F422134

General Info

Members Datasets Scaffolds Average Seq Length
361 169 361 206

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100361841|Ga0068867_1003618412
Length 224
Sequence MNNSSKLQLSAEEMELVSNTEWILTKHGIIKKVYEMFGEINDMMRSEVMGSNHLFHENLKFRQGGKISKGENYQMLPYVILDYPSFFEKDNIFTIRTMFWWGNFFSVTLHLSGDHKTKFINNAPSLFSSLKKNNFFICINEEEWQHHFKEGNYALASAITNEEYTQLIKQDFFKVAKKLPLIRWENAYDFIMESFREILELLQINFQGDKKDLLPGSPIIGSDL

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
148 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
149 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
154 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
155 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
156 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
157 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
158 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
159 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
160 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
161 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
162 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
163 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
164 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
165 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
166 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.11
Rhizosphere 98.34
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10176682 3300005290 Bacteria 1208
2 Ga0070658_10010368 3300005327 Bacteria 7475
3 Ga0070658_10271905 3300005327 Bacteria 1441
4 Ga0070658_10329567 3300005327 Bacteria 1304
5 Ga0070676_10098844 3300005328 Unclassified 1800
6 Ga0070676_10392458 3300005328 Bacteria 964
7 Ga0070683_100000468 3300005329 Bacteria 28362
8 Ga0070683_100373354 3300005329 Bacteria 1359
9 Ga0070690_100033160 3300005330 Bacteria 3230
10 Ga0070690_100249207 3300005330 Bacteria 1255
11 Ga0070670_100036127 3300005331 Bacteria 4252
12 Ga0070670_100667417 3300005331 Bacteria 933
13 Ga0068869_100017295 3300005334 Bacteria 4884
14 Ga0068869_100056733 3300005334 Bacteria 2857
15 Ga0068869_100063232 3300005334 Bacteria 2718
16 Ga0068869_100076813 3300005334 Bacteria 2483
17 Ga0068869_100202886 3300005334 Bacteria 1564
18 Ga0068869_100516891 3300005334 Bacteria 999
19 Ga0070666_10004991 3300005335 Bacteria 8117
20 Ga0070680_100015403 3300005336 Bacteria 5994
21 Ga0070682_100112306 3300005337 Bacteria 1818
22 Ga0068868_100078150 3300005338 Bacteria 2648
23 Ga0070660_100002766 3300005339 Bacteria 12053
24 Ga0070660_100022308 3300005339 Bacteria 4679
25 Ga0070689_100008276 3300005340 Bacteria 7318
26 Ga0070689_100050112 3300005340 Bacteria 3225
27 Ga0070689_100319247 3300005340 Bacteria 1297
28 Ga0070687_100554803 3300005343 Bacteria 782
29 Ga0070661_100000179 3300005344 Bacteria 52306
30 Ga0070661_100034574 3300005344 Bacteria 3665
31 Ga0070661_100041203 3300005344 Bacteria 3370
32 Ga0070661_100662587 3300005344 Bacteria 848
33 Ga0070668_100043263 3300005347 Bacteria 3454
34 Ga0070668_100159046 3300005347 Bacteria 1832
35 Ga0070669_100031325 3300005353 Bacteria 3842
36 Ga0070669_100046644 3300005353 Bacteria 3160
37 Ga0070669_100080917 3300005353 Bacteria 2419
38 Ga0070669_100709288 3300005353 Bacteria 850
39 Ga0070675_100020576 3300005354 Bacteria 5264
40 Ga0070675_100174024 3300005354 Bacteria 1858
41 Ga0070671_100008104 3300005355 Bacteria 8414
42 Ga0070671_100015772 3300005355 Bacteria 6105
43 Ga0070671_101024903 3300005355 Bacteria 724
44 Ga0070688_100703388 3300005365 Bacteria 783
45 Ga0070659_100025861 3300005366 Bacteria 4515
46 Ga0070667_100077748 3300005367 Bacteria 2834
47 Ga0070678_100004697 3300005456 Bacteria 7775
48 Ga0070678_100018048 3300005456 Bacteria 4563
49 Ga0070678_100627109 3300005456 Bacteria 962
50 Ga0070662_100005910 3300005457 Bacteria 7851
51 Ga0070662_100049525 3300005457 Bacteria 3029
52 Ga0070681_10085457 3300005458 Bacteria 3107
53 Ga0070681_10613839 3300005458 Bacteria 1002
54 Ga0068867_100040030 3300005459 Bacteria 3419
55 Ga0068867_100361841 3300005459 Bacteria 1214
56 Ga0068867_100379898 3300005459 Bacteria 1186
57 Ga0068867_100464861 3300005459 Bacteria 1081
58 Ga0070685_10007192 3300005466 Bacteria 5688
59 Ga0070685_10169882 3300005466 Bacteria 1397
60 Ga0070679_100001442 3300005530 Bacteria 21032
61 Ga0070679_100115058 3300005530 Bacteria 2675
62 Ga0070679_101051514 3300005530 Bacteria 758
63 Ga0070684_100000484 3300005535 Bacteria 27334
64 Ga0070684_100022853 3300005535 Bacteria 5220
65 Ga0068853_100015211 3300005539 Bacteria 6324
66 Ga0068853_100022828 3300005539 Bacteria 5230
67 Ga0068853_100285236 3300005539 Bacteria 1523
68 Ga0070695_100811801 3300005545 Bacteria 750
69 Ga0070693_100211657 3300005547 Bacteria 1265
70 Ga0070665_100079455 3300005548 Bacteria 3286
71 Ga0068855_100052840 3300005563 Bacteria 4782
72 Ga0068855_100555181 3300005563 Bacteria 1243
73 Ga0068855_101090679 3300005563 Bacteria 835
74 Ga0070664_100000140 3300005564 Bacteria 49126
75 Ga0070664_100054130 3300005564 Unclassified 3404
76 Ga0070664_100258862 3300005564 Bacteria 1565
77 Ga0070664_100262348 3300005564 Bacteria 1554
78 Ga0070664_100766894 3300005564 Bacteria 901
79 Ga0068857_100007728 3300005577 Bacteria 9263
80 Ga0068854_100011485 3300005578 Bacteria 5769
81 Ga0070702_100656985 3300005615 Bacteria 794
82 Ga0068852_100010785 3300005616 Bacteria 6845
83 Ga0068852_100127957 3300005616 Bacteria 2335
84 Ga0068852_100379175 3300005616 Bacteria 1387
85 Ga0068852_101385310 3300005616 Bacteria 725
86 Ga0068859_100005939 3300005617 Bacteria 12395
87 Ga0068859_100007298 3300005617 Bacteria 11213
88 Ga0068859_100100050 3300005617 Bacteria 2955
89 Ga0068859_100105935 3300005617 Bacteria 2871
90 Ga0068859_100201899 3300005617 Bacteria 2073
91 Ga0068859_100359325 3300005617 Unclassified 1551
92 Ga0068859_100525270 3300005617 Bacteria 1278
93 Ga0068859_100719847 3300005617 Bacteria 1088
94 Ga0068859_100890498 3300005617 Unclassified 975
95 Ga0068864_100019755 3300005618 Bacteria 5634
96 Ga0068864_100034237 3300005618 Bacteria 4320
97 Ga0068864_100061031 3300005618 Unclassified 3265
98 Ga0068864_100232845 3300005618 Unclassified 1704
99 Ga0068866_10008725 3300005718 Bacteria 4285
100 Ga0068866_10017766 3300005718 Bacteria 3204
101 Ga0068866_10261797 3300005718 Bacteria 1063
102 Ga0068861_100143217 3300005719 Bacteria 1953
103 Ga0068861_100585690 3300005719 Bacteria 1022
104 Ga0068870_10093933 3300005840 Bacteria 1683
105 Ga0068863_100097940 3300005841 Bacteria 2785
106 Ga0068863_100111325 3300005841 Bacteria 2608
107 Ga0068863_100251431 3300005841 Bacteria 1707
108 Ga0068863_100262047 3300005841 Bacteria 1671
109 Ga0068863_100304587 3300005841 Bacteria 1546
110 Ga0068863_100341681 3300005841 Bacteria 1456
111 Ga0068858_100131947 3300005842 Unclassified 2343
112 Ga0068858_100576703 3300005842 Bacteria 1090
113 Ga0068858_100976986 3300005842 Unclassified 829
114 Ga0068860_100007061 3300005843 Bacteria 11243
115 Ga0068860_100096965 3300005843 Unclassified 2811
116 Ga0068860_100222848 3300005843 Bacteria 1831
117 Ga0068860_101132810 3300005843 Unclassified 802
118 Ga0068862_100216440 3300005844 Bacteria 1733
119 Ga0068862_100423013 3300005844 Bacteria 1250
120 Ga0068862_100533328 3300005844 Bacteria 1119
121 Ga0081539_10120820 3300005985 Bacteria 1301
122 Ga0070715_10041252 3300006163 Unclassified 1933
123 Ga0070715_10194068 3300006163 Bacteria 1027
124 Ga0097621_100000118 3300006237 Bacteria 45384
125 Ga0097621_100011491 3300006237 Bacteria 6523
126 Ga0097621_100152109 3300006237 Bacteria 1985
127 Ga0097621_100528948 3300006237 Unclassified 1071
128 Ga0068871_100011269 3300006358 Bacteria 6555
129 Ga0068871_100019364 3300006358 Bacteria 5196
130 Ga0075434_100085548 3300006871 Bacteria 3153
131 Ga0075434_100439577 3300006871 Bacteria 1326
132 Ga0068865_100189750 3300006881 Bacteria 1588
133 Ga0068865_100440266 3300006881 Bacteria 1075
134 Ga0097620_100005939 3300006931 Bacteria 12395
135 Ga0097620_100007298 3300006931 Bacteria 11213
136 Ga0097620_100100047 3300006931 Bacteria 2955
137 Ga0097620_100105936 3300006931 Bacteria 2871
138 Ga0097620_100201902 3300006931 Bacteria 2073
139 Ga0097620_100359307 3300006931 Unclassified 1551
140 Ga0097620_100525293 3300006931 Bacteria 1278
141 Ga0097620_100719905 3300006931 Bacteria 1088
142 Ga0097620_100890561 3300006931 Unclassified 975
143 Ga0105251_10109895 3300009011 Unclassified 1256
144 Ga0105240_10356633 3300009093 Bacteria 1658
145 Ga0105240_10946081 3300009093 Bacteria 924
146 Ga0105247_10008390 3300009101 Bacteria 6298
147 Ga0105241_10474408 3300009174 Bacteria 1111
148 Ga0105242_10186413 3300009176 Bacteria 1834
149 Ga0105248_10014430 3300009177 Bacteria 8696
150 Ga0105249_10009062 3300009553 Bacteria 8700
151 Ga0105249_10038553 3300009553 Bacteria 4336
152 Ga0105249_10078816 3300009553 Bacteria 3057
153 Ga0105249_10245322 3300009553 Bacteria 1773
154 Ga0105239_10247625 3300010375 Bacteria 2001
155 Ga0157373_10011824 3300013100 Bacteria 6412
156 Ga0157373_10053938 3300013100 Bacteria 2858
157 Ga0157373_10054257 3300013100 Bacteria 2848
158 Ga0157371_10006604 3300013102 Bacteria 9532
159 Ga0157371_10066624 3300013102 Bacteria 2550
160 Ga0157371_10140652 3300013102 Bacteria 1719
161 Ga0157370_10557505 3300013104 Bacteria 1050
162 Ga0157370_10624551 3300013104 Bacteria 986
163 Ga0157369_10038641 3300013105 Bacteria 5218
164 Ga0157374_10000237 3300013296 Bacteria 51331
165 Ga0157374_10006341 3300013296 Bacteria 10032
166 Ga0157374_10098966 3300013296 Bacteria 2793
167 Ga0157378_10005153 3300013297 Bacteria 11475
168 Ga0157378_10162612 3300013297 Bacteria 2089
169 Ga0157378_10692674 3300013297 Bacteria 1038
170 Ga0163162_10000086 3300013306 Bacteria 85949
171 Ga0163162_10006217 3300013306 Bacteria 11572
172 Ga0163162_10076764 3300013306 Bacteria 3403
173 Ga0163162_10264187 3300013306 Bacteria 1853
174 Ga0157372_10006279 3300013307 Bacteria 12639
175 Ga0157372_10055089 3300013307 Bacteria 4439
176 Ga0157372_10072477 3300013307 Bacteria 3882
177 Ga0157372_11764210 3300013307 Unclassified 712
178 Ga0157375_10000115 3300013308 Bacteria 77964
179 Ga0157375_10079604 3300013308 Bacteria 3313
180 Ga0157375_10603737 3300013308 Bacteria 1256
181 Ga0157375_10634183 3300013308 Bacteria 1226
182 Ga0157375_11142551 3300013308 Bacteria 912
183 Ga0163163_10000088 3300014325 Bacteria 101126
184 Ga0163163_10000244 3300014325 Bacteria 55634
185 Ga0163163_10056245 3300014325 Bacteria 3888
186 Ga0157380_10131722 3300014326 Bacteria 2134
187 Ga0157377_10009383 3300014745 Bacteria 4799
188 Ga0157377_10089787 3300014745 Bacteria 1812
189 Ga0157377_10174719 3300014745 Bacteria 1346
190 Ga0157379_10050431 3300014968 Bacteria 3715
191 Ga0157376_10001060 3300014969 Bacteria 18012
192 Ga0157376_10073355 3300014969 Bacteria 2914
193 Ga0157376_10317978 3300014969 Bacteria 1479
194 Ga0157376_10526578 3300014969 Bacteria 1166
195 Ga0157376_10604161 3300014969 Bacteria 1092
196 Ga0163161_10002796 3300017792 Bacteria 12374
197 Ga0163161_10006573 3300017792 Bacteria 8049
198 Ga0163161_10027138 3300017792 Bacteria 4061
199 Ga0207656_10083691 3300025321 Bacteria 1438
200 Ga0207642_10028662 3300025899 Bacteria 2295
201 Ga0207710_10010630 3300025900 Bacteria 3876
202 Ga0207680_10009247 3300025903 Bacteria 4878
203 Ga0207680_10500844 3300025903 Bacteria 865
204 Ga0207647_10009722 3300025904 Bacteria 6823
205 Ga0207685_10006223 3300025905 Bacteria 3231
206 Ga0207645_10007658 3300025907 Bacteria 7609
207 Ga0207705_10074064 3300025909 Bacteria 2471
208 Ga0207705_10114463 3300025909 Bacteria 1995
209 Ga0207705_10128238 3300025909 Bacteria 1886
210 Ga0207707_10242770 3300025912 Bacteria 1566
211 Ga0207660_10052319 3300025917 Bacteria 2907
212 Ga0207660_10177239 3300025917 Bacteria 1653
213 Ga0207657_10016994 3300025919 Bacteria 6998
214 Ga0207657_10040875 3300025919 Bacteria 4105
215 Ga0207657_10106769 3300025919 Bacteria 2316
216 Ga0207649_10000419 3300025920 Bacteria 31284
217 Ga0207649_10042112 3300025920 Bacteria 2784
218 Ga0207652_10008227 3300025921 Bacteria 8377
219 Ga0207652_10018048 3300025921 Bacteria 5784
220 Ga0207652_10100676 3300025921 Bacteria 2551
221 Ga0207681_10184535 3300025923 Bacteria 1591
222 Ga0207681_10231658 3300025923 Bacteria 1434
223 Ga0207650_10020700 3300025925 Bacteria 4642
224 Ga0207650_10426799 3300025925 Bacteria 1101
225 Ga0207659_10113269 3300025926 Bacteria 2066
226 Ga0207644_10013035 3300025931 Bacteria 5533
227 Ga0207644_10327169 3300025931 Bacteria 1240
228 Ga0207690_10019939 3300025932 Bacteria 4135
229 Ga0207690_10026064 3300025932 Bacteria 3680
230 Ga0207706_10002103 3300025933 Bacteria 19496
231 Ga0207706_10018001 3300025933 Bacteria 6357
232 Ga0207706_10084464 3300025933 Bacteria 2791
233 Ga0207706_10118453 3300025933 Bacteria 2328
234 Ga0207670_10003257 3300025936 Bacteria 8605
235 Ga0207670_10061124 3300025936 Bacteria 2569
236 Ga0207704_10128813 3300025938 Bacteria 1748
237 Ga0207704_10177265 3300025938 Bacteria 1536
238 Ga0207704_10407915 3300025938 Bacteria 1074
239 Ga0207691_10011435 3300025940 Bacteria 8516
240 Ga0207711_10070479 3300025941 Bacteria 3032
241 Ga0207689_10021058 3300025942 Bacteria 5481
242 Ga0207689_10045204 3300025942 Bacteria 3642
243 Ga0207689_10066263 3300025942 Bacteria 2970
244 Ga0207689_10167225 3300025942 Bacteria 1812
245 Ga0207661_10000370 3300025944 Bacteria 28914
246 Ga0207661_10331612 3300025944 Bacteria 1369
247 Ga0207661_10505198 3300025944 Bacteria 1105
248 Ga0207679_10000266 3300025945 Bacteria 39927
249 Ga0207679_10163117 3300025945 Bacteria 1827
250 Ga0207679_10265879 3300025945 Bacteria 1465
251 Ga0207679_10356536 3300025945 Bacteria 1276
252 Ga0207679_10571150 3300025945 Bacteria 1016
253 Ga0207667_10128873 3300025949 Bacteria 2606
254 Ga0207667_10628074 3300025949 Bacteria 1081
255 Ga0207651_10500552 3300025960 Bacteria 1050
256 Ga0207651_10946960 3300025960 Bacteria 768
257 Ga0207712_10043764 3300025961 Bacteria 3091
258 Ga0207712_10052431 3300025961 Unclassified 2857
259 Ga0207712_10057462 3300025961 Bacteria 2745
260 Ga0207668_10011982 3300025972 Bacteria 5292
261 Ga0207640_10016310 3300025981 Unclassified 4318
262 Ga0207640_10021342 3300025981 Bacteria 3859
263 Ga0207658_10154632 3300025986 Unclassified 1873
264 Ga0207658_10241994 3300025986 Bacteria 1529
265 Ga0207658_10407432 3300025986 Bacteria 1196
266 Ga0207658_10452266 3300025986 Bacteria 1137
267 Ga0207658_10478351 3300025986 Bacteria 1106
268 Ga0207677_10080790 3300026023 Bacteria 2331
269 Ga0207677_10285222 3300026023 Unclassified 1357
270 Ga0207703_10311119 3300026035 Bacteria 1440
271 Ga0207703_10405070 3300026035 Bacteria 1266
272 Ga0207703_10568143 3300026035 Bacteria 1070
273 Ga0207639_10012815 3300026041 Bacteria 5851
274 Ga0207639_10037661 3300026041 Bacteria 3593
275 Ga0207639_10082339 3300026041 Bacteria 2551
276 Ga0207678_10090917 3300026067 Bacteria 2608
277 Ga0207678_11130585 3300026067 Bacteria 693
278 Ga0207641_10037835 3300026088 Bacteria 4032
279 Ga0207641_10080565 3300026088 Bacteria 2825
280 Ga0207641_10107035 3300026088 Unclassified 2473
281 Ga0207641_10441283 3300026088 Bacteria 1256
282 Ga0207641_10625585 3300026088 Unclassified 1056
283 Ga0207648_10016945 3300026089 Bacteria 6639
284 Ga0207648_10146511 3300026089 Bacteria 2083
285 Ga0207648_10304460 3300026089 Bacteria 1430
286 Ga0207648_10556120 3300026089 Bacteria 1054
287 Ga0207648_10762807 3300026089 Bacteria 899
288 Ga0207676_10011089 3300026095 Bacteria 6433
289 Ga0207676_10019254 3300026095 Bacteria 4976
290 Ga0207676_10038829 3300026095 Bacteria 3637
291 Ga0207676_10053210 3300026095 Bacteria 3168
292 Ga0207676_10192267 3300026095 Bacteria 1797
293 Ga0207674_10007803 3300026116 Bacteria 12446
294 Ga0207674_10023542 3300026116 Bacteria 6593
295 Ga0207674_10321322 3300026116 Bacteria 1497
296 Ga0207675_100044754 3300026118 Bacteria 4137
297 Ga0207675_100161846 3300026118 Bacteria 2135
298 Ga0207675_100237361 3300026118 Unclassified 1761
299 Ga0207683_10010220 3300026121 Bacteria 8005
300 Ga0207683_10031651 3300026121 Bacteria 4591
301 Ga0207683_10311957 3300026121 Bacteria 1440
302 Ga0207698_10048581 3300026142 Bacteria 3222
303 Ga0207698_10070251 3300026142 Bacteria 2774
304 Ga0207698_10267478 3300026142 Bacteria 1574
305 Ga0207698_10760326 3300026142 Bacteria 969
306 Ga0268265_10166897 3300028380 Unclassified 1877
307 Ga0268265_10337878 3300028380 Bacteria 1370
308 Ga0268264_10005924 3300028381 Bacteria 10348
309 Ga0268264_10124135 3300028381 Unclassified 2279
310 Ga0268264_10146150 3300028381 Bacteria 2114
311 Ga0268264_10972371 3300028381 Unclassified 855
312 Ga0307515_10000010 3300028794 Bacteria 651586
313 Ga0265331_10075079 3300031250 Bacteria 1577
314 Ga0265327_10000219 3300031251 Bacteria 116606
315 Ga0265327_10063339 3300031251 Bacteria 1878
316 Ga0373934_0082751 3300035086 Bacteria 1290
317 Ga0373943_0075083 3300035170 Bacteria 1721
318 Ga0373924_0006769 3300035410 Bacteria 4118
319 Ga0373933_0012397 3300035724 Bacteria 4707
320 Ga0373937_0002104 3300036401 Bacteria 16647
321 Ga0451807_0884830 3300041486 Bacteria 1435
322 Ga0451853_1577816 3300041512 Bacteria 1417
323 Ga0451577_0292243 3300042876 Bacteria 1477
324 Ga0453684_0586581 3300044712 Bacteria 1223
325 Ga0495592_0026380 3300046454 Bacteria 4405
326 Ga0495653_0043228 3300046463 Bacteria 3505
327 Ga0495630_0003153 3300046517 Bacteria 11441
328 Ga0495587_0062204 3300046536 Bacteria 2186
329 Ga0495598_0103538 3300046537 Bacteria 945
330 Ga0495634_0019397 3300046642 Bacteria 4833
331 Ga0495635_0255719 3300046663 Bacteria 1180
332 Ga0495646_0188611 3300046680 Bacteria 1128
333 Ga0495613_0118295 3300046689 Bacteria 1905
334 Ga0496104_0686662 3300048907 Unclassified 932
335 Ga0496111_0089780 3300048914 Bacteria 2251
336 Ga0496111_0686191 3300048914 Unclassified 746
337 Ga0501291_050191 3300049514 Bacteria 758
338 Ga0501298_011148 3300049521 Bacteria 1557
339 Ga0501299_006290 3300049522 Bacteria 1859
340 Ga0501032_0400257 3300049569 Bacteria 882
341 Ga0501033_0080020 3300049570 Bacteria 2398
342 Ga0501034_0111061 3300049571 Bacteria 2732
343 Ga0501034_1081674 3300049571 Bacteria 683
344 Ga0501201_001663 3300049651 Bacteria 2068
345 Ga0501202_002207 3300049652 Bacteria 3248
346 Ga0501206_008166 3300049653 Bacteria 1382
347 Ga0501207_014739 3300049654 Bacteria 1196
348 Ga0501217_000585 3300049661 Bacteria 6139
349 Ga0501235_011635 3300049669 Bacteria 1930
350 Ga0501243_000796 3300049675 Bacteria 4379
351 Ga0501252_010264 3300049682 Bacteria 1104
352 Ga0501256_019437 3300049685 Bacteria 704
353 Ga0501261_002428 3300049690 Bacteria 2286
354 Ga0501221_000606 3300049704 Bacteria 5723
355 Ga0501225_0000561 3300049705 Bacteria 11624
356 Ga0501234_003922 3300049707 Bacteria 2336
357 Ga0501245_000123 3300049708 Bacteria 7876
358 Ga0501035_0080039 3300049822 Bacteria 2885
359 Ga0501035_0261549 3300049822 Unclassified 1467
360 Ga0501044_0312142 3300049823 Unclassified 1499
361 nmdc:mga0n895_317322_c1 3300050512 Bacteria 1579

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_1081674 Ga0501034_1081674_47_577 152
2 3300049822 Ga0501035_0261549 Ga0501035_0261549_29_658 168
3 3300026067 Ga0207678_11130585 Ga0207678_111305851 169
4 3300049514 Ga0501291_050191 Ga0501291_050191_187_702 170
5 3300049685 Ga0501256_019437 Ga0501256_019437_79_594 170
6 3300005355 Ga0070671_100008104 Ga0070671_1000081042 174
7 3300005456 Ga0070678_100018048 Ga0070678_1000180482 174
8 3300005718 Ga0068866_10261797 Ga0068866_102617972 174
9 3300006237 Ga0097621_100000118 Ga0097621_1000001189 174
10 3300017792 Ga0163161_10006573 Ga0163161_100065738 174
11 3300025931 Ga0207644_10013035 Ga0207644_100130352 174
12 3300049570 Ga0501033_0080020 Ga0501033_0080020_1791_2387 174
13 3300026121 Ga0207683_10311957 Ga0207683_103119572 175
14 3300028380 Ga0268265_10166897 Ga0268265_101668971 180
15 3300009093 Ga0105240_10946081 Ga0105240_109460812 181
16 3300049569 Ga0501032_0400257 Ga0501032_0400257_173_808 187
17 3300049822 Ga0501035_0080039 Ga0501035_0080039_1705_2340 187
18 3300005334 Ga0068869_100076813 Ga0068869_1000768132 190
19 3300005354 Ga0070675_100020576 Ga0070675_1000205762 190
20 3300005367 Ga0070667_100077748 Ga0070667_1000777482 190
21 3300005617 Ga0068859_100007298 Ga0068859_1000072988 190
22 3300005618 Ga0068864_100019755 Ga0068864_1000197553 190
23 3300005844 Ga0068862_100533328 Ga0068862_1005333282 190
24 3300006931 Ga0097620_100007298 Ga0097620_1000072988 190
25 3300025942 Ga0207689_10045204 Ga0207689_100452043 190
26 3300025949 Ga0207667_10628074 Ga0207667_106280741 190
27 3300026095 Ga0207676_10011089 Ga0207676_100110893 190
28 3300026142 Ga0207698_10760326 Ga0207698_107603262 190
29 3300035170 Ga0373943_0075083 Ga0373943_0075083_361_933 190
30 3300031251 Ga0265327_10063339 Ga0265327_100633392 192
31 3300005842 Ga0068858_100131947 Ga0068858_1001319473 195
32 3300005339 Ga0070660_100002766 Ga0070660_1000027666 196
33 3300025919 Ga0207657_10016994 Ga0207657_100169949 196
34 3300013306 Ga0163162_10076764 Ga0163162_100767644 197
35 3300025321 Ga0207656_10083691 Ga0207656_100836912 199
36 3300049521 Ga0501298_011148 Ga0501298_011148_364_966 199
37 3300049522 Ga0501299_006290 Ga0501299_006290_178_780 199
38 3300049651 Ga0501201_001663 Ga0501201_001663_1453_2055 199
39 3300049652 Ga0501202_002207 Ga0501202_002207_1172_1774 199
40 3300049653 Ga0501206_008166 Ga0501206_008166_241_843 199
41 3300049654 Ga0501207_014739 Ga0501207_014739_532_1134 199
42 3300049661 Ga0501217_000585 Ga0501217_000585_1289_1891 199
43 3300049669 Ga0501235_011635 Ga0501235_011635_758_1360 199
44 3300049675 Ga0501243_000796 Ga0501243_000796_1453_2055 199
45 3300049682 Ga0501252_010264 Ga0501252_010264_52_654 199
46 3300049690 Ga0501261_002428 Ga0501261_002428_1477_2079 199
47 3300049704 Ga0501221_000606 Ga0501221_000606_3848_4450 199
48 3300049705 Ga0501225_0000561 Ga0501225_0000561_6382_6984 199
49 3300049707 Ga0501234_003922 Ga0501234_003922_396_998 199
50 3300049708 Ga0501245_000123 Ga0501245_000123_1345_1947 199
51 3300005331 Ga0070670_100667417 Ga0070670_1006674171 200
52 3300005334 Ga0068869_100056733 Ga0068869_1000567332 200
53 3300005353 Ga0070669_100046644 Ga0070669_1000466443 200
54 3300005459 Ga0068867_100464861 Ga0068867_1004648612 200
55 3300005617 Ga0068859_100105935 Ga0068859_1001059353 200
56 3300005618 Ga0068864_100034237 Ga0068864_1000342372 200
57 3300006931 Ga0097620_100105936 Ga0097620_1001059363 200
58 3300013307 Ga0157372_10055089 Ga0157372_100550893 200
59 3300025925 Ga0207650_10426799 Ga0207650_104267992 200
60 3300025942 Ga0207689_10066263 Ga0207689_100662634 200
61 3300025960 Ga0207651_10946960 Ga0207651_109469602 200
62 3300025986 Ga0207658_10241994 Ga0207658_102419942 200
63 3300026089 Ga0207648_10762807 Ga0207648_107628071 200
64 3300026095 Ga0207676_10053210 Ga0207676_100532102 200
65 3300028381 Ga0268264_10005924 Ga0268264_100059245 200
66 3300049823 Ga0501044_0312142 Ga0501044_0312142_195_827 200
67 3300005327 Ga0070658_10010368 Ga0070658_100103683 201
68 3300005327 Ga0070658_10271905 Ga0070658_102719051 201
69 3300005327 Ga0070658_10329567 Ga0070658_103295671 201
70 3300005329 Ga0070683_100373354 Ga0070683_1003733542 201
71 3300005336 Ga0070680_100015403 Ga0070680_1000154034 201
72 3300005339 Ga0070660_100022308 Ga0070660_1000223082 201
73 3300005366 Ga0070659_100025861 Ga0070659_1000258613 201
74 3300005458 Ga0070681_10085457 Ga0070681_100854573 201
75 3300005530 Ga0070679_100001442 Ga0070679_10000144210 201
76 3300005530 Ga0070679_100115058 Ga0070679_1001150582 201
77 3300005530 Ga0070679_101051514 Ga0070679_1010515141 201
78 3300005539 Ga0068853_100285236 Ga0068853_1002852362 201
79 3300005563 Ga0068855_100052840 Ga0068855_1000528403 201
80 3300005563 Ga0068855_100555181 Ga0068855_1005551812 201
81 3300005563 Ga0068855_101090679 Ga0068855_1010906792 201
82 3300005616 Ga0068852_100010785 Ga0068852_1000107858 201
83 3300005616 Ga0068852_101385310 Ga0068852_1013853102 201
84 3300005617 Ga0068859_100719847 Ga0068859_1007198472 201
85 3300005843 Ga0068860_100007061 Ga0068860_1000070612 201
86 3300006163 Ga0070715_10194068 Ga0070715_101940682 201
87 3300006931 Ga0097620_100719905 Ga0097620_1007199052 201
88 3300013100 Ga0157373_10011824 Ga0157373_100118244 201
89 3300013100 Ga0157373_10054257 Ga0157373_100542572 201
90 3300013102 Ga0157371_10006604 Ga0157371_100066043 201
91 3300013102 Ga0157371_10066624 Ga0157371_100666242 201
92 3300013102 Ga0157371_10140652 Ga0157371_101406521 201
93 3300013104 Ga0157370_10557505 Ga0157370_105575052 201
94 3300013104 Ga0157370_10624551 Ga0157370_106245511 201
95 3300013105 Ga0157369_10038641 Ga0157369_100386415 201
96 3300013297 Ga0157378_10692674 Ga0157378_106926741 201
97 3300013307 Ga0157372_10006279 Ga0157372_100062793 201
98 3300025909 Ga0207705_10074064 Ga0207705_100740642 201
99 3300025909 Ga0207705_10114463 Ga0207705_101144631 201
100 3300025909 Ga0207705_10128238 Ga0207705_101282382 201
101 3300025917 Ga0207660_10052319 Ga0207660_100523193 201
102 3300025917 Ga0207660_10177239 Ga0207660_101772392 201
103 3300025919 Ga0207657_10040875 Ga0207657_100408753 201
104 3300025919 Ga0207657_10106769 Ga0207657_101067693 201
105 3300025921 Ga0207652_10008227 Ga0207652_100082273 201
106 3300025921 Ga0207652_10018048 Ga0207652_100180484 201
107 3300025921 Ga0207652_10100676 Ga0207652_101006762 201
108 3300025932 Ga0207690_10019939 Ga0207690_100199394 201
109 3300025944 Ga0207661_10505198 Ga0207661_105051982 201
110 3300025949 Ga0207667_10128873 Ga0207667_101288733 201
111 3300025981 Ga0207640_10016310 Ga0207640_100163102 201
112 3300026041 Ga0207639_10037661 Ga0207639_100376612 201
113 3300026116 Ga0207674_10023542 Ga0207674_100235425 201
114 3300028381 Ga0268264_10124135 Ga0268264_101241352 201
115 3300041486 Ga0451807_0884830 Ga0451807_0884830_120_728 201
116 3300042876 Ga0451577_0292243 Ga0451577_0292243_847_1455 201
117 3300044712 Ga0453684_0586581 Ga0453684_0586581_118_726 201
118 3300049571 Ga0501034_0111061 Ga0501034_0111061_1906_2574 201
119 3300005334 Ga0068869_100017295 Ga0068869_1000172955 202
120 3300005340 Ga0070689_100319247 Ga0070689_1003192472 202
121 3300005347 Ga0070668_100043263 Ga0070668_1000432634 202
122 3300005353 Ga0070669_100709288 Ga0070669_1007092881 202
123 3300005456 Ga0070678_100627109 Ga0070678_1006271092 202
124 3300005459 Ga0068867_100040030 Ga0068867_1000400304 202
125 3300005459 Ga0068867_100361841 Ga0068867_1003618412 202
126 3300005617 Ga0068859_100890498 Ga0068859_1008904982 202
127 3300005718 Ga0068866_10017766 Ga0068866_100177664 202
128 3300005719 Ga0068861_100143217 Ga0068861_1001432173 202
129 3300005841 Ga0068863_100111325 Ga0068863_1001113252 202
130 3300005844 Ga0068862_100216440 Ga0068862_1002164403 202
131 3300005844 Ga0068862_100423013 Ga0068862_1004230132 202
132 3300005985 Ga0081539_10120820 Ga0081539_101208202 202
133 3300006931 Ga0097620_100890561 Ga0097620_1008905612 202
134 3300009177 Ga0105248_10014430 Ga0105248_100144302 202
135 3300013297 Ga0157378_10005153 Ga0157378_1000515310 202
136 3300013297 Ga0157378_10162612 Ga0157378_101626122 202
137 3300013306 Ga0163162_10000086 Ga0163162_1000008662 202
138 3300013308 Ga0157375_10000115 Ga0157375_1000011516 202
139 3300013308 Ga0157375_11142551 Ga0157375_111425511 202
140 3300014969 Ga0157376_10001060 Ga0157376_1000106016 202
141 3300025923 Ga0207681_10231658 Ga0207681_102316582 202
142 3300025972 Ga0207668_10011982 Ga0207668_100119825 202
143 3300025986 Ga0207658_10452266 Ga0207658_104522662 202
144 3300026088 Ga0207641_10080565 Ga0207641_100805652 202
145 3300026089 Ga0207648_10016945 Ga0207648_100169456 202
146 3300026118 Ga0207675_100044754 Ga0207675_1000447543 202
147 3300026142 Ga0207698_10267478 Ga0207698_102674782 202
148 3300028380 Ga0268265_10337878 Ga0268265_103378782 202
149 3300005290 Ga0065712_10176682 Ga0065712_101766822 203
150 3300005328 Ga0070676_10098844 Ga0070676_100988442 203
151 3300005328 Ga0070676_10392458 Ga0070676_103924581 203
152 3300005329 Ga0070683_100000468 Ga0070683_10000046824 203
153 3300005330 Ga0070690_100033160 Ga0070690_1000331603 203
154 3300005330 Ga0070690_100249207 Ga0070690_1002492072 203
155 3300005331 Ga0070670_100036127 Ga0070670_1000361274 203
156 3300005334 Ga0068869_100063232 Ga0068869_1000632324 203
157 3300005334 Ga0068869_100202886 Ga0068869_1002028862 203
158 3300005334 Ga0068869_100516891 Ga0068869_1005168912 203
159 3300005335 Ga0070666_10004991 Ga0070666_100049917 203
160 3300005337 Ga0070682_100112306 Ga0070682_1001123062 203
161 3300005338 Ga0068868_100078150 Ga0068868_1000781501 203
162 3300005340 Ga0070689_100008276 Ga0070689_1000082762 203
163 3300005340 Ga0070689_100050112 Ga0070689_1000501123 203
164 3300005343 Ga0070687_100554803 Ga0070687_1005548032 203
165 3300005344 Ga0070661_100000179 Ga0070661_10000017949 203
166 3300005344 Ga0070661_100034574 Ga0070661_1000345743 203
167 3300005344 Ga0070661_100041203 Ga0070661_1000412032 203
168 3300005344 Ga0070661_100662587 Ga0070661_1006625871 203
169 3300005347 Ga0070668_100159046 Ga0070668_1001590462 203
170 3300005353 Ga0070669_100031325 Ga0070669_1000313253 203
171 3300005353 Ga0070669_100080917 Ga0070669_1000809172 203
172 3300005354 Ga0070675_100174024 Ga0070675_1001740242 203
173 3300005355 Ga0070671_100015772 Ga0070671_1000157727 203
174 3300005355 Ga0070671_101024903 Ga0070671_1010249031 203
175 3300005365 Ga0070688_100703388 Ga0070688_1007033881 203
176 3300005456 Ga0070678_100004697 Ga0070678_1000046973 203
177 3300005457 Ga0070662_100005910 Ga0070662_1000059106 203
178 3300005457 Ga0070662_100049525 Ga0070662_1000495253 203
179 3300005458 Ga0070681_10613839 Ga0070681_106138392 203
180 3300005459 Ga0068867_100379898 Ga0068867_1003798982 203
181 3300005466 Ga0070685_10007192 Ga0070685_100071927 203
182 3300005466 Ga0070685_10169882 Ga0070685_101698822 203
183 3300005535 Ga0070684_100000484 Ga0070684_1000004842 203
184 3300005535 Ga0070684_100022853 Ga0070684_1000228534 203
185 3300005539 Ga0068853_100015211 Ga0068853_1000152113 203
186 3300005539 Ga0068853_100022828 Ga0068853_1000228283 203
187 3300005545 Ga0070695_100811801 Ga0070695_1008118011 203
188 3300005547 Ga0070693_100211657 Ga0070693_1002116572 203
189 3300005548 Ga0070665_100079455 Ga0070665_1000794553 203
190 3300005564 Ga0070664_100000140 Ga0070664_10000014034 203
191 3300005564 Ga0070664_100054130 Ga0070664_1000541302 203
192 3300005564 Ga0070664_100258862 Ga0070664_1002588623 203
193 3300005564 Ga0070664_100262348 Ga0070664_1002623483 203
194 3300005564 Ga0070664_100766894 Ga0070664_1007668942 203
195 3300005577 Ga0068857_100007728 Ga0068857_1000077288 203
196 3300005578 Ga0068854_100011485 Ga0068854_1000114856 203
197 3300005615 Ga0070702_100656985 Ga0070702_1006569851 203
198 3300005616 Ga0068852_100127957 Ga0068852_1001279573 203
199 3300005616 Ga0068852_100379175 Ga0068852_1003791752 203
200 3300005617 Ga0068859_100005939 Ga0068859_1000059399 203
201 3300005617 Ga0068859_100100050 Ga0068859_1001000503 203
202 3300005617 Ga0068859_100201899 Ga0068859_1002018992 203
203 3300005617 Ga0068859_100359325 Ga0068859_1003593252 203
204 3300005617 Ga0068859_100525270 Ga0068859_1005252702 203
205 3300005618 Ga0068864_100061031 Ga0068864_1000610313 203
206 3300005618 Ga0068864_100232845 Ga0068864_1002328452 203
207 3300005718 Ga0068866_10008725 Ga0068866_100087253 203
208 3300005719 Ga0068861_100585690 Ga0068861_1005856902 203
209 3300005840 Ga0068870_10093933 Ga0068870_100939332 203
210 3300005841 Ga0068863_100097940 Ga0068863_1000979402 203
211 3300005841 Ga0068863_100251431 Ga0068863_1002514312 203
212 3300005841 Ga0068863_100262047 Ga0068863_1002620472 203
213 3300005841 Ga0068863_100304587 Ga0068863_1003045872 203
214 3300005841 Ga0068863_100341681 Ga0068863_1003416812 203
215 3300005842 Ga0068858_100576703 Ga0068858_1005767032 203
216 3300005842 Ga0068858_100976986 Ga0068858_1009769861 203
217 3300005843 Ga0068860_100096965 Ga0068860_1000969651 203
218 3300005843 Ga0068860_100222848 Ga0068860_1002228483 203
219 3300005843 Ga0068860_101132810 Ga0068860_1011328101 203
220 3300006163 Ga0070715_10041252 Ga0070715_100412522 203
221 3300006237 Ga0097621_100011491 Ga0097621_1000114918 203
222 3300006237 Ga0097621_100152109 Ga0097621_1001521092 203
223 3300006237 Ga0097621_100528948 Ga0097621_1005289481 203
224 3300006358 Ga0068871_100011269 Ga0068871_1000112695 203
225 3300006358 Ga0068871_100019364 Ga0068871_1000193644 203
226 3300006871 Ga0075434_100085548 Ga0075434_1000855483 203
227 3300006871 Ga0075434_100439577 Ga0075434_1004395772 203
228 3300006881 Ga0068865_100189750 Ga0068865_1001897502 203
229 3300006881 Ga0068865_100440266 Ga0068865_1004402661 203
230 3300006931 Ga0097620_100005939 Ga0097620_1000059399 203
231 3300006931 Ga0097620_100100047 Ga0097620_1001000473 203
232 3300006931 Ga0097620_100201902 Ga0097620_1002019022 203
233 3300006931 Ga0097620_100359307 Ga0097620_1003593072 203
234 3300006931 Ga0097620_100525293 Ga0097620_1005252932 203
235 3300009011 Ga0105251_10109895 Ga0105251_101098952 203
236 3300009093 Ga0105240_10356633 Ga0105240_103566331 203
237 3300009101 Ga0105247_10008390 Ga0105247_100083903 203
238 3300009174 Ga0105241_10474408 Ga0105241_104744082 203
239 3300009176 Ga0105242_10186413 Ga0105242_101864132 203
240 3300009553 Ga0105249_10009062 Ga0105249_100090623 203
241 3300009553 Ga0105249_10038553 Ga0105249_100385535 203
242 3300009553 Ga0105249_10078816 Ga0105249_100788162 203
243 3300009553 Ga0105249_10245322 Ga0105249_102453222 203
244 3300010375 Ga0105239_10247625 Ga0105239_102476252 203
245 3300013100 Ga0157373_10053938 Ga0157373_100539384 203
246 3300013296 Ga0157374_10000237 Ga0157374_1000023720 203
247 3300013296 Ga0157374_10006341 Ga0157374_1000634111 203
248 3300013296 Ga0157374_10098966 Ga0157374_100989661 203
249 3300013306 Ga0163162_10006217 Ga0163162_100062178 203
250 3300013306 Ga0163162_10264187 Ga0163162_102641872 203
251 3300013307 Ga0157372_10072477 Ga0157372_100724772 203
252 3300013307 Ga0157372_11764210 Ga0157372_117642101 203
253 3300013308 Ga0157375_10079604 Ga0157375_100796042 203
254 3300013308 Ga0157375_10603737 Ga0157375_106037372 203
255 3300013308 Ga0157375_10634183 Ga0157375_106341832 203
256 3300014325 Ga0163163_10000088 Ga0163163_1000008855 203
257 3300014325 Ga0163163_10000244 Ga0163163_1000024417 203
258 3300014325 Ga0163163_10056245 Ga0163163_100562452 203
259 3300014326 Ga0157380_10131722 Ga0157380_101317223 203
260 3300014745 Ga0157377_10009383 Ga0157377_100093832 203
261 3300014745 Ga0157377_10089787 Ga0157377_100897873 203
262 3300014745 Ga0157377_10174719 Ga0157377_101747192 203
263 3300014968 Ga0157379_10050431 Ga0157379_100504314 203
264 3300014969 Ga0157376_10073355 Ga0157376_100733553 203
265 3300014969 Ga0157376_10317978 Ga0157376_103179782 203
266 3300014969 Ga0157376_10526578 Ga0157376_105265782 203
267 3300014969 Ga0157376_10604161 Ga0157376_106041611 203
268 3300017792 Ga0163161_10002796 Ga0163161_1000279612 203
269 3300017792 Ga0163161_10027138 Ga0163161_100271384 203
270 3300025899 Ga0207642_10028662 Ga0207642_100286622 203
271 3300025900 Ga0207710_10010630 Ga0207710_100106302 203
272 3300025903 Ga0207680_10009247 Ga0207680_100092473 203
273 3300025903 Ga0207680_10500844 Ga0207680_105008441 203
274 3300025904 Ga0207647_10009722 Ga0207647_100097226 203
275 3300025905 Ga0207685_10006223 Ga0207685_100062232 203
276 3300025907 Ga0207645_10007658 Ga0207645_100076582 203
277 3300025912 Ga0207707_10242770 Ga0207707_102427701 203
278 3300025920 Ga0207649_10000419 Ga0207649_1000041924 203
279 3300025920 Ga0207649_10042112 Ga0207649_100421123 203
280 3300025923 Ga0207681_10184535 Ga0207681_101845352 203
281 3300025925 Ga0207650_10020700 Ga0207650_100207003 203
282 3300025926 Ga0207659_10113269 Ga0207659_101132692 203
283 3300025931 Ga0207644_10327169 Ga0207644_103271692 203
284 3300025932 Ga0207690_10026064 Ga0207690_100260644 203
285 3300025933 Ga0207706_10002103 Ga0207706_100021035 203
286 3300025933 Ga0207706_10018001 Ga0207706_100180012 203
287 3300025933 Ga0207706_10084464 Ga0207706_100844643 203
288 3300025933 Ga0207706_10118453 Ga0207706_101184533 203
289 3300025936 Ga0207670_10003257 Ga0207670_1000325710 203
290 3300025936 Ga0207670_10061124 Ga0207670_100611242 203
291 3300025938 Ga0207704_10128813 Ga0207704_101288132 203
292 3300025938 Ga0207704_10177265 Ga0207704_101772652 203
293 3300025938 Ga0207704_10407915 Ga0207704_104079151 203
294 3300025940 Ga0207691_10011435 Ga0207691_100114354 203
295 3300025941 Ga0207711_10070479 Ga0207711_100704793 203
296 3300025942 Ga0207689_10021058 Ga0207689_100210582 203
297 3300025942 Ga0207689_10167225 Ga0207689_101672252 203
298 3300025944 Ga0207661_10000370 Ga0207661_100003709 203
299 3300025944 Ga0207661_10331612 Ga0207661_103316121 203
300 3300025945 Ga0207679_10000266 Ga0207679_1000026613 203
301 3300025945 Ga0207679_10163117 Ga0207679_101631172 203
302 3300025945 Ga0207679_10265879 Ga0207679_102658792 203
303 3300025945 Ga0207679_10356536 Ga0207679_103565362 203
304 3300025945 Ga0207679_10571150 Ga0207679_105711501 203
305 3300025960 Ga0207651_10500552 Ga0207651_105005522 203
306 3300025961 Ga0207712_10043764 Ga0207712_100437643 203
307 3300025961 Ga0207712_10052431 Ga0207712_100524313 203
308 3300025961 Ga0207712_10057462 Ga0207712_100574623 203
309 3300025981 Ga0207640_10021342 Ga0207640_100213422 203
310 3300025986 Ga0207658_10154632 Ga0207658_101546322 203
311 3300025986 Ga0207658_10407432 Ga0207658_104074321 203
312 3300025986 Ga0207658_10478351 Ga0207658_104783512 203
313 3300026023 Ga0207677_10080790 Ga0207677_100807903 203
314 3300026023 Ga0207677_10285222 Ga0207677_102852221 203
315 3300026035 Ga0207703_10311119 Ga0207703_103111192 203
316 3300026035 Ga0207703_10405070 Ga0207703_104050702 203
317 3300026035 Ga0207703_10568143 Ga0207703_105681432 203
318 3300026041 Ga0207639_10012815 Ga0207639_100128154 203
319 3300026041 Ga0207639_10082339 Ga0207639_100823392 203
320 3300026067 Ga0207678_10090917 Ga0207678_100909173 203
321 3300026088 Ga0207641_10037835 Ga0207641_100378355 203
322 3300026088 Ga0207641_10107035 Ga0207641_101070352 203
323 3300026088 Ga0207641_10441283 Ga0207641_104412832 203
324 3300026088 Ga0207641_10625585 Ga0207641_106255852 203
325 3300026089 Ga0207648_10146511 Ga0207648_101465113 203
326 3300026089 Ga0207648_10304460 Ga0207648_103044602 203
327 3300026089 Ga0207648_10556120 Ga0207648_105561202 203
328 3300026095 Ga0207676_10019254 Ga0207676_100192542 203
329 3300026095 Ga0207676_10038829 Ga0207676_100388294 203
330 3300026095 Ga0207676_10192267 Ga0207676_101922672 203
331 3300026116 Ga0207674_10007803 Ga0207674_1000780311 203
332 3300026116 Ga0207674_10321322 Ga0207674_103213222 203
333 3300026118 Ga0207675_100161846 Ga0207675_1001618462 203
334 3300026118 Ga0207675_100237361 Ga0207675_1002373612 203
335 3300026121 Ga0207683_10010220 Ga0207683_100102208 203
336 3300026121 Ga0207683_10031651 Ga0207683_100316514 203
337 3300026142 Ga0207698_10048581 Ga0207698_100485814 203
338 3300026142 Ga0207698_10070251 Ga0207698_100702513 203
339 3300028381 Ga0268264_10146150 Ga0268264_101461502 203
340 3300028381 Ga0268264_10972371 Ga0268264_109723712 203
341 3300028794 Ga0307515_10000010 Ga0307515_10000010126 203
342 3300031250 Ga0265331_10075079 Ga0265331_100750792 203
343 3300031251 Ga0265327_10000219 Ga0265327_1000021980 203
344 3300035086 Ga0373934_0082751 Ga0373934_0082751_412_1023 203
345 3300035410 Ga0373924_0006769 Ga0373924_0006769_1658_2269 203
346 3300035724 Ga0373933_0012397 Ga0373933_0012397_4039_4650 203
347 3300036401 Ga0373937_0002104 Ga0373937_0002104_12704_13315 203
348 3300041512 Ga0451853_1577816 Ga0451853_1577816_102_713 203
349 3300046454 Ga0495592_0026380 Ga0495592_0026380_1017_1628 203
350 3300046463 Ga0495653_0043228 Ga0495653_0043228_2187_2798 203
351 3300046517 Ga0495630_0003153 Ga0495630_0003153_6245_6856 203
352 3300046536 Ga0495587_0062204 Ga0495587_0062204_1075_1686 203
353 3300046537 Ga0495598_0103538 Ga0495598_0103538_189_833 203
354 3300046642 Ga0495634_0019397 Ga0495634_0019397_176_787 203
355 3300046663 Ga0495635_0255719 Ga0495635_0255719_386_997 203
356 3300046680 Ga0495646_0188611 Ga0495646_0188611_152_763 203
357 3300046689 Ga0495613_0118295 Ga0495613_0118295_191_802 203
358 3300048907 Ga0496104_0686662 Ga0496104_0686662_14_625 203
359 3300048914 Ga0496111_0089780 Ga0496111_0089780_1040_1651 203
360 3300048914 Ga0496111_0686191 Ga0496111_0686191_80_691 203
361 3300050512 nmdc:mga0n895_317322_c1 nmdc:mga0n895_317322_c1_507_1118 203

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e85-assembly2.cif.gz_B-2 snoal-like domain-containing protein 0.7289 77 109
3d44-assembly1.cif.gz_A crystal structure of heptp in complex with a dually phosphorylated erk2 peptide mimetic 0.5211 67 106
2hvl-assembly1.cif.gz_A crystal structure of the heptp catalytic domain c270s mutant 0.497 67 125
3d42-assembly1.cif.gz_A crystal structure of heptp in complex with a monophosphorylated erk2 peptide 0.4965 67 125
1zc0-assembly1.cif.gz_A crystal structure of human hematopoietic tyrosine phosphatase (heptp) catalytic domain 0.4939 70 125
ID Description Score Start End Superfamily
af_Q9M3D0_8_304_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7425 62 82 3.40.50.1820
af_Q9LID1_55_196_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.638 64 97 2.120.10.80
af_M0R781_602_862_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.636 62 90 3.40.50.1820
af_Q6WIZ7_394_805_2.70.98.20 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5;Copper amine oxidase, catalytic domain 0.6012 64 111 2.70.98.20
af_P49134_639_725_4.10.1240.30 Few Secondary Structures;Irregular;Hormone receptor fold; 0.5791 51 81 4.10.1240.30
ID Description Score Start End GO Terms
AF-A0A537KQZ0-F1-model_v4 Uncharacterized protein 0.9784 1 203
AF-A0A537KQZ0-F1-model_v4 Uncharacterized protein 0.9736 1 203
AF-A0A537IFL4-F1-model_v4 Uncharacterized protein 0.9603 1 202
AF-A0A522DR60-F1-model_v4 Uncharacterized protein 0.96 7 203
AF-A0A431MQS3-F1-model_v4 Uncharacterized protein 0.9597 6 199

Feature Viewer

pLDDT pTM Quality
92.27 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map