F422005
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 360 | 270 | 258 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300049572|Ga0501036_0016280|Ga0501036_0016280_4849_5769 |
| Length | 306 |
| Sequence | MGETIFGMWRANAGQAVGMNGGRASLCPPCAHYHTIRILAAASIPSWCGEAIVPNEDRSPRLAVLIDADNASAKIADGLFEEIAKIGEASVRRIYGDFSNPRSKAWTDTLSKHAIIPQQQFAYTTGKNASDITLVIDAMDLLHSGRFDGFCLVSSDSDFTRLAARIREQGVDVFGFGEQKTPESFRQACRRFVYTENLLSGVANSHDDVSSRKSLQPPSAAVPIVKKVIAQIESEDGWVPLGQVGTQLANLTSDFDPRNFGFRKLSDLIRKTSAFDIEHRPGQAMRIRVKAAAPLRPRADKKPERQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 2 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 5 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 6 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 7 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 8 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 9 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 10 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 11 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 12 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 13 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 14 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 15 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 16 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 17 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 18 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 19 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 20 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 21 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 22 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 23 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 24 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 25 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 26 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 27 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 28 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 29 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 30 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 31 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 32 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 33 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 34 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 35 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 36 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 37 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 38 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 39 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 40 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 41 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 42 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 43 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 44 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 45 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 46 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 47 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 48 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 49 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 50 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 51 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 52 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 53 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 54 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 55 | 2904699407 | |||
| 56 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 57 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 58 | 2906610324 | |||
| 59 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 60 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 61 | 2922425934 | |||
| 62 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 63 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 64 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 65 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 66 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 67 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 68 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 69 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 70 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 71 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 72 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 73 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 74 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 75 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 76 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 77 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 78 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 79 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 80 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 81 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 82 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 83 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 84 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 85 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 86 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 87 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 88 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 89 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 90 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 91 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 92 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 93 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 94 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 95 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 96 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 97 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 98 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 99 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 100 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 101 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 102 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 103 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 104 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 105 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 106 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 108 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 110 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 117 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 119 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 121 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 123 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 124 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 125 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 126 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 127 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 128 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 129 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 130 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 131 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 132 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 133 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 134 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 135 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 136 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 137 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 138 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 139 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 140 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 141 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 143 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 144 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 153 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 154 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 161 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 200 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 208 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 209 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 210 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 211 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 219 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 223 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 224 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 225 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 226 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 256 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 257 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 258 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 259 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 260 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 261 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 262 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 263 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 264 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 265 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 266 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 267 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 268 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 269 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 270 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.27 |
| Metatranscriptomes | 0 |
| Isolates | 27.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.72 |
| Nodule | 21.39 |
| Rhizoplane | 1.94 |
| Rhizosphere | 52.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1000175 | 3300002987 | Bacteria | 29637 |
| 2 | JGI25151J46595_10000373 | 3300003187 | Bacteria | 46885 |
| 3 | JGI25151J46595_10001163 | 3300003187 | Bacteria | 18979 |
| 4 | JGI25165J46597_1000041 | 3300003214 | Bacteria | 272566 |
| 5 | JGI25153J46596_10003023 | 3300003215 | Bacteria | 9516 |
| 6 | JGI25160J50197_1000365 | 3300003354 | Bacteria | 29637 |
| 7 | JGI25160J50197_1039406 | 3300003354 | Bacteria | 1106 |
| 8 | JGI25161J50226_1000280 | 3300003374 | Bacteria | 29331 |
| 9 | Ga0055526_1001092 | 3300003771 | Bacteria | 19774 |
| 10 | Ga0055526_1009369 | 3300003771 | Bacteria | 4720 |
| 11 | Ga0055526_1013021 | 3300003771 | Bacteria | 3560 |
| 12 | Ga0055524_1008274 | 3300003775 | Bacteria | 4333 |
| 13 | Ga0055524_1022021 | 3300003775 | Bacteria | 2094 |
| 14 | Ga0055536_1009544 | 3300003781 | Bacteria | 3993 |
| 15 | Ga0055528_1000638 | 3300003790 | Bacteria | 25688 |
| 16 | Ga0055528_1005587 | 3300003790 | Bacteria | 5819 |
| 17 | Ga0055530_10021428 | 3300003791 | Bacteria | 1905 |
| 18 | Ga0055531_10011368 | 3300003794 | Bacteria | 4303 |
| 19 | Ga0055543_1000372 | 3300004625 | Bacteria | 29554 |
| 20 | Ga0065165_1001221 | 3300005262 | Bacteria | 29554 |
| 21 | Ga0070670_100366761 | 3300005331 | Bacteria | 1267 |
| 22 | Ga0068869_100056720 | 3300005334 | Bacteria | 2857 |
| 23 | Ga0070680_100076235 | 3300005336 | Bacteria | 2760 |
| 24 | Ga0068868_100373557 | 3300005338 | Bacteria | 1225 |
| 25 | Ga0070660_100173860 | 3300005339 | Bacteria | 1741 |
| 26 | Ga0070661_100006990 | 3300005344 | Bacteria | 7789 |
| 27 | Ga0070661_100085961 | 3300005344 | Bacteria | 2325 |
| 28 | Ga0070668_100120499 | 3300005347 | Bacteria | 2096 |
| 29 | Ga0070668_100147561 | 3300005347 | Bacteria | 1899 |
| 30 | Ga0070669_100258573 | 3300005353 | Bacteria | 1389 |
| 31 | Ga0070671_100056896 | 3300005355 | Bacteria | 3254 |
| 32 | Ga0070663_100138787 | 3300005455 | Bacteria | 1853 |
| 33 | Ga0070681_10025743 | 3300005458 | Bacteria | 5915 |
| 34 | Ga0070698_100460374 | 3300005471 | Bacteria | 1208 |
| 35 | Ga0070679_100058603 | 3300005530 | Bacteria | 3837 |
| 36 | Ga0070679_100191857 | 3300005530 | Bacteria | 2012 |
| 37 | Ga0070697_100145997 | 3300005536 | Bacteria | 1991 |
| 38 | Ga0068853_100003239 | 3300005539 | Bacteria | 12442 |
| 39 | Ga0068853_100030185 | 3300005539 | Bacteria | 4578 |
| 40 | Ga0068853_100155546 | 3300005539 | Bacteria | 2060 |
| 41 | Ga0070665_100351507 | 3300005548 | Bacteria | 1479 |
| 42 | Ga0068855_100492197 | 3300005563 | Bacteria | 1334 |
| 43 | Ga0068857_100011976 | 3300005577 | Bacteria | 7544 |
| 44 | Ga0068854_100358906 | 3300005578 | Bacteria | 1195 |
| 45 | Ga0068856_100143004 | 3300005614 | Bacteria | 2399 |
| 46 | Ga0068852_100293557 | 3300005616 | Bacteria | 1571 |
| 47 | Ga0068851_10046841 | 3300005834 | Bacteria | 2188 |
| 48 | Ga0068863_100003503 | 3300005841 | Bacteria | 15483 |
| 49 | Ga0068860_100001008 | 3300005843 | Bacteria | 31179 |
| 50 | Ga0068862_100000163 | 3300005844 | Bacteria | 74506 |
| 51 | Ga0081455_10049130 | 3300005937 | Bacteria | 3639 |
| 52 | Ga0081540_1006315 | 3300005983 | Bacteria | 8664 |
| 53 | Ga0081539_10001801 | 3300005985 | Bacteria | 33917 |
| 54 | Ga0075365_10001463 | 3300006038 | Bacteria | 10723 |
| 55 | Ga0075368_10000287 | 3300006042 | Bacteria | 14467 |
| 56 | Ga0075363_100000904 | 3300006048 | Bacteria | 10461 |
| 57 | Ga0075364_10011297 | 3300006051 | Bacteria | 5423 |
| 58 | Ga0075364_10197761 | 3300006051 | Bacteria | 1362 |
| 59 | Ga0075362_10001875 | 3300006177 | Bacteria | 6889 |
| 60 | Ga0075367_10000871 | 3300006178 | Bacteria | 12080 |
| 61 | Ga0075369_10002398 | 3300006186 | Bacteria | 6681 |
| 62 | Ga0097621_100602994 | 3300006237 | Bacteria | 1004 |
| 63 | Ga0068871_100700658 | 3300006358 | Bacteria | 928 |
| 64 | Ga0075434_100122890 | 3300006871 | Bacteria | 2612 |
| 65 | Ga0097620_100179476 | 3300006931 | Bacteria | 2200 |
| 66 | Ga0105251_10031302 | 3300009011 | Bacteria | 2663 |
| 67 | Ga0105250_10040418 | 3300009092 | Bacteria | 1871 |
| 68 | Ga0105240_10011604 | 3300009093 | Bacteria | 12258 |
| 69 | Ga0105240_10587441 | 3300009093 | Bacteria | 1228 |
| 70 | Ga0111539_10480277 | 3300009094 | Bacteria | 1447 |
| 71 | Ga0105247_10020612 | 3300009101 | Bacteria | 3963 |
| 72 | Ga0105247_10243393 | 3300009101 | Bacteria | 1226 |
| 73 | Ga0105238_10020477 | 3300009551 | Bacteria | 6734 |
| 74 | Ga0105238_10052222 | 3300009551 | Bacteria | 4110 |
| 75 | Ga0105249_10000067 | 3300009553 | Bacteria | 149492 |
| 76 | Ga0105249_10211897 | 3300009553 | Bacteria | 1902 |
| 77 | Ga0105148_100139 | 3300009978 | Bacteria | 10762 |
| 78 | Ga0099796_10102566 | 3300010159 | Bacteria | 1078 |
| 79 | Ga0105239_10003590 | 3300010375 | Bacteria | 18946 |
| 80 | Ga0105239_10037776 | 3300010375 | Bacteria | 5292 |
| 81 | Ga0105239_10045181 | 3300010375 | Bacteria | 4827 |
| 82 | Ga0157370_10203875 | 3300013104 | Bacteria | 1834 |
| 83 | Ga0157369_10010432 | 3300013105 | Bacteria | 10587 |
| 84 | Ga0157378_10559866 | 3300013297 | Bacteria | 1150 |
| 85 | Ga0163162_10169418 | 3300013306 | Bacteria | 2308 |
| 86 | Ga0163162_10472758 | 3300013306 | Bacteria | 1385 |
| 87 | Ga0157380_10465176 | 3300014326 | Bacteria | 1219 |
| 88 | Ga0182008_10128163 | 3300014497 | Bacteria | 1264 |
| 89 | Ga0209436_100259 | 3300025208 | Bacteria | 24235 |
| 90 | Ga0209437_108954 | 3300025233 | Unclassified | 1580 |
| 91 | Ga0207425_1003523 | 3300025245 | Bacteria | 4978 |
| 92 | Ga0209129_1004554 | 3300025258 | Bacteria | 5348 |
| 93 | Ga0209233_1000104 | 3300025261 | Bacteria | 272675 |
| 94 | Ga0209455_1001350 | 3300025272 | Bacteria | 11283 |
| 95 | Ga0209673_1000022 | 3300025273 | Bacteria | 413125 |
| 96 | Ga0209130_1000598 | 3300025284 | Bacteria | 34961 |
| 97 | Ga0209676_1005905 | 3300025292 | Bacteria | 6214 |
| 98 | Ga0209025_1000969 | 3300025294 | Bacteria | 43045 |
| 99 | Ga0209025_1002488 | 3300025294 | Bacteria | 19372 |
| 100 | Ga0209564_1000163 | 3300025295 | Bacteria | 162077 |
| 101 | Ga0209564_1000692 | 3300025295 | Bacteria | 49341 |
| 102 | Ga0209758_1002375 | 3300025297 | Bacteria | 19372 |
| 103 | Ga0209050_1006124 | 3300025298 | Bacteria | 7256 |
| 104 | Ga0209256_1001225 | 3300025299 | Bacteria | 28613 |
| 105 | Ga0209256_1001398 | 3300025299 | Bacteria | 25156 |
| 106 | Ga0207426_1000779 | 3300025302 | Bacteria | 34961 |
| 107 | Ga0207656_10040155 | 3300025321 | Bacteria | 1983 |
| 108 | Ga0207710_10012667 | 3300025900 | Bacteria | 3548 |
| 109 | Ga0207710_10092693 | 3300025900 | Bacteria | 1416 |
| 110 | Ga0207684_10085628 | 3300025910 | Bacteria | 2684 |
| 111 | Ga0207654_10077086 | 3300025911 | Bacteria | 1997 |
| 112 | Ga0207707_10087741 | 3300025912 | Bacteria | 2718 |
| 113 | Ga0207695_10186869 | 3300025913 | Bacteria | 1991 |
| 114 | Ga0207657_10142946 | 3300025919 | Bacteria | 1954 |
| 115 | Ga0207694_10099842 | 3300025924 | Bacteria | 2299 |
| 116 | Ga0207679_10213491 | 3300025945 | Bacteria | 1620 |
| 117 | Ga0207667_10307309 | 3300025949 | Bacteria | 1620 |
| 118 | Ga0207667_10392594 | 3300025949 | Bacteria | 1413 |
| 119 | Ga0207712_10000054 | 3300025961 | Bacteria | 148878 |
| 120 | Ga0207712_10009711 | 3300025961 | Bacteria | 6098 |
| 121 | Ga0207668_10127424 | 3300025972 | Bacteria | 1938 |
| 122 | Ga0207640_10273330 | 3300025981 | Bacteria | 1323 |
| 123 | Ga0207639_10011470 | 3300026041 | Bacteria | 6157 |
| 124 | Ga0207678_10100384 | 3300026067 | Bacteria | 2472 |
| 125 | Ga0207641_10008688 | 3300026088 | Bacteria | 8388 |
| 126 | Ga0207674_10007240 | 3300026116 | Bacteria | 12947 |
| 127 | Ga0207698_10291189 | 3300026142 | Bacteria | 1515 |
| 128 | Ga0209813_10000027 | 3300027866 | Bacteria | 69637 |
| 129 | Ga0268266_10307920 | 3300028379 | Bacteria | 1479 |
| 130 | Ga0268265_10000182 | 3300028380 | Bacteria | 74651 |
| 131 | Ga0268264_10003017 | 3300028381 | Bacteria | 14599 |
| 132 | Ga0268264_10750260 | 3300028381 | Bacteria | 972 |
| 133 | Ga0307515_10355730 | 3300028794 | Bacteria | 1108 |
| 134 | Ga0307509_10172726 | 3300031507 | Bacteria | 2038 |
| 135 | Ga0307508_10000090 | 3300031616 | Bacteria | 106893 |
| 136 | Ga0307508_10265721 | 3300031616 | Bacteria | 1310 |
| 137 | Ga0373955_0062225 | 3300035172 | Bacteria | 2064 |
| 138 | Ga0373925_0165807 | 3300037068 | Bacteria | 1742 |
| 139 | Ga0395900_0010066 | 3300037418 | Bacteria | 9672 |
| 140 | Ga0395898_0371066 | 3300037466 | Bacteria | 1365 |
| 141 | Ga0395905_0346203 | 3300037471 | Bacteria | 1378 |
| 142 | Ga0395901_0046355 | 3300038443 | Bacteria | 4515 |
| 143 | Ga0395901_0079329 | 3300038443 | Bacteria | 3428 |
| 144 | Ga0436360_0803520 | 3300039438 | Bacteria | 1160 |
| 145 | Ga0436360_0860069 | 3300039438 | Bacteria | 1339 |
| 146 | Ga0436360_1211757 | 3300039438 | Bacteria | 1086 |
| 147 | Ga0451791_1426729 | 3300041451 | Bacteria | 987 |
| 148 | Ga0439448_0102717 | 3300042005 | Bacteria | 973 |
| 149 | Ga0439435_0000469 | 3300042436 | Bacteria | 6391 |
| 150 | Ga0495592_0217058 | 3300046454 | Bacteria | 1281 |
| 151 | Ga0495629_0199232 | 3300046459 | Bacteria | 1385 |
| 152 | Ga0495629_0245793 | 3300046459 | Bacteria | 1232 |
| 153 | Ga0495638_0009959 | 3300046460 | Bacteria | 6627 |
| 154 | Ga0495638_0060940 | 3300046460 | Bacteria | 2332 |
| 155 | Ga0495639_0221740 | 3300046475 | Bacteria | 930 |
| 156 | Ga0495648_0114698 | 3300046524 | Bacteria | 1459 |
| 157 | Ga0495668_0075078 | 3300046616 | Bacteria | 1857 |
| 158 | Ga0496102_0563229 | 3300048905 | Bacteria | 1062 |
| 159 | Ga0496103_0109638 | 3300048906 | Bacteria | 1753 |
| 160 | Ga0496107_0034512 | 3300048910 | Bacteria | 3624 |
| 161 | Ga0496109_0100483 | 3300048912 | Bacteria | 2684 |
| 162 | Ga0496113_0549743 | 3300048916 | Bacteria | 926 |
| 163 | Ga0496121_0165241 | 3300048924 | Bacteria | 1614 |
| 164 | Ga0496121_0235864 | 3300048924 | Bacteria | 1278 |
| 165 | Ga0496124_0319439 | 3300048927 | Bacteria | 1112 |
| 166 | Ga0496125_0086478 | 3300048928 | Bacteria | 2371 |
| 167 | Ga0496126_0019907 | 3300048929 | Bacteria | 6597 |
| 168 | Ga0496126_0390011 | 3300048929 | Bacteria | 1132 |
| 169 | Ga0501031_0000036 | 3300049568 | Bacteria | 73760 |
| 170 | Ga0501031_0000068 | 3300049568 | Bacteria | 56283 |
| 171 | Ga0501031_0023006 | 3300049568 | Bacteria | 4064 |
| 172 | Ga0501032_0000100 | 3300049569 | Bacteria | 73505 |
| 173 | Ga0501032_0000103 | 3300049569 | Bacteria | 72143 |
| 174 | Ga0501032_0004376 | 3300049569 | Bacteria | 10655 |
| 175 | Ga0501032_0095544 | 3300049569 | Bacteria | 1970 |
| 176 | Ga0501032_0308402 | 3300049569 | Bacteria | 1022 |
| 177 | Ga0501033_0000088 | 3300049570 | Bacteria | 87638 |
| 178 | Ga0501033_0000778 | 3300049570 | Bacteria | 29323 |
| 179 | Ga0501033_0003728 | 3300049570 | Bacteria | 12395 |
| 180 | Ga0501033_0009764 | 3300049570 | Bacteria | 7372 |
| 181 | Ga0501033_0075297 | 3300049570 | Bacteria | 2477 |
| 182 | Ga0501034_0000365 | 3300049571 | Bacteria | 77224 |
| 183 | Ga0501034_0000397 | 3300049571 | Bacteria | 73511 |
| 184 | Ga0501034_0004282 | 3300049571 | Bacteria | 15914 |
| 185 | Ga0501034_0005317 | 3300049571 | Bacteria | 14111 |
| 186 | Ga0501034_0039512 | 3300049571 | Bacteria | 4779 |
| 187 | Ga0501034_0158801 | 3300049571 | Bacteria | 2233 |
| 188 | Ga0501036_0000056 | 3300049572 | Bacteria | 73511 |
| 189 | Ga0501036_0000058 | 3300049572 | Bacteria | 72516 |
| 190 | Ga0501036_0000544 | 3300049572 | Bacteria | 27031 |
| 191 | Ga0501036_0016280 | 3300049572 | Bacteria | 6211 |
| 192 | Ga0501036_0031967 | 3300049572 | Bacteria | 4447 |
| 193 | Ga0501037_0000119 | 3300049573 | Bacteria | 73510 |
| 194 | Ga0501037_0000157 | 3300049573 | Bacteria | 63800 |
| 195 | Ga0501037_0007051 | 3300049573 | Bacteria | 8208 |
| 196 | Ga0501037_0136455 | 3300049573 | Bacteria | 1757 |
| 197 | Ga0501037_0218352 | 3300049573 | Bacteria | 1342 |
| 198 | Ga0501038_0000091 | 3300049574 | Bacteria | 77224 |
| 199 | Ga0501038_0000098 | 3300049574 | Bacteria | 73471 |
| 200 | Ga0501038_0000837 | 3300049574 | Bacteria | 27392 |
| 201 | Ga0501038_0001470 | 3300049574 | Bacteria | 21665 |
| 202 | Ga0501038_0014937 | 3300049574 | Bacteria | 7070 |
| 203 | Ga0501038_0080716 | 3300049574 | Bacteria | 2741 |
| 204 | Ga0501039_0000013 | 3300049575 | Bacteria | 234418 |
| 205 | Ga0501039_0000071 | 3300049575 | Bacteria | 77224 |
| 206 | Ga0501039_0001124 | 3300049575 | Bacteria | 19671 |
| 207 | Ga0501040_0197695 | 3300049576 | Bacteria | 1427 |
| 208 | Ga0501041_0188180 | 3300049577 | Bacteria | 1293 |
| 209 | Ga0501042_0039549 | 3300049578 | Bacteria | 3352 |
| 210 | Ga0501043_0001191 | 3300049579 | Bacteria | 22880 |
| 211 | Ga0501043_0001914 | 3300049579 | Bacteria | 17825 |
| 212 | Ga0501043_0081327 | 3300049579 | Bacteria | 2545 |
| 213 | Ga0501043_0223913 | 3300049579 | Bacteria | 1454 |
| 214 | Ga0501046_0003472 | 3300049580 | Bacteria | 14468 |
| 215 | Ga0501046_0039551 | 3300049580 | Bacteria | 3776 |
| 216 | Ga0501046_0204670 | 3300049580 | Bacteria | 1467 |
| 217 | Ga0501047_0000797 | 3300049581 | Bacteria | 32944 |
| 218 | Ga0501047_0014437 | 3300049581 | Bacteria | 7511 |
| 219 | Ga0501047_0030775 | 3300049581 | Bacteria | 5173 |
| 220 | Ga0501047_0185821 | 3300049581 | Bacteria | 1943 |
| 221 | Ga0501048_0000925 | 3300049582 | Bacteria | 21630 |
| 222 | Ga0501048_0054840 | 3300049582 | Bacteria | 2831 |
| 223 | Ga0501068_0039477 | 3300049584 | Bacteria | 2830 |
| 224 | Ga0501070_0072704 | 3300049586 | Bacteria | 2846 |
| 225 | Ga0501070_0093675 | 3300049586 | Bacteria | 2485 |
| 226 | Ga0501070_0105549 | 3300049586 | Bacteria | 2329 |
| 227 | Ga0501073_0042427 | 3300049589 | Bacteria | 3211 |
| 228 | Ga0501073_0075193 | 3300049589 | Bacteria | 2351 |
| 229 | Ga0501073_0408823 | 3300049589 | Bacteria | 938 |
| 230 | Ga0501074_0006277 | 3300049590 | Bacteria | 8581 |
| 231 | Ga0501076_0154681 | 3300049592 | Bacteria | 1866 |
| 232 | Ga0501079_0111904 | 3300049741 | Bacteria | 2122 |
| 233 | Ga0501080_0008286 | 3300049742 | Bacteria | 9417 |
| 234 | Ga0501080_0013473 | 3300049742 | Bacteria | 7523 |
| 235 | Ga0501081_0076013 | 3300049743 | Bacteria | 2345 |
| 236 | Ga0501083_0106249 | 3300049744 | Bacteria | 1848 |
| 237 | Ga0501083_0239318 | 3300049744 | Bacteria | 1182 |
| 238 | Ga0501035_0000053 | 3300049822 | Bacteria | 142860 |
| 239 | Ga0501035_0000503 | 3300049822 | Bacteria | 44064 |
| 240 | Ga0501035_0005592 | 3300049822 | Bacteria | 11870 |
| 241 | Ga0501035_0013016 | 3300049822 | Bacteria | 7677 |
| 242 | Ga0501035_0013388 | 3300049822 | Bacteria | 7572 |
| 243 | Ga0501035_0140082 | 3300049822 | Bacteria | 2103 |
| 244 | Ga0501035_0163268 | 3300049822 | Bacteria | 1927 |
| 245 | Ga0501035_0424938 | 3300049822 | Bacteria | 1103 |
| 246 | Ga0501044_0000214 | 3300049823 | Bacteria | 73483 |
| 247 | Ga0501044_0000225 | 3300049823 | Bacteria | 71586 |
| 248 | Ga0501044_0023441 | 3300049823 | Bacteria | 6564 |
| 249 | Ga0501044_0042224 | 3300049823 | Bacteria | 4744 |
| 250 | nmdc:mga05p37_318786_c1 | 3300050507 | Bacteria | 1840 |
| 251 | nmdc:mga0n895_25121_c1 | 3300050512 | Bacteria | 5625 |
| 252 | nmdc:mga08x19_149348_c1 | 3300050514 | Bacteria | 1581 |
| 253 | Ga0500562_060411 | 3300053108 | Bacteria | 1018 |
| 254 | Ga0500559_0078423 | 3300053136 | Bacteria | 1498 |
| 255 | Ga0500622_0027369 | 3300053156 | Bacteria | 3005 |
| 256 | Ga0500636_0014831 | 3300053177 | Bacteria | 4587 |
| 257 | Ga0500645_049412 | 3300053730 | Bacteria | 1230 |
| 258 | Ga0500601_006494 | 3300053737 | Bacteria | 1288 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025949 | Ga0207667_10307309 | Ga0207667_103073092 | 205 |
| 2 | 3300046459 | Ga0495629_0199232 | Ga0495629_0199232_407_1192 | 235 |
| 3 | 3300028794 | Ga0307515_10355730 | Ga0307515_103557301 | 236 |
| 4 | iso_pu_bacteria | 2510461069 | 2510844023 | 236 |
| 5 | 3300049586 | Ga0501070_0105549 | Ga0501070_0105549_808_1551 | 237 |
| 6 | iso_pu_bacteria | 2842341865 | 2842342724 | 238 |
| 7 | iso_pu_bacteria | 2961170736 | 2961176952 | 238 |
| 8 | iso_pu_bacteria | 2970503327 | 2970509625 | 238 |
| 9 | iso_pu_bacteria | 2979808191 | 2979814412 | 238 |
| 10 | iso_pu_bacteria | 3005474847 | 3005480979 | 238 |
| 11 | iso_pu_bacteria | 2513237137 | 2513856251 | 239 |
| 12 | iso_pu_bacteria | 2513237144 | 2513912841 | 239 |
| 13 | iso_pu_bacteria | 2513237145 | 2513918154 | 239 |
| 14 | iso_pu_bacteria | 2513237146 | 2513924087 | 239 |
| 15 | iso_pu_bacteria | 2517572143 | 2517891607 | 239 |
| 16 | iso_pu_bacteria | 2524023228 | 2524538633 | 239 |
| 17 | iso_pu_bacteria | 2599185170 | 2599416133 | 239 |
| 18 | iso_pu_bacteria | 2838035591 | 2838036254 | 239 |
| 19 | iso_pu_bacteria | 2885326080 | 2885332568 | 239 |
| 20 | iso_pu_bacteria | 2904699407 | 2904704668 | 239 |
| 21 | iso_pu_bacteria | 2906635258 | 2906640142 | 239 |
| 22 | iso_pu_bacteria | 2906660503 | 2906667109 | 239 |
| 23 | iso_pu_bacteria | 8006933436 | 8006939733 | 239 |
| 24 | iso_pu_bacteria | 8006973647 | 8006979483 | 239 |
| 25 | 3300005539 | Ga0068853_100155546 | Ga0068853_1001555462 | 240 |
| 26 | 3300009978 | Ga0105148_100139 | Ga0105148_1001392 | 240 |
| 27 | 3300025949 | Ga0207667_10392594 | Ga0207667_103925941 | 240 |
| 28 | 3300049744 | Ga0501083_0239318 | Ga0501083_0239318_252_995 | 240 |
| 29 | iso_pu_bacteria | 2643221551 | 2643775497 | 240 |
| 30 | iso_pu_bacteria | 2643221555 | 2643793943 | 240 |
| 31 | iso_pu_bacteria | 2667528175 | 2671118620 | 240 |
| 32 | iso_pu_bacteria | 2718217882 | 2719183649 | 240 |
| 33 | iso_pu_bacteria | 2718218009 | 2719728090 | 240 |
| 34 | iso_pu_bacteria | 2718218363 | 2721144951 | 240 |
| 35 | iso_pu_bacteria | 2718218365 | 2721155687 | 240 |
| 36 | iso_pu_bacteria | 2718218366 | 2721167038 | 240 |
| 37 | iso_pu_bacteria | 2721755514 | 2722838016 | 240 |
| 38 | iso_pu_bacteria | 2721755810 | 2724042284 | 240 |
| 39 | iso_pu_bacteria | 2728369365 | 2730161789 | 240 |
| 40 | iso_pu_bacteria | 2728369397 | 2730300794 | 240 |
| 41 | iso_pu_bacteria | 2791355263 | 2793340375 | 240 |
| 42 | iso_pu_bacteria | 2791355264 | 2793346133 | 240 |
| 43 | iso_pu_bacteria | 2791355266 | 2793358025 | 240 |
| 44 | iso_pu_bacteria | 2838022645 | 2838024974 | 240 |
| 45 | iso_pu_bacteria | 2838042994 | 2838048587 | 240 |
| 46 | iso_pu_bacteria | 2841734538 | 2841737603 | 240 |
| 47 | iso_pu_bacteria | 2842198810 | 2842202058 | 240 |
| 48 | iso_pu_bacteria | 2871474448 | 2871481213 | 240 |
| 49 | iso_pu_bacteria | 2878788777 | 2878790196 | 240 |
| 50 | iso_pu_bacteria | 2881147464 | 2881155038 | 240 |
| 51 | iso_pu_bacteria | 2906610324 | 2906616780 | 240 |
| 52 | iso_pu_bacteria | 2922425934 | 2922431161 | 240 |
| 53 | iso_pu_bacteria | 2936381700 | 2936385517 | 240 |
| 54 | iso_pu_bacteria | 2937836603 | 2937840162 | 240 |
| 55 | iso_pu_bacteria | 2958071322 | 2958072779 | 240 |
| 56 | iso_pu_bacteria | 3004268573 | 3004268984 | 240 |
| 57 | iso_pu_bacteria | 8003570095 | 8003575338 | 240 |
| 58 | iso_pu_bacteria | 8004633249 | 8004633893 | 240 |
| 59 | iso_pu_bacteria | 8019555841 | 8019565630 | 240 |
| 60 | iso_pu_bacteria | 8019565922 | 8019575726 | 240 |
| 61 | 3300003214 | JGI25165J46597_1000041 | JGI25165J46597_100004121 | 241 |
| 62 | 3300005336 | Ga0070680_100076235 | Ga0070680_1000762355 | 241 |
| 63 | 3300005339 | Ga0070660_100173860 | Ga0070660_1001738602 | 241 |
| 64 | 3300005344 | Ga0070661_100006990 | Ga0070661_1000069905 | 241 |
| 65 | 3300005353 | Ga0070669_100258573 | Ga0070669_1002585731 | 241 |
| 66 | 3300005458 | Ga0070681_10025743 | Ga0070681_100257432 | 241 |
| 67 | 3300005530 | Ga0070679_100058603 | Ga0070679_1000586033 | 241 |
| 68 | 3300005539 | Ga0068853_100030185 | Ga0068853_1000301855 | 241 |
| 69 | 3300005614 | Ga0068856_100143004 | Ga0068856_1001430042 | 241 |
| 70 | 3300005616 | Ga0068852_100293557 | Ga0068852_1002935572 | 241 |
| 71 | 3300005985 | Ga0081539_10001801 | Ga0081539_1000180123 | 241 |
| 72 | 3300009093 | Ga0105240_10011604 | Ga0105240_100116044 | 241 |
| 73 | 3300009551 | Ga0105238_10052222 | Ga0105238_100522222 | 241 |
| 74 | 3300010375 | Ga0105239_10045181 | Ga0105239_100451812 | 241 |
| 75 | 3300013104 | Ga0157370_10203875 | Ga0157370_102038752 | 241 |
| 76 | 3300013105 | Ga0157369_10010432 | Ga0157369_1001043211 | 241 |
| 77 | 3300025233 | Ga0209437_108954 | Ga0209437_1089543 | 241 |
| 78 | 3300025261 | Ga0209233_1000104 | Ga0209233_100010421 | 241 |
| 79 | 3300025912 | Ga0207707_10087741 | Ga0207707_100877412 | 241 |
| 80 | 3300025913 | Ga0207695_10186869 | Ga0207695_101868692 | 241 |
| 81 | 3300025919 | Ga0207657_10142946 | Ga0207657_101429463 | 241 |
| 82 | 3300025981 | Ga0207640_10273330 | Ga0207640_102733302 | 241 |
| 83 | 3300026142 | Ga0207698_10291189 | Ga0207698_102911892 | 241 |
| 84 | 3300048924 | Ga0496121_0235864 | Ga0496121_0235864_273_1016 | 241 |
| 85 | iso_pu_bacteria | 2524023209 | 2524460929 | 241 |
| 86 | iso_pu_bacteria | 2643221607 | 2644047521 | 241 |
| 87 | iso_pu_bacteria | 2643221610 | 2644070272 | 241 |
| 88 | iso_pu_bacteria | 2643221675 | 2644421034 | 241 |
| 89 | iso_pu_bacteria | 2643221680 | 2644454557 | 241 |
| 90 | iso_pu_bacteria | 2643221686 | 2644480988 | 241 |
| 91 | iso_pu_bacteria | 2643221726 | 2644692496 | 241 |
| 92 | iso_pu_bacteria | 2837678835 | 2837681480 | 241 |
| 93 | iso_pu_bacteria | 2842298080 | 2842298942 | 241 |
| 94 | iso_pu_bacteria | 2842357229 | 2842359190 | 241 |
| 95 | iso_pu_bacteria | 2874123672 | 2874126743 | 241 |
| 96 | iso_pu_bacteria | 2874139085 | 2874143602 | 241 |
| 97 | iso_pu_bacteria | 2876369609 | 2876375151 | 241 |
| 98 | iso_pu_bacteria | 8004695233 | 8004699806 | 241 |
| 99 | 3300005347 | Ga0070668_100147561 | Ga0070668_1001475612 | 242 |
| 100 | 3300005548 | Ga0070665_100351507 | Ga0070665_1003515072 | 242 |
| 101 | 3300006871 | Ga0075434_100122890 | Ga0075434_1001228903 | 242 |
| 102 | 3300009553 | Ga0105249_10211897 | Ga0105249_102118972 | 242 |
| 103 | 3300013306 | Ga0163162_10472758 | Ga0163162_104727581 | 242 |
| 104 | 3300025961 | Ga0207712_10009711 | Ga0207712_100097117 | 242 |
| 105 | 3300025972 | Ga0207668_10127424 | Ga0207668_101274242 | 242 |
| 106 | 3300028379 | Ga0268266_10307920 | Ga0268266_103079202 | 242 |
| 107 | 3300039438 | Ga0436360_0860069 | Ga0436360_0860069_431_1174 | 242 |
| 108 | 3300049569 | Ga0501032_0308402 | Ga0501032_0308402_61_825 | 242 |
| 109 | 3300049572 | Ga0501036_0016280 | Ga0501036_0016280_4849_5769 | 242 |
| 110 | 3300049573 | Ga0501037_0136455 | Ga0501037_0136455_619_1539 | 242 |
| 111 | 3300049579 | Ga0501043_0223913 | Ga0501043_0223913_106_870 | 242 |
| 112 | 3300049581 | Ga0501047_0185821 | Ga0501047_0185821_230_1150 | 242 |
| 113 | 3300049582 | Ga0501048_0054840 | Ga0501048_0054840_229_1149 | 242 |
| 114 | 3300049586 | Ga0501070_0072704 | Ga0501070_0072704_1212_2132 | 242 |
| 115 | 3300049589 | Ga0501073_0042427 | Ga0501073_0042427_2049_2969 | 242 |
| 116 | 3300049590 | Ga0501074_0006277 | Ga0501074_0006277_49_813 | 242 |
| 117 | 3300049742 | Ga0501080_0008286 | Ga0501080_0008286_8441_9205 | 242 |
| 118 | 3300049744 | Ga0501083_0106249 | Ga0501083_0106249_330_1250 | 242 |
| 119 | 3300049822 | Ga0501035_0163268 | Ga0501035_0163268_794_1558 | 242 |
| 120 | 3300050512 | nmdc:mga0n895_25121_c1 | nmdc:mga0n895_25121_c1_1013_1774 | 242 |
| 121 | iso_pu_bacteria | 2847686936 | 2847691684 | 242 |
| 122 | iso_pu_bacteria | 2856314179 | 2856315548 | 242 |
| 123 | iso_pu_bacteria | 2874102143 | 2874108890 | 242 |
| 124 | iso_pu_bacteria | 2878035449 | 2878037220 | 242 |
| 125 | iso_pu_bacteria | 2885334103 | 2885341555 | 242 |
| 126 | iso_pu_bacteria | 2906328253 | 2906329447 | 242 |
| 127 | iso_pu_bacteria | 2906414383 | 2906415685 | 242 |
| 128 | iso_pu_bacteria | 2937891427 | 2937895790 | 242 |
| 129 | iso_pu_bacteria | 2937994558 | 2937994845 | 242 |
| 130 | iso_pu_bacteria | 2958115193 | 2958122067 | 242 |
| 131 | iso_pu_bacteria | 2958165035 | 2958165325 | 242 |
| 132 | iso_pu_bacteria | 2961163497 | 2961163783 | 242 |
| 133 | iso_pu_bacteria | 2965018300 | 2965018588 | 242 |
| 134 | iso_pu_bacteria | 2968097103 | 2968102907 | 242 |
| 135 | iso_pu_bacteria | 2968117919 | 2968118305 | 242 |
| 136 | iso_pu_bacteria | 2968128360 | 2968131054 | 242 |
| 137 | iso_pu_bacteria | 2968171901 | 2968172189 | 242 |
| 138 | iso_pu_bacteria | 2970554993 | 2970555279 | 242 |
| 139 | iso_pu_bacteria | 2977858184 | 2977861366 | 242 |
| 140 | iso_pu_bacteria | 2979779861 | 2979780410 | 242 |
| 141 | iso_pu_bacteria | 2987659509 | 2987659795 | 242 |
| 142 | iso_pu_bacteria | 3004188549 | 3004188842 | 242 |
| 143 | iso_pu_bacteria | 8004445564 | 8004448183 | 242 |
| 144 | iso_pu_bacteria | 8004703790 | 8004712930 | 242 |
| 145 | 3300003771 | Ga0055526_1009369 | Ga0055526_10093692 | 243 |
| 146 | 3300003771 | Ga0055526_1013021 | Ga0055526_10130212 | 243 |
| 147 | 3300003775 | Ga0055524_1022021 | Ga0055524_10220212 | 243 |
| 148 | 3300003790 | Ga0055528_1005587 | Ga0055528_10055874 | 243 |
| 149 | 3300005344 | Ga0070661_100085961 | Ga0070661_1000859612 | 243 |
| 150 | 3300005530 | Ga0070679_100191857 | Ga0070679_1001918572 | 243 |
| 151 | 3300005539 | Ga0068853_100003239 | Ga0068853_10000323914 | 243 |
| 152 | 3300005577 | Ga0068857_100011976 | Ga0068857_1000119763 | 243 |
| 153 | 3300005834 | Ga0068851_10046841 | Ga0068851_100468412 | 243 |
| 154 | 3300006237 | Ga0097621_100602994 | Ga0097621_1006029941 | 243 |
| 155 | 3300006358 | Ga0068871_100700658 | Ga0068871_1007006581 | 243 |
| 156 | 3300006931 | Ga0097620_100179476 | Ga0097620_1001794763 | 243 |
| 157 | 3300009093 | Ga0105240_10587441 | Ga0105240_105874411 | 243 |
| 158 | 3300009101 | Ga0105247_10243393 | Ga0105247_102433932 | 243 |
| 159 | 3300010375 | Ga0105239_10003590 | Ga0105239_100035909 | 243 |
| 160 | 3300010375 | Ga0105239_10037776 | Ga0105239_100377763 | 243 |
| 161 | 3300013297 | Ga0157378_10559866 | Ga0157378_105598662 | 243 |
| 162 | 3300025273 | Ga0209673_1000022 | Ga0209673_1000022259 | 243 |
| 163 | 3300025295 | Ga0209564_1000163 | Ga0209564_10001639 | 243 |
| 164 | 3300025299 | Ga0209256_1001398 | Ga0209256_10013989 | 243 |
| 165 | 3300025321 | Ga0207656_10040155 | Ga0207656_100401553 | 243 |
| 166 | 3300025900 | Ga0207710_10092693 | Ga0207710_100926932 | 243 |
| 167 | 3300025911 | Ga0207654_10077086 | Ga0207654_100770863 | 243 |
| 168 | 3300026041 | Ga0207639_10011470 | Ga0207639_100114706 | 243 |
| 169 | 3300026116 | Ga0207674_10007240 | Ga0207674_100072407 | 243 |
| 170 | 3300042436 | Ga0439435_0000469 | Ga0439435_0000469_4945_5730 | 243 |
| 171 | 3300046460 | Ga0495638_0060940 | Ga0495638_0060940_900_1670 | 243 |
| 172 | 3300048910 | Ga0496107_0034512 | Ga0496107_0034512_1098_1871 | 243 |
| 173 | iso_pu_bacteria | 8045864390 | 8045868466 | 243 |
| 174 | 3300005334 | Ga0068869_100056720 | Ga0068869_1000567202 | 244 |
| 175 | 3300005338 | Ga0068868_100373557 | Ga0068868_1003735572 | 244 |
| 176 | 3300005347 | Ga0070668_100120499 | Ga0070668_1001204993 | 244 |
| 177 | 3300005455 | Ga0070663_100138787 | Ga0070663_1001387872 | 244 |
| 178 | 3300005563 | Ga0068855_100492197 | Ga0068855_1004921971 | 244 |
| 179 | 3300005578 | Ga0068854_100358906 | Ga0068854_1003589061 | 244 |
| 180 | 3300005841 | Ga0068863_100003503 | Ga0068863_1000035032 | 244 |
| 181 | 3300005843 | Ga0068860_100001008 | Ga0068860_1000010082 | 244 |
| 182 | 3300005844 | Ga0068862_100000163 | Ga0068862_10000016327 | 244 |
| 183 | 3300005937 | Ga0081455_10049130 | Ga0081455_100491305 | 244 |
| 184 | 3300005983 | Ga0081540_1006315 | Ga0081540_10063157 | 244 |
| 185 | 3300006051 | Ga0075364_10197761 | Ga0075364_101977612 | 244 |
| 186 | 3300009094 | Ga0111539_10480277 | Ga0111539_104802772 | 244 |
| 187 | 3300009101 | Ga0105247_10020612 | Ga0105247_100206123 | 244 |
| 188 | 3300009553 | Ga0105249_10000067 | Ga0105249_1000006721 | 244 |
| 189 | 3300013306 | Ga0163162_10169418 | Ga0163162_101694182 | 244 |
| 190 | 3300014326 | Ga0157380_10465176 | Ga0157380_104651761 | 244 |
| 191 | 3300014497 | Ga0182008_10128163 | Ga0182008_101281631 | 244 |
| 192 | 3300025272 | Ga0209455_1001350 | Ga0209455_10013503 | 244 |
| 193 | 3300025900 | Ga0207710_10012667 | Ga0207710_100126673 | 244 |
| 194 | 3300025945 | Ga0207679_10213491 | Ga0207679_102134912 | 244 |
| 195 | 3300025961 | Ga0207712_10000054 | Ga0207712_1000005419 | 244 |
| 196 | 3300026067 | Ga0207678_10100384 | Ga0207678_101003842 | 244 |
| 197 | 3300026088 | Ga0207641_10008688 | Ga0207641_100086882 | 244 |
| 198 | 3300028380 | Ga0268265_10000182 | Ga0268265_1000018228 | 244 |
| 199 | 3300028381 | Ga0268264_10003017 | Ga0268264_100030176 | 244 |
| 200 | 3300031507 | Ga0307509_10172726 | Ga0307509_101727261 | 244 |
| 201 | 3300031616 | Ga0307508_10000090 | Ga0307508_1000009047 | 244 |
| 202 | 3300031616 | Ga0307508_10265721 | Ga0307508_102657211 | 244 |
| 203 | 3300037471 | Ga0395905_0346203 | Ga0395905_0346203_114_869 | 244 |
| 204 | 3300039438 | Ga0436360_0803520 | Ga0436360_0803520_154_912 | 244 |
| 205 | 3300039438 | Ga0436360_1211757 | Ga0436360_1211757_163_930 | 244 |
| 206 | 3300041451 | Ga0451791_1426729 | Ga0451791_1426729_177_944 | 244 |
| 207 | 3300042005 | Ga0439448_0102717 | Ga0439448_0102717_61_828 | 244 |
| 208 | 3300046454 | Ga0495592_0217058 | Ga0495592_0217058_447_1220 | 244 |
| 209 | 3300046459 | Ga0495629_0245793 | Ga0495629_0245793_335_1144 | 244 |
| 210 | 3300046460 | Ga0495638_0009959 | Ga0495638_0009959_1563_2324 | 244 |
| 211 | 3300046616 | Ga0495668_0075078 | Ga0495668_0075078_465_1220 | 244 |
| 212 | 3300048905 | Ga0496102_0563229 | Ga0496102_0563229_194_958 | 244 |
| 213 | 3300048906 | Ga0496103_0109638 | Ga0496103_0109638_303_1067 | 244 |
| 214 | 3300048912 | Ga0496109_0100483 | Ga0496109_0100483_1096_1863 | 244 |
| 215 | 3300048916 | Ga0496113_0549743 | Ga0496113_0549743_11_778 | 244 |
| 216 | 3300048924 | Ga0496121_0165241 | Ga0496121_0165241_651_1442 | 244 |
| 217 | 3300048927 | Ga0496124_0319439 | Ga0496124_0319439_113_883 | 244 |
| 218 | 3300048928 | Ga0496125_0086478 | Ga0496125_0086478_1366_2136 | 244 |
| 219 | 3300048929 | Ga0496126_0019907 | Ga0496126_0019907_4681_5472 | 244 |
| 220 | 3300049574 | Ga0501038_0000837 | Ga0501038_0000837_6010_6777 | 244 |
| 221 | 3300049822 | Ga0501035_0424938 | Ga0501035_0424938_17_784 | 244 |
| 222 | 3300050507 | nmdc:mga05p37_318786_c1 | nmdc:mga05p37_318786_c1_161_952 | 244 |
| 223 | 3300050514 | nmdc:mga08x19_149348_c1 | nmdc:mga08x19_149348_c1_142_909 | 244 |
| 224 | 3300053108 | Ga0500562_060411 | Ga0500562_060411_133_900 | 244 |
| 225 | 3300053177 | Ga0500636_0014831 | Ga0500636_0014831_3235_4005 | 244 |
| 226 | 3300053730 | Ga0500645_049412 | Ga0500645_049412_11_778 | 244 |
| 227 | 3300053737 | Ga0500601_006494 | Ga0500601_006494_141_911 | 244 |
| 228 | iso_pu_bacteria | 2508501127 | 2509142334 | 244 |
| 229 | iso_pu_bacteria | 2885312484 | 2885313001 | 244 |
| 230 | iso_pu_bacteria | 2941507105 | 2941510901 | 244 |
| 231 | iso_pu_bacteria | 2941515067 | 2941518285 | 244 |
| 232 | iso_pu_bacteria | 2941523033 | 2941526844 | 244 |
| 233 | 3300002987 | JGI25159J45721_1000175 | JGI25159J45721_10001756 | 245 |
| 234 | 3300003187 | JGI25151J46595_10000373 | JGI25151J46595_1000037352 | 245 |
| 235 | 3300003187 | JGI25151J46595_10001163 | JGI25151J46595_100011632 | 245 |
| 236 | 3300003215 | JGI25153J46596_10003023 | JGI25153J46596_100030233 | 245 |
| 237 | 3300003354 | JGI25160J50197_1000365 | JGI25160J50197_10003656 | 245 |
| 238 | 3300003354 | JGI25160J50197_1039406 | JGI25160J50197_10394061 | 245 |
| 239 | 3300003374 | JGI25161J50226_1000280 | JGI25161J50226_100028035 | 245 |
| 240 | 3300003771 | Ga0055526_1001092 | Ga0055526_10010927 | 245 |
| 241 | 3300003775 | Ga0055524_1008274 | Ga0055524_10082742 | 245 |
| 242 | 3300003781 | Ga0055536_1009544 | Ga0055536_10095444 | 245 |
| 243 | 3300003790 | Ga0055528_1000638 | Ga0055528_10006385 | 245 |
| 244 | 3300003791 | Ga0055530_10021428 | Ga0055530_100214283 | 245 |
| 245 | 3300003794 | Ga0055531_10011368 | Ga0055531_100113684 | 245 |
| 246 | 3300004625 | Ga0055543_1000372 | Ga0055543_10003726 | 245 |
| 247 | 3300005262 | Ga0065165_1001221 | Ga0065165_10012216 | 245 |
| 248 | 3300005331 | Ga0070670_100366761 | Ga0070670_1003667611 | 245 |
| 249 | 3300005355 | Ga0070671_100056896 | Ga0070671_1000568963 | 245 |
| 250 | 3300005471 | Ga0070698_100460374 | Ga0070698_1004603742 | 245 |
| 251 | 3300005536 | Ga0070697_100145997 | Ga0070697_1001459971 | 245 |
| 252 | 3300006038 | Ga0075365_10001463 | Ga0075365_1000146310 | 245 |
| 253 | 3300006042 | Ga0075368_10000287 | Ga0075368_1000028712 | 245 |
| 254 | 3300006048 | Ga0075363_100000904 | Ga0075363_1000009046 | 245 |
| 255 | 3300006051 | Ga0075364_10011297 | Ga0075364_100112972 | 245 |
| 256 | 3300006177 | Ga0075362_10001875 | Ga0075362_100018758 | 245 |
| 257 | 3300006178 | Ga0075367_10000871 | Ga0075367_1000087111 | 245 |
| 258 | 3300006186 | Ga0075369_10002398 | Ga0075369_100023985 | 245 |
| 259 | 3300009011 | Ga0105251_10031302 | Ga0105251_100313021 | 245 |
| 260 | 3300009092 | Ga0105250_10040418 | Ga0105250_100404182 | 245 |
| 261 | 3300009551 | Ga0105238_10020477 | Ga0105238_100204775 | 245 |
| 262 | 3300010159 | Ga0099796_10102566 | Ga0099796_101025661 | 245 |
| 263 | 3300025208 | Ga0209436_100259 | Ga0209436_1002593 | 245 |
| 264 | 3300025245 | Ga0207425_1003523 | Ga0207425_10035232 | 245 |
| 265 | 3300025258 | Ga0209129_1004554 | Ga0209129_10045542 | 245 |
| 266 | 3300025284 | Ga0209130_1000598 | Ga0209130_10005986 | 245 |
| 267 | 3300025292 | Ga0209676_1005905 | Ga0209676_10059054 | 245 |
| 268 | 3300025294 | Ga0209025_1000969 | Ga0209025_10009696 | 245 |
| 269 | 3300025294 | Ga0209025_1002488 | Ga0209025_10024882 | 245 |
| 270 | 3300025295 | Ga0209564_1000692 | Ga0209564_100069252 | 245 |
| 271 | 3300025297 | Ga0209758_1002375 | Ga0209758_10023752 | 245 |
| 272 | 3300025298 | Ga0209050_1006124 | Ga0209050_10061245 | 245 |
| 273 | 3300025299 | Ga0209256_1001225 | Ga0209256_100122513 | 245 |
| 274 | 3300025302 | Ga0207426_1000779 | Ga0207426_10007796 | 245 |
| 275 | 3300025910 | Ga0207684_10085628 | Ga0207684_100856281 | 245 |
| 276 | 3300025924 | Ga0207694_10099842 | Ga0207694_100998423 | 245 |
| 277 | 3300027866 | Ga0209813_10000027 | Ga0209813_1000002757 | 245 |
| 278 | 3300028381 | Ga0268264_10750260 | Ga0268264_107502601 | 245 |
| 279 | 3300035172 | Ga0373955_0062225 | Ga0373955_0062225_715_1500 | 245 |
| 280 | 3300037068 | Ga0373925_0165807 | Ga0373925_0165807_714_1499 | 245 |
| 281 | 3300037418 | Ga0395900_0010066 | Ga0395900_0010066_7746_8501 | 245 |
| 282 | 3300037466 | Ga0395898_0371066 | Ga0395898_0371066_441_1196 | 245 |
| 283 | 3300038443 | Ga0395901_0046355 | Ga0395901_0046355_940_1719 | 245 |
| 284 | 3300038443 | Ga0395901_0079329 | Ga0395901_0079329_1045_1800 | 245 |
| 285 | 3300046475 | Ga0495639_0221740 | Ga0495639_0221740_43_828 | 245 |
| 286 | 3300046524 | Ga0495648_0114698 | Ga0495648_0114698_272_1018 | 245 |
| 287 | 3300048929 | Ga0496126_0390011 | Ga0496126_0390011_235_1020 | 245 |
| 288 | 3300049568 | Ga0501031_0000036 | Ga0501031_0000036_42613_43380 | 245 |
| 289 | 3300049568 | Ga0501031_0000068 | Ga0501031_0000068_31796_32548 | 245 |
| 290 | 3300049568 | Ga0501031_0023006 | Ga0501031_0023006_2084_2887 | 245 |
| 291 | 3300049569 | Ga0501032_0000100 | Ga0501032_0000100_30425_31192 | 245 |
| 292 | 3300049569 | Ga0501032_0000103 | Ga0501032_0000103_31824_32576 | 245 |
| 293 | 3300049569 | Ga0501032_0004376 | Ga0501032_0004376_6895_7698 | 245 |
| 294 | 3300049569 | Ga0501032_0095544 | Ga0501032_0095544_263_1027 | 245 |
| 295 | 3300049570 | Ga0501033_0000088 | Ga0501033_0000088_42314_43081 | 245 |
| 296 | 3300049570 | Ga0501033_0000778 | Ga0501033_0000778_4156_4908 | 245 |
| 297 | 3300049570 | Ga0501033_0003728 | Ga0501033_0003728_2116_2919 | 245 |
| 298 | 3300049570 | Ga0501033_0009764 | Ga0501033_0009764_1679_2482 | 245 |
| 299 | 3300049570 | Ga0501033_0075297 | Ga0501033_0075297_872_1636 | 245 |
| 300 | 3300049571 | Ga0501034_0000365 | Ga0501034_0000365_44649_45401 | 245 |
| 301 | 3300049571 | Ga0501034_0000397 | Ga0501034_0000397_30431_31198 | 245 |
| 302 | 3300049571 | Ga0501034_0004282 | Ga0501034_0004282_6895_7698 | 245 |
| 303 | 3300049571 | Ga0501034_0005317 | Ga0501034_0005317_5951_6742 | 245 |
| 304 | 3300049571 | Ga0501034_0039512 | Ga0501034_0039512_2489_3292 | 245 |
| 305 | 3300049571 | Ga0501034_0158801 | Ga0501034_0158801_1200_1946 | 245 |
| 306 | 3300049572 | Ga0501036_0000056 | Ga0501036_0000056_30431_31198 | 245 |
| 307 | 3300049572 | Ga0501036_0000058 | Ga0501036_0000058_31824_32576 | 245 |
| 308 | 3300049572 | Ga0501036_0000544 | Ga0501036_0000544_18168_18971 | 245 |
| 309 | 3300049572 | Ga0501036_0031967 | Ga0501036_0031967_564_1463 | 245 |
| 310 | 3300049573 | Ga0501037_0000119 | Ga0501037_0000119_30430_31197 | 245 |
| 311 | 3300049573 | Ga0501037_0000157 | Ga0501037_0000157_31824_32576 | 245 |
| 312 | 3300049573 | Ga0501037_0007051 | Ga0501037_0007051_4075_4878 | 245 |
| 313 | 3300049573 | Ga0501037_0218352 | Ga0501037_0218352_409_1155 | 245 |
| 314 | 3300049574 | Ga0501038_0000091 | Ga0501038_0000091_44649_45401 | 245 |
| 315 | 3300049574 | Ga0501038_0000098 | Ga0501038_0000098_30404_31171 | 245 |
| 316 | 3300049574 | Ga0501038_0001470 | Ga0501038_0001470_9477_10280 | 245 |
| 317 | 3300049574 | Ga0501038_0014937 | Ga0501038_0014937_2934_3737 | 245 |
| 318 | 3300049574 | Ga0501038_0080716 | Ga0501038_0080716_227_991 | 245 |
| 319 | 3300049575 | Ga0501039_0000013 | Ga0501039_0000013_42314_43081 | 245 |
| 320 | 3300049575 | Ga0501039_0000071 | Ga0501039_0000071_31824_32576 | 245 |
| 321 | 3300049575 | Ga0501039_0001124 | Ga0501039_0001124_12141_12944 | 245 |
| 322 | 3300049576 | Ga0501040_0197695 | Ga0501040_0197695_93_860 | 245 |
| 323 | 3300049577 | Ga0501041_0188180 | Ga0501041_0188180_236_1012 | 245 |
| 324 | 3300049578 | Ga0501042_0039549 | Ga0501042_0039549_544_1320 | 245 |
| 325 | 3300049579 | Ga0501043_0001191 | Ga0501043_0001191_14232_14999 | 245 |
| 326 | 3300049579 | Ga0501043_0001914 | Ga0501043_0001914_10128_10931 | 245 |
| 327 | 3300049579 | Ga0501043_0081327 | Ga0501043_0081327_296_1060 | 245 |
| 328 | 3300049580 | Ga0501046_0003472 | Ga0501046_0003472_9493_10296 | 245 |
| 329 | 3300049580 | Ga0501046_0039551 | Ga0501046_0039551_1756_2508 | 245 |
| 330 | 3300049580 | Ga0501046_0204670 | Ga0501046_0204670_88_855 | 245 |
| 331 | 3300049581 | Ga0501047_0000797 | Ga0501047_0000797_13885_14688 | 245 |
| 332 | 3300049581 | Ga0501047_0014437 | Ga0501047_0014437_1716_2468 | 245 |
| 333 | 3300049581 | Ga0501047_0030775 | Ga0501047_0030775_2180_2947 | 245 |
| 334 | 3300049582 | Ga0501048_0000925 | Ga0501048_0000925_15682_16485 | 245 |
| 335 | 3300049584 | Ga0501068_0039477 | Ga0501068_0039477_641_1444 | 245 |
| 336 | 3300049586 | Ga0501070_0093675 | Ga0501070_0093675_1239_2006 | 245 |
| 337 | 3300049589 | Ga0501073_0075193 | Ga0501073_0075193_841_1644 | 245 |
| 338 | 3300049589 | Ga0501073_0408823 | Ga0501073_0408823_83_841 | 245 |
| 339 | 3300049592 | Ga0501076_0154681 | Ga0501076_0154681_59_835 | 245 |
| 340 | 3300049741 | Ga0501079_0111904 | Ga0501079_0111904_161_937 | 245 |
| 341 | 3300049742 | Ga0501080_0013473 | Ga0501080_0013473_1798_2601 | 245 |
| 342 | 3300049743 | Ga0501081_0076013 | Ga0501081_0076013_265_1041 | 245 |
| 343 | 3300049822 | Ga0501035_0000053 | Ga0501035_0000053_99780_100547 | 245 |
| 344 | 3300049822 | Ga0501035_0000503 | Ga0501035_0000503_11489_12241 | 245 |
| 345 | 3300049822 | Ga0501035_0005592 | Ga0501035_0005592_6895_7698 | 245 |
| 346 | 3300049822 | Ga0501035_0013016 | Ga0501035_0013016_4487_5386 | 245 |
| 347 | 3300049822 | Ga0501035_0013388 | Ga0501035_0013388_4447_5250 | 245 |
| 348 | 3300049822 | Ga0501035_0140082 | Ga0501035_0140082_792_1556 | 245 |
| 349 | 3300049823 | Ga0501044_0000214 | Ga0501044_0000214_42314_43081 | 245 |
| 350 | 3300049823 | Ga0501044_0000225 | Ga0501044_0000225_39011_39763 | 245 |
| 351 | 3300049823 | Ga0501044_0023441 | Ga0501044_0023441_1897_2700 | 245 |
| 352 | 3300049823 | Ga0501044_0042224 | Ga0501044_0042224_1842_2645 | 245 |
| 353 | 3300053136 | Ga0500559_0078423 | Ga0500559_0078423_18_758 | 245 |
| 354 | 3300053156 | Ga0500622_0027369 | Ga0500622_0027369_675_1415 | 245 |
| 355 | iso_pu_bacteria | 2643221564 | 2643839874 | 245 |
| 356 | iso_pu_bacteria | 2968128360 | 2968132344 | 245 |
| 357 | iso_pu_bacteria | 2977864932 | 2977865024 | 245 |
| 358 | iso_pu_bacteria | 2977942078 | 2977944625 | 245 |
| 359 | iso_pu_bacteria | 2987636660 | 2987638871 | 245 |
| 360 | iso_pu_bacteria | 3004203850 | 3004204885 | 245 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar