856_100197043
429 Ga0068856_100358723
430 Ga0068856_100811358
431 Ga0068852_100000070
432 Ga0068852_100008264
433 Ga0068852_100451004
434 Ga0068852_100471958
435 Ga0068852_100744357
436 Ga0068859_100373151
437 Ga0068851_10011554
438 Ga0068851_10061099
439 Ga0068851_10092291
440 Ga0068851_10131823
441 Ga0068863_100090524
442 Ga0068858_100897391
443 Ga0070717_10628209
444 Ga0097621_100498654
445 Ga0097621_100767817
446 Ga0068871_100052476
447 Ga0097620_100373158
448 Ga0105240_10000828
449 Ga0105240_10001319
450 Ga0105240_10035083
451 Ga0105240_10041995
452 Ga0105240_10110157
453 Ga0105240_10148859
454 Ga0105240_10293603
455 Ga0105240_10370310
456 Ga0105240_10517306
457 Ga0105240_10593733
458 Ga0105240_10783571
459 Ga0105240_11311273
460 Ga0105245_10005864
461 Ga0105245_10032841
462 Ga0105247_10556183
463 Ga0105243_10556378
464 Ga0105241_10000064
465 Ga0105241_10007952
466 Ga0105241_10012410
467 Ga0105241_10024249
468 Ga0105242_10465450
469 Ga0105248_10008161
470 Ga0105248_10011531
471 Ga0105237_10000242
472 Ga0105237_10038533
473 Ga0105237_10088868
474 Ga0105237_10336617
475 Ga0105238_10000080
476 Ga0105238_10003244
477 Ga0105238_10008255
478 Ga0105238_10012324
479 Ga0105238_10016150
480 Ga0105238_10059533
481 Ga0105238_10108507
482 Ga0105239_10000571
483 Ga0105239_10003058
484 Ga0105239_10204782
485 Ga0105239_10604892
486 Ga0105239_10637920
487 Ga0105239_10679022
488 Ga0105239_12592312
489 Ga0157373_10132146
490 Ga0157371_10315387
491 Ga0157371_10595018
492 Ga0157370_10003018
493 Ga0157370_10271473
494 Ga0157370_11317083
495 Ga0157369_10000212
496 Ga0157369_10002792
497 Ga0157369_10005306
498 Ga0157369_10007428
499 Ga0157369_10010733
500 Ga0157374_10004485
501 Ga0157374_10007127
502 Ga0157374_10008188
503 Ga0157374_10020184
504 Ga0157374_11232635
505 Ga0157378_10006109
506 Ga0157378_10028379
507 Ga0157378_11225107
508 Ga0163162_10163184
509 Ga0157372_10001434
510 Ga0157372_10002974
511 Ga0157372_10019036
512 Ga0157372_10020304
513 Ga0157372_10021169
514 Ga0157372_10479417
515 Ga0157372_11981135
516 Ga0157375_10119268
517 Ga0157375_11651217
518 Ga0157375_12670008
519 Ga0163163_10120531
520 Ga0157379_10412593
521 Ga0157376_10008439
522 Ga0157376_10032231
523 Ga0157376_10061386
524 Ga0163161_11360447
525 Ga0207656_10020922
526 Ga0207656_10054150
527 Ga0207656_10217770
528 Ga0207680_10049417
529 Ga0207680_10173822
530 Ga0207647_10003211
531 Ga0207647_10095669
532 Ga0207705_10000013
533 Ga0207705_10058022
534 Ga0207705_10124821
535 Ga0207654_10000357
536 Ga0207654_10009328
537 Ga0207654_10040224
538 Ga0207654_10090044
539 Ga0207695_10000063
540 Ga0207695_10000144
541 Ga0207695_10011673
542 Ga0207695_10043516
543 Ga0207695_10092046
544 Ga0207695_10162375
545 Ga0207671_10001117
546 Ga0207671_10395635
547 Ga0207671_10411887
548 Ga0207671_11010151
549 Ga0207660_10063325
550 Ga0207649_10003299
551 Ga0207652_10018119
552 Ga0207694_10000028
553 Ga0207694_10000673
554 Ga0207694_10144094
555 Ga0207694_10160702
556 Ga0207687_10022555
557 Ga0207700_10132556
558 Ga0207700_10468068
559 Ga0207700_11060234
560 Ga0207644_10008792
561 Ga0207644_10068791
562 Ga0207709_10323487
563 Ga0207711_10025580
564 Ga0207711_10432352
565 Ga0207661_10039481
566 Ga0207661_10045826
567 Ga0207661_10053479
568 Ga0207661_10115031
569 Ga0207667_10000712
570 Ga0207667_10020711
571 Ga0207667_10021216
572 Ga0207667_10031308
573 Ga0207667_10755913
574 Ga0207668_10322530
575 Ga0207658_10164104
576 Ga0207677_10365024
577 Ga0207677_10462061
578 Ga0207703_10950168
579 Ga0207639_10000291
580 Ga0207639_10027344
581 Ga0207639_10166952
582 Ga0207639_10181998
583 Ga0207678_10000102
584 Ga0207678_10517497
585 Ga0207702_10001563
586 Ga0207702_10159032
587 Ga0207702_10404835
588 Ga0207641_10105918
589 Ga0207676_10533161
590 Ga0207674_10003255
591 Ga0207674_10201245
592 Ga0207674_10767492
593 Ga0207698_10000047
594 Ga0207698_10006609
595 Ga0207698_10192235
596 Ga0207698_10408255
597 Ga0207698_10632385
598 Ga0268266_10032405
599 Ga0268266_10033348
600 Ga0268266_10066358
601 Ga0268266_10066536
602 Ga0268266_10653801
603 Ga0268266_11189894
604 Ga0265318_10012119
605 Ga0265336_10005665
606 Ga0265338_10003648
607 Ga0265338_10003948
608 Ga0265338_10009837
609 Ga0265338_10323948
610 Ga0265762_1027590
611 Ga0265770_1021146
612 Ga0265330_10000235
613 Ga0265330_10013889
614 Ga0265330_10034519
615 Ga0265330_10337496
616 Ga0265332_10061094
617 Ga0265328_10005363
618 Ga0265328_10023576
619 Ga0265328_10107374
620 Ga0265320_10110070
621 Ga0265320_10111991
622 Ga0265325_10000341
623 Ga0265325_10001538
624 Ga0265325_10019213
625 Ga0265325_10022814
626 Ga0265325_10041954
627 Ga0265325_10044834
628 Ga0265325_10047770
629 Ga0265329_10012083
630 Ga0265340_10006098
631 Ga0265340_10012479
632 Ga0265340_10040768
633 Ga0265340_10244471
634 Ga0265340_10291567
635 Ga0265339_10000040
636 Ga0265339_10001213
637 Ga0265339_10002181
638 Ga0265339_10002344
639 Ga0265339_10153766
640 Ga0265339_10182026
641 Ga0265316_10000912
642 Ga0265316_10016339
643 Ga0265316_10021227
644 Ga0265316_10088518
645 Ga0265316_10131080
646 Ga0265316_10194296
647 Ga0265316_10864260
648 Ga0265313_10001791
649 Ga0265313_10002848
650 Ga0265313_10160330
651 Ga0265314_10000081
652 Ga0265314_10022144
653 Ga0265314_10224608
654 Ga0265342_10001522
655 Ga0265342_10004607
656 Ga0265342_10005508
657 Ga0265342_10093345
658 Ga0265342_10134482
659 Ga0265342_10191469
660 Ga0265342_10240160
661 Ga0265342_10289231
662 Ga0265342_10519315
663 Ga0307510_10113600
664 Ga0373955_0310909
665 Ga0373933_0089457
666 Ga0373933_0429150
667 Ga0373933_0613414
668 Ga0373937_0003128
669 Ga0439448_0120913
670 Ga0466969_0221361
671 Ga0466961_0013229
672 Ga0495603_0041283
673 Ga0495629_0089612
674 Ga0495629_0115664
675 Ga0495629_0121073
676 Ga0495629_0123200
677 Ga0495651_0251819
678 Ga0495650_0000010
679 Ga0495580_0167026
680 Ga0495582_0076556
681 Ga0495582_0573947
682 Ga0495594_0000565
683 Ga0495594_0007994
684 Ga0495596_0028106
685 Ga0495583_0074267
686 Ga0495583_0097687
687 Ga0495606_0033938
688 Ga0495606_0229236
689 Ga0495643_0057098
690 Ga0495644_0000186
691 Ga0495652_0236683
692 Ga0495665_0066887
693 Ga0495665_0271883
694 Ga0495665_0428995
695 Ga0495645_0269012
696 Ga0495611_0227641
697 Ga0495669_0011792
698 Ga0495613_0008056
699 Ga0495670_0158586
700 Ga0495604_0286849
701 Ga0495683_0187951
702 Ga0495687_057935
703 Ga0495677_0067443
704 Ga0495673_0106228
705 Ga0495684_0415864
706 Ga0495684_0457149
707 Ga0495686_0010928
708 Ga0495602_0293266
709 Ga0495602_0746909
710 Ga0496100_0147973
711 Ga0496104_0116641
712 Ga0496105_0149531
713 Ga0496106_0752981
714 Ga0496107_0131413
715 Ga0496112_1074448
716 Ga0496115_0081856
717 Ga0496115_0317919
718 Ga0496126_0017020
719 Ga0496126_0592052
720 Ga0495601_0062814
721 Ga0495619_0475155
722 Ga0500643_025611

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

7

35

0.95

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

142

187

0.93

Map