F422134
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 361 | 169 | 361 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300005459|Ga0068867_100361841|Ga0068867_1003618412 |
| Length | 224 |
| Sequence | MNNSSKLQLSAEEMELVSNTEWILTKHGIIKKVYEMFGEINDMMRSEVMGSNHLFHENLKFRQGGKISKGENYQMLPYVILDYPSFFEKDNIFTIRTMFWWGNFFSVTLHLSGDHKTKFINNAPSLFSSLKKNNFFICINEEEWQHHFKEGNYALASAITNEEYTQLIKQDFFKVAKKLPLIRWENAYDFIMESFREILELLQINFQGDKKDLLPGSPIIGSDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 125 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 128 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 129 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 130 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 133 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 134 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 135 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 136 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 146 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 147 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 148 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 149 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 150 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 154 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 155 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 156 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 157 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 158 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 159 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 160 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 161 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 162 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 163 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 164 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 165 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 166 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 167 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.11 |
| Rhizosphere | 98.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10176682 | 3300005290 | Bacteria | 1208 |
| 2 | Ga0070658_10010368 | 3300005327 | Bacteria | 7475 |
| 3 | Ga0070658_10271905 | 3300005327 | Bacteria | 1441 |
| 4 | Ga0070658_10329567 | 3300005327 | Bacteria | 1304 |
| 5 | Ga0070676_10098844 | 3300005328 | Unclassified | 1800 |
| 6 | Ga0070676_10392458 | 3300005328 | Bacteria | 964 |
| 7 | Ga0070683_100000468 | 3300005329 | Bacteria | 28362 |
| 8 | Ga0070683_100373354 | 3300005329 | Bacteria | 1359 |
| 9 | Ga0070690_100033160 | 3300005330 | Bacteria | 3230 |
| 10 | Ga0070690_100249207 | 3300005330 | Bacteria | 1255 |
| 11 | Ga0070670_100036127 | 3300005331 | Bacteria | 4252 |
| 12 | Ga0070670_100667417 | 3300005331 | Bacteria | 933 |
| 13 | Ga0068869_100017295 | 3300005334 | Bacteria | 4884 |
| 14 | Ga0068869_100056733 | 3300005334 | Bacteria | 2857 |
| 15 | Ga0068869_100063232 | 3300005334 | Bacteria | 2718 |
| 16 | Ga0068869_100076813 | 3300005334 | Bacteria | 2483 |
| 17 | Ga0068869_100202886 | 3300005334 | Bacteria | 1564 |
| 18 | Ga0068869_100516891 | 3300005334 | Bacteria | 999 |
| 19 | Ga0070666_10004991 | 3300005335 | Bacteria | 8117 |
| 20 | Ga0070680_100015403 | 3300005336 | Bacteria | 5994 |
| 21 | Ga0070682_100112306 | 3300005337 | Bacteria | 1818 |
| 22 | Ga0068868_100078150 | 3300005338 | Bacteria | 2648 |
| 23 | Ga0070660_100002766 | 3300005339 | Bacteria | 12053 |
| 24 | Ga0070660_100022308 | 3300005339 | Bacteria | 4679 |
| 25 | Ga0070689_100008276 | 3300005340 | Bacteria | 7318 |
| 26 | Ga0070689_100050112 | 3300005340 | Bacteria | 3225 |
| 27 | Ga0070689_100319247 | 3300005340 | Bacteria | 1297 |
| 28 | Ga0070687_100554803 | 3300005343 | Bacteria | 782 |
| 29 | Ga0070661_100000179 | 3300005344 | Bacteria | 52306 |
| 30 | Ga0070661_100034574 | 3300005344 | Bacteria | 3665 |
| 31 | Ga0070661_100041203 | 3300005344 | Bacteria | 3370 |
| 32 | Ga0070661_100662587 | 3300005344 | Bacteria | 848 |
| 33 | Ga0070668_100043263 | 3300005347 | Bacteria | 3454 |
| 34 | Ga0070668_100159046 | 3300005347 | Bacteria | 1832 |
| 35 | Ga0070669_100031325 | 3300005353 | Bacteria | 3842 |
| 36 | Ga0070669_100046644 | 3300005353 | Bacteria | 3160 |
| 37 | Ga0070669_100080917 | 3300005353 | Bacteria | 2419 |
| 38 | Ga0070669_100709288 | 3300005353 | Bacteria | 850 |
| 39 | Ga0070675_100020576 | 3300005354 | Bacteria | 5264 |
| 40 | Ga0070675_100174024 | 3300005354 | Bacteria | 1858 |
| 41 | Ga0070671_100008104 | 3300005355 | Bacteria | 8414 |
| 42 | Ga0070671_100015772 | 3300005355 | Bacteria | 6105 |
| 43 | Ga0070671_101024903 | 3300005355 | Bacteria | 724 |
| 44 | Ga0070688_100703388 | 3300005365 | Bacteria | 783 |
| 45 | Ga0070659_100025861 | 3300005366 | Bacteria | 4515 |
| 46 | Ga0070667_100077748 | 3300005367 | Bacteria | 2834 |
| 47 | Ga0070678_100004697 | 3300005456 | Bacteria | 7775 |
| 48 | Ga0070678_100018048 | 3300005456 | Bacteria | 4563 |
| 49 | Ga0070678_100627109 | 3300005456 | Bacteria | 962 |
| 50 | Ga0070662_100005910 | 3300005457 | Bacteria | 7851 |
| 51 | Ga0070662_100049525 | 3300005457 | Bacteria | 3029 |
| 52 | Ga0070681_10085457 | 3300005458 | Bacteria | 3107 |
| 53 | Ga0070681_10613839 | 3300005458 | Bacteria | 1002 |
| 54 | Ga0068867_100040030 | 3300005459 | Bacteria | 3419 |
| 55 | Ga0068867_100361841 | 3300005459 | Bacteria | 1214 |
| 56 | Ga0068867_100379898 | 3300005459 | Bacteria | 1186 |
| 57 | Ga0068867_100464861 | 3300005459 | Bacteria | 1081 |
| 58 | Ga0070685_10007192 | 3300005466 | Bacteria | 5688 |
| 59 | Ga0070685_10169882 | 3300005466 | Bacteria | 1397 |
| 60 | Ga0070679_100001442 | 3300005530 | Bacteria | 21032 |
| 61 | Ga0070679_100115058 | 3300005530 | Bacteria | 2675 |
| 62 | Ga0070679_101051514 | 3300005530 | Bacteria | 758 |
| 63 | Ga0070684_100000484 | 3300005535 | Bacteria | 27334 |
| 64 | Ga0070684_100022853 | 3300005535 | Bacteria | 5220 |
| 65 | Ga0068853_100015211 | 3300005539 | Bacteria | 6324 |
| 66 | Ga0068853_100022828 | 3300005539 | Bacteria | 5230 |
| 67 | Ga0068853_100285236 | 3300005539 | Bacteria | 1523 |
| 68 | Ga0070695_100811801 | 3300005545 | Bacteria | 750 |
| 69 | Ga0070693_100211657 | 3300005547 | Bacteria | 1265 |
| 70 | Ga0070665_100079455 | 3300005548 | Bacteria | 3286 |
| 71 | Ga0068855_100052840 | 3300005563 | Bacteria | 4782 |
| 72 | Ga0068855_100555181 | 3300005563 | Bacteria | 1243 |
| 73 | Ga0068855_101090679 | 3300005563 | Bacteria | 835 |
| 74 | Ga0070664_100000140 | 3300005564 | Bacteria | 49126 |
| 75 | Ga0070664_100054130 | 3300005564 | Unclassified | 3404 |
| 76 | Ga0070664_100258862 | 3300005564 | Bacteria | 1565 |
| 77 | Ga0070664_100262348 | 3300005564 | Bacteria | 1554 |
| 78 | Ga0070664_100766894 | 3300005564 | Bacteria | 901 |
| 79 | Ga0068857_100007728 | 3300005577 | Bacteria | 9263 |
| 80 | Ga0068854_100011485 | 3300005578 | Bacteria | 5769 |
| 81 | Ga0070702_100656985 | 3300005615 | Bacteria | 794 |
| 82 | Ga0068852_100010785 | 3300005616 | Bacteria | 6845 |
| 83 | Ga0068852_100127957 | 3300005616 | Bacteria | 2335 |
| 84 | Ga0068852_100379175 | 3300005616 | Bacteria | 1387 |
| 85 | Ga0068852_101385310 | 3300005616 | Bacteria | 725 |
| 86 | Ga0068859_100005939 | 3300005617 | Bacteria | 12395 |
| 87 | Ga0068859_100007298 | 3300005617 | Bacteria | 11213 |
| 88 | Ga0068859_100100050 | 3300005617 | Bacteria | 2955 |
| 89 | Ga0068859_100105935 | 3300005617 | Bacteria | 2871 |
| 90 | Ga0068859_100201899 | 3300005617 | Bacteria | 2073 |
| 91 | Ga0068859_100359325 | 3300005617 | Unclassified | 1551 |
| 92 | Ga0068859_100525270 | 3300005617 | Bacteria | 1278 |
| 93 | Ga0068859_100719847 | 3300005617 | Bacteria | 1088 |
| 94 | Ga0068859_100890498 | 3300005617 | Unclassified | 975 |
| 95 | Ga0068864_100019755 | 3300005618 | Bacteria | 5634 |
| 96 | Ga0068864_100034237 | 3300005618 | Bacteria | 4320 |
| 97 | Ga0068864_100061031 | 3300005618 | Unclassified | 3265 |
| 98 | Ga0068864_100232845 | 3300005618 | Unclassified | 1704 |
| 99 | Ga0068866_10008725 | 3300005718 | Bacteria | 4285 |
| 100 | Ga0068866_10017766 | 3300005718 | Bacteria | 3204 |
| 101 | Ga0068866_10261797 | 3300005718 | Bacteria | 1063 |
| 102 | Ga0068861_100143217 | 3300005719 | Bacteria | 1953 |
| 103 | Ga0068861_100585690 | 3300005719 | Bacteria | 1022 |
| 104 | Ga0068870_10093933 | 3300005840 | Bacteria | 1683 |
| 105 | Ga0068863_100097940 | 3300005841 | Bacteria | 2785 |
| 106 | Ga0068863_100111325 | 3300005841 | Bacteria | 2608 |
| 107 | Ga0068863_100251431 | 3300005841 | Bacteria | 1707 |
| 108 | Ga0068863_100262047 | 3300005841 | Bacteria | 1671 |
| 109 | Ga0068863_100304587 | 3300005841 | Bacteria | 1546 |
| 110 | Ga0068863_100341681 | 3300005841 | Bacteria | 1456 |
| 111 | Ga0068858_100131947 | 3300005842 | Unclassified | 2343 |
| 112 | Ga0068858_100576703 | 3300005842 | Bacteria | 1090 |
| 113 | Ga0068858_100976986 | 3300005842 | Unclassified | 829 |
| 114 | Ga0068860_100007061 | 3300005843 | Bacteria | 11243 |
| 115 | Ga0068860_100096965 | 3300005843 | Unclassified | 2811 |
| 116 | Ga0068860_100222848 | 3300005843 | Bacteria | 1831 |
| 117 | Ga0068860_101132810 | 3300005843 | Unclassified | 802 |
| 118 | Ga0068862_100216440 | 3300005844 | Bacteria | 1733 |
| 119 | Ga0068862_100423013 | 3300005844 | Bacteria | 1250 |
| 120 | Ga0068862_100533328 | 3300005844 | Bacteria | 1119 |
| 121 | Ga0081539_10120820 | 3300005985 | Bacteria | 1301 |
| 122 | Ga0070715_10041252 | 3300006163 | Unclassified | 1933 |
| 123 | Ga0070715_10194068 | 3300006163 | Bacteria | 1027 |
| 124 | Ga0097621_100000118 | 3300006237 | Bacteria | 45384 |
| 125 | Ga0097621_100011491 | 3300006237 | Bacteria | 6523 |
| 126 | Ga0097621_100152109 | 3300006237 | Bacteria | 1985 |
| 127 | Ga0097621_100528948 | 3300006237 | Unclassified | 1071 |
| 128 | Ga0068871_100011269 | 3300006358 | Bacteria | 6555 |
| 129 | Ga0068871_100019364 | 3300006358 | Bacteria | 5196 |
| 130 | Ga0075434_100085548 | 3300006871 | Bacteria | 3153 |
| 131 | Ga0075434_100439577 | 3300006871 | Bacteria | 1326 |
| 132 | Ga0068865_100189750 | 3300006881 | Bacteria | 1588 |
| 133 | Ga0068865_100440266 | 3300006881 | Bacteria | 1075 |
| 134 | Ga0097620_100005939 | 3300006931 | Bacteria | 12395 |
| 135 | Ga0097620_100007298 | 3300006931 | Bacteria | 11213 |
| 136 | Ga0097620_100100047 | 3300006931 | Bacteria | 2955 |
| 137 | Ga0097620_100105936 | 3300006931 | Bacteria | 2871 |
| 138 | Ga0097620_100201902 | 3300006931 | Bacteria | 2073 |
| 139 | Ga0097620_100359307 | 3300006931 | Unclassified | 1551 |
| 140 | Ga0097620_100525293 | 3300006931 | Bacteria | 1278 |
| 141 | Ga0097620_100719905 | 3300006931 | Bacteria | 1088 |
| 142 | Ga0097620_100890561 | 3300006931 | Unclassified | 975 |
| 143 | Ga0105251_10109895 | 3300009011 | Unclassified | 1256 |
| 144 | Ga0105240_10356633 | 3300009093 | Bacteria | 1658 |
| 145 | Ga0105240_10946081 | 3300009093 | Bacteria | 924 |
| 146 | Ga0105247_10008390 | 3300009101 | Bacteria | 6298 |
| 147 | Ga0105241_10474408 | 3300009174 | Bacteria | 1111 |
| 148 | Ga0105242_10186413 | 3300009176 | Bacteria | 1834 |
| 149 | Ga0105248_10014430 | 3300009177 | Bacteria | 8696 |
| 150 | Ga0105249_10009062 | 3300009553 | Bacteria | 8700 |
| 151 | Ga0105249_10038553 | 3300009553 | Bacteria | 4336 |
| 152 | Ga0105249_10078816 | 3300009553 | Bacteria | 3057 |
| 153 | Ga0105249_10245322 | 3300009553 | Bacteria | 1773 |
| 154 | Ga0105239_10247625 | 3300010375 | Bacteria | 2001 |
| 155 | Ga0157373_10011824 | 3300013100 | Bacteria | 6412 |
| 156 | Ga0157373_10053938 | 3300013100 | Bacteria | 2858 |
| 157 | Ga0157373_10054257 | 3300013100 | Bacteria | 2848 |
| 158 | Ga0157371_10006604 | 3300013102 | Bacteria | 9532 |
| 159 | Ga0157371_10066624 | 3300013102 | Bacteria | 2550 |
| 160 | Ga0157371_10140652 | 3300013102 | Bacteria | 1719 |
| 161 | Ga0157370_10557505 | 3300013104 | Bacteria | 1050 |
| 162 | Ga0157370_10624551 | 3300013104 | Bacteria | 986 |
| 163 | Ga0157369_10038641 | 3300013105 | Bacteria | 5218 |
| 164 | Ga0157374_10000237 | 3300013296 | Bacteria | 51331 |
| 165 | Ga0157374_10006341 | 3300013296 | Bacteria | 10032 |
| 166 | Ga0157374_10098966 | 3300013296 | Bacteria | 2793 |
| 167 | Ga0157378_10005153 | 3300013297 | Bacteria | 11475 |
| 168 | Ga0157378_10162612 | 3300013297 | Bacteria | 2089 |
| 169 | Ga0157378_10692674 | 3300013297 | Bacteria | 1038 |
| 170 | Ga0163162_10000086 | 3300013306 | Bacteria | 85949 |
| 171 | Ga0163162_10006217 | 3300013306 | Bacteria | 11572 |
| 172 | Ga0163162_10076764 | 3300013306 | Bacteria | 3403 |
| 173 | Ga0163162_10264187 | 3300013306 | Bacteria | 1853 |
| 174 | Ga0157372_10006279 | 3300013307 | Bacteria | 12639 |
| 175 | Ga0157372_10055089 | 3300013307 | Bacteria | 4439 |
| 176 | Ga0157372_10072477 | 3300013307 | Bacteria | 3882 |
| 177 | Ga0157372_11764210 | 3300013307 | Unclassified | 712 |
| 178 | Ga0157375_10000115 | 3300013308 | Bacteria | 77964 |
| 179 | Ga0157375_10079604 | 3300013308 | Bacteria | 3313 |
| 180 | Ga0157375_10603737 | 3300013308 | Bacteria | 1256 |
| 181 | Ga0157375_10634183 | 3300013308 | Bacteria | 1226 |
| 182 | Ga0157375_11142551 | 3300013308 | Bacteria | 912 |
| 183 | Ga0163163_10000088 | 3300014325 | Bacteria | 101126 |
| 184 | Ga0163163_10000244 | 3300014325 | Bacteria | 55634 |
| 185 | Ga0163163_10056245 | 3300014325 | Bacteria | 3888 |
| 186 | Ga0157380_10131722 | 3300014326 | Bacteria | 2134 |
| 187 | Ga0157377_10009383 | 3300014745 | Bacteria | 4799 |
| 188 | Ga0157377_10089787 | 3300014745 | Bacteria | 1812 |
| 189 | Ga0157377_10174719 | 3300014745 | Bacteria | 1346 |
| 190 | Ga0157379_10050431 | 3300014968 | Bacteria | 3715 |
| 191 | Ga0157376_10001060 | 3300014969 | Bacteria | 18012 |
| 192 | Ga0157376_10073355 | 3300014969 | Bacteria | 2914 |
| 193 | Ga0157376_10317978 | 3300014969 | Bacteria | 1479 |
| 194 | Ga0157376_10526578 | 3300014969 | Bacteria | 1166 |
| 195 | Ga0157376_10604161 | 3300014969 | Bacteria | 1092 |
| 196 | Ga0163161_10002796 | 3300017792 | Bacteria | 12374 |
| 197 | Ga0163161_10006573 | 3300017792 | Bacteria | 8049 |
| 198 | Ga0163161_10027138 | 3300017792 | Bacteria | 4061 |
| 199 | Ga0207656_10083691 | 3300025321 | Bacteria | 1438 |
| 200 | Ga0207642_10028662 | 3300025899 | Bacteria | 2295 |
| 201 | Ga0207710_10010630 | 3300025900 | Bacteria | 3876 |
| 202 | Ga0207680_10009247 | 3300025903 | Bacteria | 4878 |
| 203 | Ga0207680_10500844 | 3300025903 | Bacteria | 865 |
| 204 | Ga0207647_10009722 | 3300025904 | Bacteria | 6823 |
| 205 | Ga0207685_10006223 | 3300025905 | Bacteria | 3231 |
| 206 | Ga0207645_10007658 | 3300025907 | Bacteria | 7609 |
| 207 | Ga0207705_10074064 | 3300025909 | Bacteria | 2471 |
| 208 | Ga0207705_10114463 | 3300025909 | Bacteria | 1995 |
| 209 | Ga0207705_10128238 | 3300025909 | Bacteria | 1886 |
| 210 | Ga0207707_10242770 | 3300025912 | Bacteria | 1566 |
| 211 | Ga0207660_10052319 | 3300025917 | Bacteria | 2907 |
| 212 | Ga0207660_10177239 | 3300025917 | Bacteria | 1653 |
| 213 | Ga0207657_10016994 | 3300025919 | Bacteria | 6998 |
| 214 | Ga0207657_10040875 | 3300025919 | Bacteria | 4105 |
| 215 | Ga0207657_10106769 | 3300025919 | Bacteria | 2316 |
| 216 | Ga0207649_10000419 | 3300025920 | Bacteria | 31284 |
| 217 | Ga0207649_10042112 | 3300025920 | Bacteria | 2784 |
| 218 | Ga0207652_10008227 | 3300025921 | Bacteria | 8377 |
| 219 | Ga0207652_10018048 | 3300025921 | Bacteria | 5784 |
| 220 | Ga0207652_10100676 | 3300025921 | Bacteria | 2551 |
| 221 | Ga0207681_10184535 | 3300025923 | Bacteria | 1591 |
| 222 | Ga0207681_10231658 | 3300025923 | Bacteria | 1434 |
| 223 | Ga0207650_10020700 | 3300025925 | Bacteria | 4642 |
| 224 | Ga0207650_10426799 | 3300025925 | Bacteria | 1101 |
| 225 | Ga0207659_10113269 | 3300025926 | Bacteria | 2066 |
| 226 | Ga0207644_10013035 | 3300025931 | Bacteria | 5533 |
| 227 | Ga0207644_10327169 | 3300025931 | Bacteria | 1240 |
| 228 | Ga0207690_10019939 | 3300025932 | Bacteria | 4135 |
| 229 | Ga0207690_10026064 | 3300025932 | Bacteria | 3680 |
| 230 | Ga0207706_10002103 | 3300025933 | Bacteria | 19496 |
| 231 | Ga0207706_10018001 | 3300025933 | Bacteria | 6357 |
| 232 | Ga0207706_10084464 | 3300025933 | Bacteria | 2791 |
| 233 | Ga0207706_10118453 | 3300025933 | Bacteria | 2328 |
| 234 | Ga0207670_10003257 | 3300025936 | Bacteria | 8605 |
| 235 | Ga0207670_10061124 | 3300025936 | Bacteria | 2569 |
| 236 | Ga0207704_10128813 | 3300025938 | Bacteria | 1748 |
| 237 | Ga0207704_10177265 | 3300025938 | Bacteria | 1536 |
| 238 | Ga0207704_10407915 | 3300025938 | Bacteria | 1074 |
| 239 | Ga0207691_10011435 | 3300025940 | Bacteria | 8516 |
| 240 | Ga0207711_10070479 | 3300025941 | Bacteria | 3032 |
| 241 | Ga0207689_10021058 | 3300025942 | Bacteria | 5481 |
| 242 | Ga0207689_10045204 | 3300025942 | Bacteria | 3642 |
| 243 | Ga0207689_10066263 | 3300025942 | Bacteria | 2970 |
| 244 | Ga0207689_10167225 | 3300025942 | Bacteria | 1812 |
| 245 | Ga0207661_10000370 | 3300025944 | Bacteria | 28914 |
| 246 | Ga0207661_10331612 | 3300025944 | Bacteria | 1369 |
| 247 | Ga0207661_10505198 | 3300025944 | Bacteria | 1105 |
| 248 | Ga0207679_10000266 | 3300025945 | Bacteria | 39927 |
| 249 | Ga0207679_10163117 | 3300025945 | Bacteria | 1827 |
| 250 | Ga0207679_10265879 | 3300025945 | Bacteria | 1465 |
| 251 | Ga0207679_10356536 | 3300025945 | Bacteria | 1276 |
| 252 | Ga0207679_10571150 | 3300025945 | Bacteria | 1016 |
| 253 | Ga0207667_10128873 | 3300025949 | Bacteria | 2606 |
| 254 | Ga0207667_10628074 | 3300025949 | Bacteria | 1081 |
| 255 | Ga0207651_10500552 | 3300025960 | Bacteria | 1050 |
| 256 | Ga0207651_10946960 | 3300025960 | Bacteria | 768 |
| 257 | Ga0207712_10043764 | 3300025961 | Bacteria | 3091 |
| 258 | Ga0207712_10052431 | 3300025961 | Unclassified | 2857 |
| 259 | Ga0207712_10057462 | 3300025961 | Bacteria | 2745 |
| 260 | Ga0207668_10011982 | 3300025972 | Bacteria | 5292 |
| 261 | Ga0207640_10016310 | 3300025981 | Unclassified | 4318 |
| 262 | Ga0207640_10021342 | 3300025981 | Bacteria | 3859 |
| 263 | Ga0207658_10154632 | 3300025986 | Unclassified | 1873 |
| 264 | Ga0207658_10241994 | 3300025986 | Bacteria | 1529 |
| 265 | Ga0207658_10407432 | 3300025986 | Bacteria | 1196 |
| 266 | Ga0207658_10452266 | 3300025986 | Bacteria | 1137 |
| 267 | Ga0207658_10478351 | 3300025986 | Bacteria | 1106 |
| 268 | Ga0207677_10080790 | 3300026023 | Bacteria | 2331 |
| 269 | Ga0207677_10285222 | 3300026023 | Unclassified | 1357 |
| 270 | Ga0207703_10311119 | 3300026035 | Bacteria | 1440 |
| 271 | Ga0207703_10405070 | 3300026035 | Bacteria | 1266 |
| 272 | Ga0207703_10568143 | 3300026035 | Bacteria | 1070 |
| 273 | Ga0207639_10012815 | 3300026041 | Bacteria | 5851 |
| 274 | Ga0207639_10037661 | 3300026041 | Bacteria | 3593 |
| 275 | Ga0207639_10082339 | 3300026041 | Bacteria | 2551 |
| 276 | Ga0207678_10090917 | 3300026067 | Bacteria | 2608 |
| 277 | Ga0207678_11130585 | 3300026067 | Bacteria | 693 |
| 278 | Ga0207641_10037835 | 3300026088 | Bacteria | 4032 |
| 279 | Ga0207641_10080565 | 3300026088 | Bacteria | 2825 |
| 280 | Ga0207641_10107035 | 3300026088 | Unclassified | 2473 |
| 281 | Ga0207641_10441283 | 3300026088 | Bacteria | 1256 |
| 282 | Ga0207641_10625585 | 3300026088 | Unclassified | 1056 |
| 283 | Ga0207648_10016945 | 3300026089 | Bacteria | 6639 |
| 284 | Ga0207648_10146511 | 3300026089 | Bacteria | 2083 |
| 285 | Ga0207648_10304460 | 3300026089 | Bacteria | 1430 |
| 286 | Ga0207648_10556120 | 3300026089 | Bacteria | 1054 |
| 287 | Ga0207648_10762807 | 3300026089 | Bacteria | 899 |
| 288 | Ga0207676_10011089 | 3300026095 | Bacteria | 6433 |
| 289 | Ga0207676_10019254 | 3300026095 | Bacteria | 4976 |
| 290 | Ga0207676_10038829 | 3300026095 | Bacteria | 3637 |
| 291 | Ga0207676_10053210 | 3300026095 | Bacteria | 3168 |
| 292 | Ga0207676_10192267 | 3300026095 | Bacteria | 1797 |
| 293 | Ga0207674_10007803 | 3300026116 | Bacteria | 12446 |
| 294 | Ga0207674_10023542 | 3300026116 | Bacteria | 6593 |
| 295 | Ga0207674_10321322 | 3300026116 | Bacteria | 1497 |
| 296 | Ga0207675_100044754 | 3300026118 | Bacteria | 4137 |
| 297 | Ga0207675_100161846 | 3300026118 | Bacteria | 2135 |
| 298 | Ga0207675_100237361 | 3300026118 | Unclassified | 1761 |
| 299 | Ga0207683_10010220 | 3300026121 | Bacteria | 8005 |
| 300 | Ga0207683_10031651 | 3300026121 | Bacteria | 4591 |
| 301 | Ga0207683_10311957 | 3300026121 | Bacteria | 1440 |
| 302 | Ga0207698_10048581 | 3300026142 | Bacteria | 3222 |
| 303 | Ga0207698_10070251 | 3300026142 | Bacteria | 2774 |
| 304 | Ga0207698_10267478 | 3300026142 | Bacteria | 1574 |
| 305 | Ga0207698_10760326 | 3300026142 | Bacteria | 969 |
| 306 | Ga0268265_10166897 | 3300028380 | Unclassified | 1877 |
| 307 | Ga0268265_10337878 | 3300028380 | Bacteria | 1370 |
| 308 | Ga0268264_10005924 | 3300028381 | Bacteria | 10348 |
| 309 | Ga0268264_10124135 | 3300028381 | Unclassified | 2279 |
| 310 | Ga0268264_10146150 | 3300028381 | Bacteria | 2114 |
| 311 | Ga0268264_10972371 | 3300028381 | Unclassified | 855 |
| 312 | Ga0307515_10000010 | 3300028794 | Bacteria | 651586 |
| 313 | Ga0265331_10075079 | 3300031250 | Bacteria | 1577 |
| 314 | Ga0265327_10000219 | 3300031251 | Bacteria | 116606 |
| 315 | Ga0265327_10063339 | 3300031251 | Bacteria | 1878 |
| 316 | Ga0373934_0082751 | 3300035086 | Bacteria | 1290 |
| 317 | Ga0373943_0075083 | 3300035170 | Bacteria | 1721 |
| 318 | Ga0373924_0006769 | 3300035410 | Bacteria | 4118 |
| 319 | Ga0373933_0012397 | 3300035724 | Bacteria | 4707 |
| 320 | Ga0373937_0002104 | 3300036401 | Bacteria | 16647 |
| 321 | Ga0451807_0884830 | 3300041486 | Bacteria | 1435 |
| 322 | Ga0451853_1577816 | 3300041512 | Bacteria | 1417 |
| 323 | Ga0451577_0292243 | 3300042876 | Bacteria | 1477 |
| 324 | Ga0453684_0586581 | 3300044712 | Bacteria | 1223 |
| 325 | Ga0495592_0026380 | 3300046454 | Bacteria | 4405 |
| 326 | Ga0495653_0043228 | 3300046463 | Bacteria | 3505 |
| 327 | Ga0495630_0003153 | 3300046517 | Bacteria | 11441 |
| 328 | Ga0495587_0062204 | 3300046536 | Bacteria | 2186 |
| 329 | Ga0495598_0103538 | 3300046537 | Bacteria | 945 |
| 330 | Ga0495634_0019397 | 3300046642 | Bacteria | 4833 |
| 331 | Ga0495635_0255719 | 3300046663 | Bacteria | 1180 |
| 332 | Ga0495646_0188611 | 3300046680 | Bacteria | 1128 |
| 333 | Ga0495613_0118295 | 3300046689 | Bacteria | 1905 |
| 334 | Ga0496104_0686662 | 3300048907 | Unclassified | 932 |
| 335 | Ga0496111_0089780 | 3300048914 | Bacteria | 2251 |
| 336 | Ga0496111_0686191 | 3300048914 | Unclassified | 746 |
| 337 | Ga0501291_050191 | 3300049514 | Bacteria | 758 |
| 338 | Ga0501298_011148 | 3300049521 | Bacteria | 1557 |
| 339 | Ga0501299_006290 | 3300049522 | Bacteria | 1859 |
| 340 | Ga0501032_0400257 | 3300049569 | Bacteria | 882 |
| 341 | Ga0501033_0080020 | 3300049570 | Bacteria | 2398 |
| 342 | Ga0501034_0111061 | 3300049571 | Bacteria | 2732 |
| 343 | Ga0501034_1081674 | 3300049571 | Bacteria | 683 |
| 344 | Ga0501201_001663 | 3300049651 | Bacteria | 2068 |
| 345 | Ga0501202_002207 | 3300049652 | Bacteria | 3248 |
| 346 | Ga0501206_008166 | 3300049653 | Bacteria | 1382 |
| 347 | Ga0501207_014739 | 3300049654 | Bacteria | 1196 |
| 348 | Ga0501217_000585 | 3300049661 | Bacteria | 6139 |
| 349 | Ga0501235_011635 | 3300049669 | Bacteria | 1930 |
| 350 | Ga0501243_000796 | 3300049675 | Bacteria | 4379 |
| 351 | Ga0501252_010264 | 3300049682 | Bacteria | 1104 |
| 352 | Ga0501256_019437 | 3300049685 | Bacteria | 704 |
| 353 | Ga0501261_002428 | 3300049690 | Bacteria | 2286 |
| 354 | Ga0501221_000606 | 3300049704 | Bacteria | 5723 |
| 355 | Ga0501225_0000561 | 3300049705 | Bacteria | 11624 |
| 356 | Ga0501234_003922 | 3300049707 | Bacteria | 2336 |
| 357 | Ga0501245_000123 | 3300049708 | Bacteria | 7876 |
| 358 | Ga0501035_0080039 | 3300049822 | Bacteria | 2885 |
| 359 | Ga0501035_0261549 | 3300049822 | Unclassified | 1467 |
| 360 | Ga0501044_0312142 | 3300049823 | Unclassified | 1499 |
| 361 | nmdc:mga0n895_317322_c1 | 3300050512 | Bacteria | 1579 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_1081674 | Ga0501034_1081674_47_577 | 152 |
| 2 | 3300049822 | Ga0501035_0261549 | Ga0501035_0261549_29_658 | 168 |
| 3 | 3300026067 | Ga0207678_11130585 | Ga0207678_111305851 | 169 |
| 4 | 3300049514 | Ga0501291_050191 | Ga0501291_050191_187_702 | 170 |
| 5 | 3300049685 | Ga0501256_019437 | Ga0501256_019437_79_594 | 170 |
| 6 | 3300005355 | Ga0070671_100008104 | Ga0070671_1000081042 | 174 |
| 7 | 3300005456 | Ga0070678_100018048 | Ga0070678_1000180482 | 174 |
| 8 | 3300005718 | Ga0068866_10261797 | Ga0068866_102617972 | 174 |
| 9 | 3300006237 | Ga0097621_100000118 | Ga0097621_1000001189 | 174 |
| 10 | 3300017792 | Ga0163161_10006573 | Ga0163161_100065738 | 174 |
| 11 | 3300025931 | Ga0207644_10013035 | Ga0207644_100130352 | 174 |
| 12 | 3300049570 | Ga0501033_0080020 | Ga0501033_0080020_1791_2387 | 174 |
| 13 | 3300026121 | Ga0207683_10311957 | Ga0207683_103119572 | 175 |
| 14 | 3300028380 | Ga0268265_10166897 | Ga0268265_101668971 | 180 |
| 15 | 3300009093 | Ga0105240_10946081 | Ga0105240_109460812 | 181 |
| 16 | 3300049569 | Ga0501032_0400257 | Ga0501032_0400257_173_808 | 187 |
| 17 | 3300049822 | Ga0501035_0080039 | Ga0501035_0080039_1705_2340 | 187 |
| 18 | 3300005334 | Ga0068869_100076813 | Ga0068869_1000768132 | 190 |
| 19 | 3300005354 | Ga0070675_100020576 | Ga0070675_1000205762 | 190 |
| 20 | 3300005367 | Ga0070667_100077748 | Ga0070667_1000777482 | 190 |
| 21 | 3300005617 | Ga0068859_100007298 | Ga0068859_1000072988 | 190 |
| 22 | 3300005618 | Ga0068864_100019755 | Ga0068864_1000197553 | 190 |
| 23 | 3300005844 | Ga0068862_100533328 | Ga0068862_1005333282 | 190 |
| 24 | 3300006931 | Ga0097620_100007298 | Ga0097620_1000072988 | 190 |
| 25 | 3300025942 | Ga0207689_10045204 | Ga0207689_100452043 | 190 |
| 26 | 3300025949 | Ga0207667_10628074 | Ga0207667_106280741 | 190 |
| 27 | 3300026095 | Ga0207676_10011089 | Ga0207676_100110893 | 190 |
| 28 | 3300026142 | Ga0207698_10760326 | Ga0207698_107603262 | 190 |
| 29 | 3300035170 | Ga0373943_0075083 | Ga0373943_0075083_361_933 | 190 |
| 30 | 3300031251 | Ga0265327_10063339 | Ga0265327_100633392 | 192 |
| 31 | 3300005842 | Ga0068858_100131947 | Ga0068858_1001319473 | 195 |
| 32 | 3300005339 | Ga0070660_100002766 | Ga0070660_1000027666 | 196 |
| 33 | 3300025919 | Ga0207657_10016994 | Ga0207657_100169949 | 196 |
| 34 | 3300013306 | Ga0163162_10076764 | Ga0163162_100767644 | 197 |
| 35 | 3300025321 | Ga0207656_10083691 | Ga0207656_100836912 | 199 |
| 36 | 3300049521 | Ga0501298_011148 | Ga0501298_011148_364_966 | 199 |
| 37 | 3300049522 | Ga0501299_006290 | Ga0501299_006290_178_780 | 199 |
| 38 | 3300049651 | Ga0501201_001663 | Ga0501201_001663_1453_2055 | 199 |
| 39 | 3300049652 | Ga0501202_002207 | Ga0501202_002207_1172_1774 | 199 |
| 40 | 3300049653 | Ga0501206_008166 | Ga0501206_008166_241_843 | 199 |
| 41 | 3300049654 | Ga0501207_014739 | Ga0501207_014739_532_1134 | 199 |
| 42 | 3300049661 | Ga0501217_000585 | Ga0501217_000585_1289_1891 | 199 |
| 43 | 3300049669 | Ga0501235_011635 | Ga0501235_011635_758_1360 | 199 |
| 44 | 3300049675 | Ga0501243_000796 | Ga0501243_000796_1453_2055 | 199 |
| 45 | 3300049682 | Ga0501252_010264 | Ga0501252_010264_52_654 | 199 |
| 46 | 3300049690 | Ga0501261_002428 | Ga0501261_002428_1477_2079 | 199 |
| 47 | 3300049704 | Ga0501221_000606 | Ga0501221_000606_3848_4450 | 199 |
| 48 | 3300049705 | Ga0501225_0000561 | Ga0501225_0000561_6382_6984 | 199 |
| 49 | 3300049707 | Ga0501234_003922 | Ga0501234_003922_396_998 | 199 |
| 50 | 3300049708 | Ga0501245_000123 | Ga0501245_000123_1345_1947 | 199 |
| 51 | 3300005331 | Ga0070670_100667417 | Ga0070670_1006674171 | 200 |
| 52 | 3300005334 | Ga0068869_100056733 | Ga0068869_1000567332 | 200 |
| 53 | 3300005353 | Ga0070669_100046644 | Ga0070669_1000466443 | 200 |
| 54 | 3300005459 | Ga0068867_100464861 | Ga0068867_1004648612 | 200 |
| 55 | 3300005617 | Ga0068859_100105935 | Ga0068859_1001059353 | 200 |
| 56 | 3300005618 | Ga0068864_100034237 | Ga0068864_1000342372 | 200 |
| 57 | 3300006931 | Ga0097620_100105936 | Ga0097620_1001059363 | 200 |
| 58 | 3300013307 | Ga0157372_10055089 | Ga0157372_100550893 | 200 |
| 59 | 3300025925 | Ga0207650_10426799 | Ga0207650_104267992 | 200 |
| 60 | 3300025942 | Ga0207689_10066263 | Ga0207689_100662634 | 200 |
| 61 | 3300025960 | Ga0207651_10946960 | Ga0207651_109469602 | 200 |
| 62 | 3300025986 | Ga0207658_10241994 | Ga0207658_102419942 | 200 |
| 63 | 3300026089 | Ga0207648_10762807 | Ga0207648_107628071 | 200 |
| 64 | 3300026095 | Ga0207676_10053210 | Ga0207676_100532102 | 200 |
| 65 | 3300028381 | Ga0268264_10005924 | Ga0268264_100059245 | 200 |
| 66 | 3300049823 | Ga0501044_0312142 | Ga0501044_0312142_195_827 | 200 |
| 67 | 3300005327 | Ga0070658_10010368 | Ga0070658_100103683 | 201 |
| 68 | 3300005327 | Ga0070658_10271905 | Ga0070658_102719051 | 201 |
| 69 | 3300005327 | Ga0070658_10329567 | Ga0070658_103295671 | 201 |
| 70 | 3300005329 | Ga0070683_100373354 | Ga0070683_1003733542 | 201 |
| 71 | 3300005336 | Ga0070680_100015403 | Ga0070680_1000154034 | 201 |
| 72 | 3300005339 | Ga0070660_100022308 | Ga0070660_1000223082 | 201 |
| 73 | 3300005366 | Ga0070659_100025861 | Ga0070659_1000258613 | 201 |
| 74 | 3300005458 | Ga0070681_10085457 | Ga0070681_100854573 | 201 |
| 75 | 3300005530 | Ga0070679_100001442 | Ga0070679_10000144210 | 201 |
| 76 | 3300005530 | Ga0070679_100115058 | Ga0070679_1001150582 | 201 |
| 77 | 3300005530 | Ga0070679_101051514 | Ga0070679_1010515141 | 201 |
| 78 | 3300005539 | Ga0068853_100285236 | Ga0068853_1002852362 | 201 |
| 79 | 3300005563 | Ga0068855_100052840 | Ga0068855_1000528403 | 201 |
| 80 | 3300005563 | Ga0068855_100555181 | Ga0068855_1005551812 | 201 |
| 81 | 3300005563 | Ga0068855_101090679 | Ga0068855_1010906792 | 201 |
| 82 | 3300005616 | Ga0068852_100010785 | Ga0068852_1000107858 | 201 |
| 83 | 3300005616 | Ga0068852_101385310 | Ga0068852_1013853102 | 201 |
| 84 | 3300005617 | Ga0068859_100719847 | Ga0068859_1007198472 | 201 |
| 85 | 3300005843 | Ga0068860_100007061 | Ga0068860_1000070612 | 201 |
| 86 | 3300006163 | Ga0070715_10194068 | Ga0070715_101940682 | 201 |
| 87 | 3300006931 | Ga0097620_100719905 | Ga0097620_1007199052 | 201 |
| 88 | 3300013100 | Ga0157373_10011824 | Ga0157373_100118244 | 201 |
| 89 | 3300013100 | Ga0157373_10054257 | Ga0157373_100542572 | 201 |
| 90 | 3300013102 | Ga0157371_10006604 | Ga0157371_100066043 | 201 |
| 91 | 3300013102 | Ga0157371_10066624 | Ga0157371_100666242 | 201 |
| 92 | 3300013102 | Ga0157371_10140652 | Ga0157371_101406521 | 201 |
| 93 | 3300013104 | Ga0157370_10557505 | Ga0157370_105575052 | 201 |
| 94 | 3300013104 | Ga0157370_10624551 | Ga0157370_106245511 | 201 |
| 95 | 3300013105 | Ga0157369_10038641 | Ga0157369_100386415 | 201 |
| 96 | 3300013297 | Ga0157378_10692674 | Ga0157378_106926741 | 201 |
| 97 | 3300013307 | Ga0157372_10006279 | Ga0157372_100062793 | 201 |
| 98 | 3300025909 | Ga0207705_10074064 | Ga0207705_100740642 | 201 |
| 99 | 3300025909 | Ga0207705_10114463 | Ga0207705_101144631 | 201 |
| 100 | 3300025909 | Ga0207705_10128238 | Ga0207705_101282382 | 201 |
| 101 | 3300025917 | Ga0207660_10052319 | Ga0207660_100523193 | 201 |
| 102 | 3300025917 | Ga0207660_10177239 | Ga0207660_101772392 | 201 |
| 103 | 3300025919 | Ga0207657_10040875 | Ga0207657_100408753 | 201 |
| 104 | 3300025919 | Ga0207657_10106769 | Ga0207657_101067693 | 201 |
| 105 | 3300025921 | Ga0207652_10008227 | Ga0207652_100082273 | 201 |
| 106 | 3300025921 | Ga0207652_10018048 | Ga0207652_100180484 | 201 |
| 107 | 3300025921 | Ga0207652_10100676 | Ga0207652_101006762 | 201 |
| 108 | 3300025932 | Ga0207690_10019939 | Ga0207690_100199394 | 201 |
| 109 | 3300025944 | Ga0207661_10505198 | Ga0207661_105051982 | 201 |
| 110 | 3300025949 | Ga0207667_10128873 | Ga0207667_101288733 | 201 |
| 111 | 3300025981 | Ga0207640_10016310 | Ga0207640_100163102 | 201 |
| 112 | 3300026041 | Ga0207639_10037661 | Ga0207639_100376612 | 201 |
| 113 | 3300026116 | Ga0207674_10023542 | Ga0207674_100235425 | 201 |
| 114 | 3300028381 | Ga0268264_10124135 | Ga0268264_101241352 | 201 |
| 115 | 3300041486 | Ga0451807_0884830 | Ga0451807_0884830_120_728 | 201 |
| 116 | 3300042876 | Ga0451577_0292243 | Ga0451577_0292243_847_1455 | 201 |
| 117 | 3300044712 | Ga0453684_0586581 | Ga0453684_0586581_118_726 | 201 |
| 118 | 3300049571 | Ga0501034_0111061 | Ga0501034_0111061_1906_2574 | 201 |
| 119 | 3300005334 | Ga0068869_100017295 | Ga0068869_1000172955 | 202 |
| 120 | 3300005340 | Ga0070689_100319247 | Ga0070689_1003192472 | 202 |
| 121 | 3300005347 | Ga0070668_100043263 | Ga0070668_1000432634 | 202 |
| 122 | 3300005353 | Ga0070669_100709288 | Ga0070669_1007092881 | 202 |
| 123 | 3300005456 | Ga0070678_100627109 | Ga0070678_1006271092 | 202 |
| 124 | 3300005459 | Ga0068867_100040030 | Ga0068867_1000400304 | 202 |
| 125 | 3300005459 | Ga0068867_100361841 | Ga0068867_1003618412 | 202 |
| 126 | 3300005617 | Ga0068859_100890498 | Ga0068859_1008904982 | 202 |
| 127 | 3300005718 | Ga0068866_10017766 | Ga0068866_100177664 | 202 |
| 128 | 3300005719 | Ga0068861_100143217 | Ga0068861_1001432173 | 202 |
| 129 | 3300005841 | Ga0068863_100111325 | Ga0068863_1001113252 | 202 |
| 130 | 3300005844 | Ga0068862_100216440 | Ga0068862_1002164403 | 202 |
| 131 | 3300005844 | Ga0068862_100423013 | Ga0068862_1004230132 | 202 |
| 132 | 3300005985 | Ga0081539_10120820 | Ga0081539_101208202 | 202 |
| 133 | 3300006931 | Ga0097620_100890561 | Ga0097620_1008905612 | 202 |
| 134 | 3300009177 | Ga0105248_10014430 | Ga0105248_100144302 | 202 |
| 135 | 3300013297 | Ga0157378_10005153 | Ga0157378_1000515310 | 202 |
| 136 | 3300013297 | Ga0157378_10162612 | Ga0157378_101626122 | 202 |
| 137 | 3300013306 | Ga0163162_10000086 | Ga0163162_1000008662 | 202 |
| 138 | 3300013308 | Ga0157375_10000115 | Ga0157375_1000011516 | 202 |
| 139 | 3300013308 | Ga0157375_11142551 | Ga0157375_111425511 | 202 |
| 140 | 3300014969 | Ga0157376_10001060 | Ga0157376_1000106016 | 202 |
| 141 | 3300025923 | Ga0207681_10231658 | Ga0207681_102316582 | 202 |
| 142 | 3300025972 | Ga0207668_10011982 | Ga0207668_100119825 | 202 |
| 143 | 3300025986 | Ga0207658_10452266 | Ga0207658_104522662 | 202 |
| 144 | 3300026088 | Ga0207641_10080565 | Ga0207641_100805652 | 202 |
| 145 | 3300026089 | Ga0207648_10016945 | Ga0207648_100169456 | 202 |
| 146 | 3300026118 | Ga0207675_100044754 | Ga0207675_1000447543 | 202 |
| 147 | 3300026142 | Ga0207698_10267478 | Ga0207698_102674782 | 202 |
| 148 | 3300028380 | Ga0268265_10337878 | Ga0268265_103378782 | 202 |
| 149 | 3300005290 | Ga0065712_10176682 | Ga0065712_101766822 | 203 |
| 150 | 3300005328 | Ga0070676_10098844 | Ga0070676_100988442 | 203 |
| 151 | 3300005328 | Ga0070676_10392458 | Ga0070676_103924581 | 203 |
| 152 | 3300005329 | Ga0070683_100000468 | Ga0070683_10000046824 | 203 |
| 153 | 3300005330 | Ga0070690_100033160 | Ga0070690_1000331603 | 203 |
| 154 | 3300005330 | Ga0070690_100249207 | Ga0070690_1002492072 | 203 |
| 155 | 3300005331 | Ga0070670_100036127 | Ga0070670_1000361274 | 203 |
| 156 | 3300005334 | Ga0068869_100063232 | Ga0068869_1000632324 | 203 |
| 157 | 3300005334 | Ga0068869_100202886 | Ga0068869_1002028862 | 203 |
| 158 | 3300005334 | Ga0068869_100516891 | Ga0068869_1005168912 | 203 |
| 159 | 3300005335 | Ga0070666_10004991 | Ga0070666_100049917 | 203 |
| 160 | 3300005337 | Ga0070682_100112306 | Ga0070682_1001123062 | 203 |
| 161 | 3300005338 | Ga0068868_100078150 | Ga0068868_1000781501 | 203 |
| 162 | 3300005340 | Ga0070689_100008276 | Ga0070689_1000082762 | 203 |
| 163 | 3300005340 | Ga0070689_100050112 | Ga0070689_1000501123 | 203 |
| 164 | 3300005343 | Ga0070687_100554803 | Ga0070687_1005548032 | 203 |
| 165 | 3300005344 | Ga0070661_100000179 | Ga0070661_10000017949 | 203 |
| 166 | 3300005344 | Ga0070661_100034574 | Ga0070661_1000345743 | 203 |
| 167 | 3300005344 | Ga0070661_100041203 | Ga0070661_1000412032 | 203 |
| 168 | 3300005344 | Ga0070661_100662587 | Ga0070661_1006625871 | 203 |
| 169 | 3300005347 | Ga0070668_100159046 | Ga0070668_1001590462 | 203 |
| 170 | 3300005353 | Ga0070669_100031325 | Ga0070669_1000313253 | 203 |
| 171 | 3300005353 | Ga0070669_100080917 | Ga0070669_1000809172 | 203 |
| 172 | 3300005354 | Ga0070675_100174024 | Ga0070675_1001740242 | 203 |
| 173 | 3300005355 | Ga0070671_100015772 | Ga0070671_1000157727 | 203 |
| 174 | 3300005355 | Ga0070671_101024903 | Ga0070671_1010249031 | 203 |
| 175 | 3300005365 | Ga0070688_100703388 | Ga0070688_1007033881 | 203 |
| 176 | 3300005456 | Ga0070678_100004697 | Ga0070678_1000046973 | 203 |
| 177 | 3300005457 | Ga0070662_100005910 | Ga0070662_1000059106 | 203 |
| 178 | 3300005457 | Ga0070662_100049525 | Ga0070662_1000495253 | 203 |
| 179 | 3300005458 | Ga0070681_10613839 | Ga0070681_106138392 | 203 |
| 180 | 3300005459 | Ga0068867_100379898 | Ga0068867_1003798982 | 203 |
| 181 | 3300005466 | Ga0070685_10007192 | Ga0070685_100071927 | 203 |
| 182 | 3300005466 | Ga0070685_10169882 | Ga0070685_101698822 | 203 |
| 183 | 3300005535 | Ga0070684_100000484 | Ga0070684_1000004842 | 203 |
| 184 | 3300005535 | Ga0070684_100022853 | Ga0070684_1000228534 | 203 |
| 185 | 3300005539 | Ga0068853_100015211 | Ga0068853_1000152113 | 203 |
| 186 | 3300005539 | Ga0068853_100022828 | Ga0068853_1000228283 | 203 |
| 187 | 3300005545 | Ga0070695_100811801 | Ga0070695_1008118011 | 203 |
| 188 | 3300005547 | Ga0070693_100211657 | Ga0070693_1002116572 | 203 |
| 189 | 3300005548 | Ga0070665_100079455 | Ga0070665_1000794553 | 203 |
| 190 | 3300005564 | Ga0070664_100000140 | Ga0070664_10000014034 | 203 |
| 191 | 3300005564 | Ga0070664_100054130 | Ga0070664_1000541302 | 203 |
| 192 | 3300005564 | Ga0070664_100258862 | Ga0070664_1002588623 | 203 |
| 193 | 3300005564 | Ga0070664_100262348 | Ga0070664_1002623483 | 203 |
| 194 | 3300005564 | Ga0070664_100766894 | Ga0070664_1007668942 | 203 |
| 195 | 3300005577 | Ga0068857_100007728 | Ga0068857_1000077288 | 203 |
| 196 | 3300005578 | Ga0068854_100011485 | Ga0068854_1000114856 | 203 |
| 197 | 3300005615 | Ga0070702_100656985 | Ga0070702_1006569851 | 203 |
| 198 | 3300005616 | Ga0068852_100127957 | Ga0068852_1001279573 | 203 |
| 199 | 3300005616 | Ga0068852_100379175 | Ga0068852_1003791752 | 203 |
| 200 | 3300005617 | Ga0068859_100005939 | Ga0068859_1000059399 | 203 |
| 201 | 3300005617 | Ga0068859_100100050 | Ga0068859_1001000503 | 203 |
| 202 | 3300005617 | Ga0068859_100201899 | Ga0068859_1002018992 | 203 |
| 203 | 3300005617 | Ga0068859_100359325 | Ga0068859_1003593252 | 203 |
| 204 | 3300005617 | Ga0068859_100525270 | Ga0068859_1005252702 | 203 |
| 205 | 3300005618 | Ga0068864_100061031 | Ga0068864_1000610313 | 203 |
| 206 | 3300005618 | Ga0068864_100232845 | Ga0068864_1002328452 | 203 |
| 207 | 3300005718 | Ga0068866_10008725 | Ga0068866_100087253 | 203 |
| 208 | 3300005719 | Ga0068861_100585690 | Ga0068861_1005856902 | 203 |
| 209 | 3300005840 | Ga0068870_10093933 | Ga0068870_100939332 | 203 |
| 210 | 3300005841 | Ga0068863_100097940 | Ga0068863_1000979402 | 203 |
| 211 | 3300005841 | Ga0068863_100251431 | Ga0068863_1002514312 | 203 |
| 212 | 3300005841 | Ga0068863_100262047 | Ga0068863_1002620472 | 203 |
| 213 | 3300005841 | Ga0068863_100304587 | Ga0068863_1003045872 | 203 |
| 214 | 3300005841 | Ga0068863_100341681 | Ga0068863_1003416812 | 203 |
| 215 | 3300005842 | Ga0068858_100576703 | Ga0068858_1005767032 | 203 |
| 216 | 3300005842 | Ga0068858_100976986 | Ga0068858_1009769861 | 203 |
| 217 | 3300005843 | Ga0068860_100096965 | Ga0068860_1000969651 | 203 |
| 218 | 3300005843 | Ga0068860_100222848 | Ga0068860_1002228483 | 203 |
| 219 | 3300005843 | Ga0068860_101132810 | Ga0068860_1011328101 | 203 |
| 220 | 3300006163 | Ga0070715_10041252 | Ga0070715_100412522 | 203 |
| 221 | 3300006237 | Ga0097621_100011491 | Ga0097621_1000114918 | 203 |
| 222 | 3300006237 | Ga0097621_100152109 | Ga0097621_1001521092 | 203 |
| 223 | 3300006237 | Ga0097621_100528948 | Ga0097621_1005289481 | 203 |
| 224 | 3300006358 | Ga0068871_100011269 | Ga0068871_1000112695 | 203 |
| 225 | 3300006358 | Ga0068871_100019364 | Ga0068871_1000193644 | 203 |
| 226 | 3300006871 | Ga0075434_100085548 | Ga0075434_1000855483 | 203 |
| 227 | 3300006871 | Ga0075434_100439577 | Ga0075434_1004395772 | 203 |
| 228 | 3300006881 | Ga0068865_100189750 | Ga0068865_1001897502 | 203 |
| 229 | 3300006881 | Ga0068865_100440266 | Ga0068865_1004402661 | 203 |
| 230 | 3300006931 | Ga0097620_100005939 | Ga0097620_1000059399 | 203 |
| 231 | 3300006931 | Ga0097620_100100047 | Ga0097620_1001000473 | 203 |
| 232 | 3300006931 | Ga0097620_100201902 | Ga0097620_1002019022 | 203 |
| 233 | 3300006931 | Ga0097620_100359307 | Ga0097620_1003593072 | 203 |
| 234 | 3300006931 | Ga0097620_100525293 | Ga0097620_1005252932 | 203 |
| 235 | 3300009011 | Ga0105251_10109895 | Ga0105251_101098952 | 203 |
| 236 | 3300009093 | Ga0105240_10356633 | Ga0105240_103566331 | 203 |
| 237 | 3300009101 | Ga0105247_10008390 | Ga0105247_100083903 | 203 |
| 238 | 3300009174 | Ga0105241_10474408 | Ga0105241_104744082 | 203 |
| 239 | 3300009176 | Ga0105242_10186413 | Ga0105242_101864132 | 203 |
| 240 | 3300009553 | Ga0105249_10009062 | Ga0105249_100090623 | 203 |
| 241 | 3300009553 | Ga0105249_10038553 | Ga0105249_100385535 | 203 |
| 242 | 3300009553 | Ga0105249_10078816 | Ga0105249_100788162 | 203 |
| 243 | 3300009553 | Ga0105249_10245322 | Ga0105249_102453222 | 203 |
| 244 | 3300010375 | Ga0105239_10247625 | Ga0105239_102476252 | 203 |
| 245 | 3300013100 | Ga0157373_10053938 | Ga0157373_100539384 | 203 |
| 246 | 3300013296 | Ga0157374_10000237 | Ga0157374_1000023720 | 203 |
| 247 | 3300013296 | Ga0157374_10006341 | Ga0157374_1000634111 | 203 |
| 248 | 3300013296 | Ga0157374_10098966 | Ga0157374_100989661 | 203 |
| 249 | 3300013306 | Ga0163162_10006217 | Ga0163162_100062178 | 203 |
| 250 | 3300013306 | Ga0163162_10264187 | Ga0163162_102641872 | 203 |
| 251 | 3300013307 | Ga0157372_10072477 | Ga0157372_100724772 | 203 |
| 252 | 3300013307 | Ga0157372_11764210 | Ga0157372_117642101 | 203 |
| 253 | 3300013308 | Ga0157375_10079604 | Ga0157375_100796042 | 203 |
| 254 | 3300013308 | Ga0157375_10603737 | Ga0157375_106037372 | 203 |
| 255 | 3300013308 | Ga0157375_10634183 | Ga0157375_106341832 | 203 |
| 256 | 3300014325 | Ga0163163_10000088 | Ga0163163_1000008855 | 203 |
| 257 | 3300014325 | Ga0163163_10000244 | Ga0163163_1000024417 | 203 |
| 258 | 3300014325 | Ga0163163_10056245 | Ga0163163_100562452 | 203 |
| 259 | 3300014326 | Ga0157380_10131722 | Ga0157380_101317223 | 203 |
| 260 | 3300014745 | Ga0157377_10009383 | Ga0157377_100093832 | 203 |
| 261 | 3300014745 | Ga0157377_10089787 | Ga0157377_100897873 | 203 |
| 262 | 3300014745 | Ga0157377_10174719 | Ga0157377_101747192 | 203 |
| 263 | 3300014968 | Ga0157379_10050431 | Ga0157379_100504314 | 203 |
| 264 | 3300014969 | Ga0157376_10073355 | Ga0157376_100733553 | 203 |
| 265 | 3300014969 | Ga0157376_10317978 | Ga0157376_103179782 | 203 |
| 266 | 3300014969 | Ga0157376_10526578 | Ga0157376_105265782 | 203 |
| 267 | 3300014969 | Ga0157376_10604161 | Ga0157376_106041611 | 203 |
| 268 | 3300017792 | Ga0163161_10002796 | Ga0163161_1000279612 | 203 |
| 269 | 3300017792 | Ga0163161_10027138 | Ga0163161_100271384 | 203 |
| 270 | 3300025899 | Ga0207642_10028662 | Ga0207642_100286622 | 203 |
| 271 | 3300025900 | Ga0207710_10010630 | Ga0207710_100106302 | 203 |
| 272 | 3300025903 | Ga0207680_10009247 | Ga0207680_100092473 | 203 |
| 273 | 3300025903 | Ga0207680_10500844 | Ga0207680_105008441 | 203 |
| 274 | 3300025904 | Ga0207647_10009722 | Ga0207647_100097226 | 203 |
| 275 | 3300025905 | Ga0207685_10006223 | Ga0207685_100062232 | 203 |
| 276 | 3300025907 | Ga0207645_10007658 | Ga0207645_100076582 | 203 |
| 277 | 3300025912 | Ga0207707_10242770 | Ga0207707_102427701 | 203 |
| 278 | 3300025920 | Ga0207649_10000419 | Ga0207649_1000041924 | 203 |
| 279 | 3300025920 | Ga0207649_10042112 | Ga0207649_100421123 | 203 |
| 280 | 3300025923 | Ga0207681_10184535 | Ga0207681_101845352 | 203 |
| 281 | 3300025925 | Ga0207650_10020700 | Ga0207650_100207003 | 203 |
| 282 | 3300025926 | Ga0207659_10113269 | Ga0207659_101132692 | 203 |
| 283 | 3300025931 | Ga0207644_10327169 | Ga0207644_103271692 | 203 |
| 284 | 3300025932 | Ga0207690_10026064 | Ga0207690_100260644 | 203 |
| 285 | 3300025933 | Ga0207706_10002103 | Ga0207706_100021035 | 203 |
| 286 | 3300025933 | Ga0207706_10018001 | Ga0207706_100180012 | 203 |
| 287 | 3300025933 | Ga0207706_10084464 | Ga0207706_100844643 | 203 |
| 288 | 3300025933 | Ga0207706_10118453 | Ga0207706_101184533 | 203 |
| 289 | 3300025936 | Ga0207670_10003257 | Ga0207670_1000325710 | 203 |
| 290 | 3300025936 | Ga0207670_10061124 | Ga0207670_100611242 | 203 |
| 291 | 3300025938 | Ga0207704_10128813 | Ga0207704_101288132 | 203 |
| 292 | 3300025938 | Ga0207704_10177265 | Ga0207704_101772652 | 203 |
| 293 | 3300025938 | Ga0207704_10407915 | Ga0207704_104079151 | 203 |
| 294 | 3300025940 | Ga0207691_10011435 | Ga0207691_100114354 | 203 |
| 295 | 3300025941 | Ga0207711_10070479 | Ga0207711_100704793 | 203 |
| 296 | 3300025942 | Ga0207689_10021058 | Ga0207689_100210582 | 203 |
| 297 | 3300025942 | Ga0207689_10167225 | Ga0207689_101672252 | 203 |
| 298 | 3300025944 | Ga0207661_10000370 | Ga0207661_100003709 | 203 |
| 299 | 3300025944 | Ga0207661_10331612 | Ga0207661_103316121 | 203 |
| 300 | 3300025945 | Ga0207679_10000266 | Ga0207679_1000026613 | 203 |
| 301 | 3300025945 | Ga0207679_10163117 | Ga0207679_101631172 | 203 |
| 302 | 3300025945 | Ga0207679_10265879 | Ga0207679_102658792 | 203 |
| 303 | 3300025945 | Ga0207679_10356536 | Ga0207679_103565362 | 203 |
| 304 | 3300025945 | Ga0207679_10571150 | Ga0207679_105711501 | 203 |
| 305 | 3300025960 | Ga0207651_10500552 | Ga0207651_105005522 | 203 |
| 306 | 3300025961 | Ga0207712_10043764 | Ga0207712_100437643 | 203 |
| 307 | 3300025961 | Ga0207712_10052431 | Ga0207712_100524313 | 203 |
| 308 | 3300025961 | Ga0207712_10057462 | Ga0207712_100574623 | 203 |
| 309 | 3300025981 | Ga0207640_10021342 | Ga0207640_100213422 | 203 |
| 310 | 3300025986 | Ga0207658_10154632 | Ga0207658_101546322 | 203 |
| 311 | 3300025986 | Ga0207658_10407432 | Ga0207658_104074321 | 203 |
| 312 | 3300025986 | Ga0207658_10478351 | Ga0207658_104783512 | 203 |
| 313 | 3300026023 | Ga0207677_10080790 | Ga0207677_100807903 | 203 |
| 314 | 3300026023 | Ga0207677_10285222 | Ga0207677_102852221 | 203 |
| 315 | 3300026035 | Ga0207703_10311119 | Ga0207703_103111192 | 203 |
| 316 | 3300026035 | Ga0207703_10405070 | Ga0207703_104050702 | 203 |
| 317 | 3300026035 | Ga0207703_10568143 | Ga0207703_105681432 | 203 |
| 318 | 3300026041 | Ga0207639_10012815 | Ga0207639_100128154 | 203 |
| 319 | 3300026041 | Ga0207639_10082339 | Ga0207639_100823392 | 203 |
| 320 | 3300026067 | Ga0207678_10090917 | Ga0207678_100909173 | 203 |
| 321 | 3300026088 | Ga0207641_10037835 | Ga0207641_100378355 | 203 |
| 322 | 3300026088 | Ga0207641_10107035 | Ga0207641_101070352 | 203 |
| 323 | 3300026088 | Ga0207641_10441283 | Ga0207641_104412832 | 203 |
| 324 | 3300026088 | Ga0207641_10625585 | Ga0207641_106255852 | 203 |
| 325 | 3300026089 | Ga0207648_10146511 | Ga0207648_101465113 | 203 |
| 326 | 3300026089 | Ga0207648_10304460 | Ga0207648_103044602 | 203 |
| 327 | 3300026089 | Ga0207648_10556120 | Ga0207648_105561202 | 203 |
| 328 | 3300026095 | Ga0207676_10019254 | Ga0207676_100192542 | 203 |
| 329 | 3300026095 | Ga0207676_10038829 | Ga0207676_100388294 | 203 |
| 330 | 3300026095 | Ga0207676_10192267 | Ga0207676_101922672 | 203 |
| 331 | 3300026116 | Ga0207674_10007803 | Ga0207674_1000780311 | 203 |
| 332 | 3300026116 | Ga0207674_10321322 | Ga0207674_103213222 | 203 |
| 333 | 3300026118 | Ga0207675_100161846 | Ga0207675_1001618462 | 203 |
| 334 | 3300026118 | Ga0207675_100237361 | Ga0207675_1002373612 | 203 |
| 335 | 3300026121 | Ga0207683_10010220 | Ga0207683_100102208 | 203 |
| 336 | 3300026121 | Ga0207683_10031651 | Ga0207683_100316514 | 203 |
| 337 | 3300026142 | Ga0207698_10048581 | Ga0207698_100485814 | 203 |
| 338 | 3300026142 | Ga0207698_10070251 | Ga0207698_100702513 | 203 |
| 339 | 3300028381 | Ga0268264_10146150 | Ga0268264_101461502 | 203 |
| 340 | 3300028381 | Ga0268264_10972371 | Ga0268264_109723712 | 203 |
| 341 | 3300028794 | Ga0307515_10000010 | Ga0307515_10000010126 | 203 |
| 342 | 3300031250 | Ga0265331_10075079 | Ga0265331_100750792 | 203 |
| 343 | 3300031251 | Ga0265327_10000219 | Ga0265327_1000021980 | 203 |
| 344 | 3300035086 | Ga0373934_0082751 | Ga0373934_0082751_412_1023 | 203 |
| 345 | 3300035410 | Ga0373924_0006769 | Ga0373924_0006769_1658_2269 | 203 |
| 346 | 3300035724 | Ga0373933_0012397 | Ga0373933_0012397_4039_4650 | 203 |
| 347 | 3300036401 | Ga0373937_0002104 | Ga0373937_0002104_12704_13315 | 203 |
| 348 | 3300041512 | Ga0451853_1577816 | Ga0451853_1577816_102_713 | 203 |
| 349 | 3300046454 | Ga0495592_0026380 | Ga0495592_0026380_1017_1628 | 203 |
| 350 | 3300046463 | Ga0495653_0043228 | Ga0495653_0043228_2187_2798 | 203 |
| 351 | 3300046517 | Ga0495630_0003153 | Ga0495630_0003153_6245_6856 | 203 |
| 352 | 3300046536 | Ga0495587_0062204 | Ga0495587_0062204_1075_1686 | 203 |
| 353 | 3300046537 | Ga0495598_0103538 | Ga0495598_0103538_189_833 | 203 |
| 354 | 3300046642 | Ga0495634_0019397 | Ga0495634_0019397_176_787 | 203 |
| 355 | 3300046663 | Ga0495635_0255719 | Ga0495635_0255719_386_997 | 203 |
| 356 | 3300046680 | Ga0495646_0188611 | Ga0495646_0188611_152_763 | 203 |
| 357 | 3300046689 | Ga0495613_0118295 | Ga0495613_0118295_191_802 | 203 |
| 358 | 3300048907 | Ga0496104_0686662 | Ga0496104_0686662_14_625 | 203 |
| 359 | 3300048914 | Ga0496111_0089780 | Ga0496111_0089780_1040_1651 | 203 |
| 360 | 3300048914 | Ga0496111_0686191 | Ga0496111_0686191_80_691 | 203 |
| 361 | 3300050512 | nmdc:mga0n895_317322_c1 | nmdc:mga0n895_317322_c1_507_1118 | 203 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7e85-assembly2.cif.gz_B-2 | snoal-like domain-containing protein | 0.7289 | 77 | 109 |
| 3d44-assembly1.cif.gz_A | crystal structure of heptp in complex with a dually phosphorylated erk2 peptide mimetic | 0.5211 | 67 | 106 |
| 2hvl-assembly1.cif.gz_A | crystal structure of the heptp catalytic domain c270s mutant | 0.497 | 67 | 125 |
| 3d42-assembly1.cif.gz_A | crystal structure of heptp in complex with a monophosphorylated erk2 peptide | 0.4965 | 67 | 125 |
| 1zc0-assembly1.cif.gz_A | crystal structure of human hematopoietic tyrosine phosphatase (heptp) catalytic domain | 0.4939 | 70 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9M3D0_8_304_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7425 | 62 | 82 | 3.40.50.1820 |
| af_Q9LID1_55_196_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.638 | 64 | 97 | 2.120.10.80 |
| af_M0R781_602_862_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.636 | 62 | 90 | 3.40.50.1820 |
| af_Q6WIZ7_394_805_2.70.98.20 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5;Copper amine oxidase, catalytic domain | 0.6012 | 64 | 111 | 2.70.98.20 |
| af_P49134_639_725_4.10.1240.30 | Few Secondary Structures;Irregular;Hormone receptor fold; | 0.5791 | 51 | 81 | 4.10.1240.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537KQZ0-F1-model_v4 | Uncharacterized protein | 0.9784 | 1 | 203 |
|
| AF-A0A537KQZ0-F1-model_v4 | Uncharacterized protein | 0.9736 | 1 | 203 |
|
| AF-A0A537IFL4-F1-model_v4 | Uncharacterized protein | 0.9603 | 1 | 202 |
|
| AF-A0A522DR60-F1-model_v4 | Uncharacterized protein | 0.96 | 7 | 203 |
|
| AF-A0A431MQS3-F1-model_v4 | Uncharacterized protein | 0.9597 | 6 | 199 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar