F422005

General Info

Members Datasets Scaffolds Average Seq Length
360 270 258 254

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0016280|Ga0501036_0016280_4849_5769
Length 306
Sequence MGETIFGMWRANAGQAVGMNGGRASLCPPCAHYHTIRILAAASIPSWCGEAIVPNEDRSPRLAVLIDADNASAKIADGLFEEIAKIGEASVRRIYGDFSNPRSKAWTDTLSKHAIIPQQQFAYTTGKNASDITLVIDAMDLLHSGRFDGFCLVSSDSDFTRLAARIREQGVDVFGFGEQKTPESFRQACRRFVYTENLLSGVANSHDDVSSRKSLQPPSAAVPIVKKVIAQIESEDGWVPLGQVGTQLANLTSDFDPRNFGFRKLSDLIRKTSAFDIEHRPGQAMRIRVKAAAPLRPRADKKPERQ

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
9 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
10 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
11 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
12 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
13 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
14 2643221607 Rhizobium sp. Root73 Isolate Unclassified
15 2643221610 Ensifer sp. Root74 Isolate Unclassified
16 2643221675 Ensifer sp. Root1298 Isolate Unclassified
17 2643221680 Ensifer sp. Root1312 Isolate Unclassified
18 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
19 2643221726 Ensifer sp. Root954 Isolate Unclassified
20 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
21 2718217882 Rhizobium sp. N741 Isolate Nodule
22 2718218009 Rhizobium sp. N561 Isolate Nodule
23 2718218363 Rhizobium sp. N113 Isolate Nodule
24 2718218365 Rhizobium sp. N731 Isolate Nodule
25 2718218366 Rhizobium sp. N621 Isolate Nodule
26 2721755514 Rhizobium sp. N6212 Isolate Nodule
27 2721755810 Rhizobium sp. N871 Isolate Nodule
28 2728369365 Rhizobium sp. N1341 Isolate Nodule
29 2728369397 Rhizobium sp. N1314 Isolate Nodule
30 2791355263 Rhizobium chutanense C5 Isolate Nodule
31 2791355264 Rhizobium sp. S9 Isolate Nodule
32 2791355266 Rhizobium sp. L43 Isolate Nodule
33 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
34 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
35 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
36 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
37 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
38 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
39 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
40 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
41 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
42 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
43 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
44 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
45 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
46 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
47 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
48 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
49 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
50 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
51 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
52 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
53 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
54 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
55 2904699407
56 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
57 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
58 2906610324
59 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
60 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
61 2922425934
62 2936381700 Rhizobium chutanense C16 Isolate Unclassified
63 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
64 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
65 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
66 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
67 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
68 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
69 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
70 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
71 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
72 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
73 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
74 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
75 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
76 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
77 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
78 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
79 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
80 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
81 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
82 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
83 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
84 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
85 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
86 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
87 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
88 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
89 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
90 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
91 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
92 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
93 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
94 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
95 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
96 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
97 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
98 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
99 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
100 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
101 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
102 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
103 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
104 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
105 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
106 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
107 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
108 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
109 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
110 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
111 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
112 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
113 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
114 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
115 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
116 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
117 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
118 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
119 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
120 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
121 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
122 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
123 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
124 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
125 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
126 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
127 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
128 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
129 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
130 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
131 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
132 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
133 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
134 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
135 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
136 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
137 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
138 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
139 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
140 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
141 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
143 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
144 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
145 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
146 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
151 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
152 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
153 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
162 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
163 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
164 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
165 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
166 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
173 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
176 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
209 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
210 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
256 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
257 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
258 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
259 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
260 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
261 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
262 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
263 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
264 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
265 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
266 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
267 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
268 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
269 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
270 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 72.27
Metatranscriptomes 0
Isolates 27.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.72
Nodule 21.39
Rhizoplane 1.94
Rhizosphere 52.78
Stem 0
Stem Tuber 0
Unclassified 9.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000175 3300002987 Bacteria 29637
2 JGI25151J46595_10000373 3300003187 Bacteria 46885
3 JGI25151J46595_10001163 3300003187 Bacteria 18979
4 JGI25165J46597_1000041 3300003214 Bacteria 272566
5 JGI25153J46596_10003023 3300003215 Bacteria 9516
6 JGI25160J50197_1000365 3300003354 Bacteria 29637
7 JGI25160J50197_1039406 3300003354 Bacteria 1106
8 JGI25161J50226_1000280 3300003374 Bacteria 29331
9 Ga0055526_1001092 3300003771 Bacteria 19774
10 Ga0055526_1009369 3300003771 Bacteria 4720
11 Ga0055526_1013021 3300003771 Bacteria 3560
12 Ga0055524_1008274 3300003775 Bacteria 4333
13 Ga0055524_1022021 3300003775 Bacteria 2094
14 Ga0055536_1009544 3300003781 Bacteria 3993
15 Ga0055528_1000638 3300003790 Bacteria 25688
16 Ga0055528_1005587 3300003790 Bacteria 5819
17 Ga0055530_10021428 3300003791 Bacteria 1905
18 Ga0055531_10011368 3300003794 Bacteria 4303
19 Ga0055543_1000372 3300004625 Bacteria 29554
20 Ga0065165_1001221 3300005262 Bacteria 29554
21 Ga0070670_100366761 3300005331 Bacteria 1267
22 Ga0068869_100056720 3300005334 Bacteria 2857
23 Ga0070680_100076235 3300005336 Bacteria 2760
24 Ga0068868_100373557 3300005338 Bacteria 1225
25 Ga0070660_100173860 3300005339 Bacteria 1741
26 Ga0070661_100006990 3300005344 Bacteria 7789
27 Ga0070661_100085961 3300005344 Bacteria 2325
28 Ga0070668_100120499 3300005347 Bacteria 2096
29 Ga0070668_100147561 3300005347 Bacteria 1899
30 Ga0070669_100258573 3300005353 Bacteria 1389
31 Ga0070671_100056896 3300005355 Bacteria 3254
32 Ga0070663_100138787 3300005455 Bacteria 1853
33 Ga0070681_10025743 3300005458 Bacteria 5915
34 Ga0070698_100460374 3300005471 Bacteria 1208
35 Ga0070679_100058603 3300005530 Bacteria 3837
36 Ga0070679_100191857 3300005530 Bacteria 2012
37 Ga0070697_100145997 3300005536 Bacteria 1991
38 Ga0068853_100003239 3300005539 Bacteria 12442
39 Ga0068853_100030185 3300005539 Bacteria 4578
40 Ga0068853_100155546 3300005539 Bacteria 2060
41 Ga0070665_100351507 3300005548 Bacteria 1479
42 Ga0068855_100492197 3300005563 Bacteria 1334
43 Ga0068857_100011976 3300005577 Bacteria 7544
44 Ga0068854_100358906 3300005578 Bacteria 1195
45 Ga0068856_100143004 3300005614 Bacteria 2399
46 Ga0068852_100293557 3300005616 Bacteria 1571
47 Ga0068851_10046841 3300005834 Bacteria 2188
48 Ga0068863_100003503 3300005841 Bacteria 15483
49 Ga0068860_100001008 3300005843 Bacteria 31179
50 Ga0068862_100000163 3300005844 Bacteria 74506
51 Ga0081455_10049130 3300005937 Bacteria 3639
52 Ga0081540_1006315 3300005983 Bacteria 8664
53 Ga0081539_10001801 3300005985 Bacteria 33917
54 Ga0075365_10001463 3300006038 Bacteria 10723
55 Ga0075368_10000287 3300006042 Bacteria 14467
56 Ga0075363_100000904 3300006048 Bacteria 10461
57 Ga0075364_10011297 3300006051 Bacteria 5423
58 Ga0075364_10197761 3300006051 Bacteria 1362
59 Ga0075362_10001875 3300006177 Bacteria 6889
60 Ga0075367_10000871 3300006178 Bacteria 12080
61 Ga0075369_10002398 3300006186 Bacteria 6681
62 Ga0097621_100602994 3300006237 Bacteria 1004
63 Ga0068871_100700658 3300006358 Bacteria 928
64 Ga0075434_100122890 3300006871 Bacteria 2612
65 Ga0097620_100179476 3300006931 Bacteria 2200
66 Ga0105251_10031302 3300009011 Bacteria 2663
67 Ga0105250_10040418 3300009092 Bacteria 1871
68 Ga0105240_10011604 3300009093 Bacteria 12258
69 Ga0105240_10587441 3300009093 Bacteria 1228
70 Ga0111539_10480277 3300009094 Bacteria 1447
71 Ga0105247_10020612 3300009101 Bacteria 3963
72 Ga0105247_10243393 3300009101 Bacteria 1226
73 Ga0105238_10020477 3300009551 Bacteria 6734
74 Ga0105238_10052222 3300009551 Bacteria 4110
75 Ga0105249_10000067 3300009553 Bacteria 149492
76 Ga0105249_10211897 3300009553 Bacteria 1902
77 Ga0105148_100139 3300009978 Bacteria 10762
78 Ga0099796_10102566 3300010159 Bacteria 1078
79 Ga0105239_10003590 3300010375 Bacteria 18946
80 Ga0105239_10037776 3300010375 Bacteria 5292
81 Ga0105239_10045181 3300010375 Bacteria 4827
82 Ga0157370_10203875 3300013104 Bacteria 1834
83 Ga0157369_10010432 3300013105 Bacteria 10587
84 Ga0157378_10559866 3300013297 Bacteria 1150
85 Ga0163162_10169418 3300013306 Bacteria 2308
86 Ga0163162_10472758 3300013306 Bacteria 1385
87 Ga0157380_10465176 3300014326 Bacteria 1219
88 Ga0182008_10128163 3300014497 Bacteria 1264
89 Ga0209436_100259 3300025208 Bacteria 24235
90 Ga0209437_108954 3300025233 Unclassified 1580
91 Ga0207425_1003523 3300025245 Bacteria 4978
92 Ga0209129_1004554 3300025258 Bacteria 5348
93 Ga0209233_1000104 3300025261 Bacteria 272675
94 Ga0209455_1001350 3300025272 Bacteria 11283
95 Ga0209673_1000022 3300025273 Bacteria 413125
96 Ga0209130_1000598 3300025284 Bacteria 34961
97 Ga0209676_1005905 3300025292 Bacteria 6214
98 Ga0209025_1000969 3300025294 Bacteria 43045
99 Ga0209025_1002488 3300025294 Bacteria 19372
100 Ga0209564_1000163 3300025295 Bacteria 162077
101 Ga0209564_1000692 3300025295 Bacteria 49341
102 Ga0209758_1002375 3300025297 Bacteria 19372
103 Ga0209050_1006124 3300025298 Bacteria 7256
104 Ga0209256_1001225 3300025299 Bacteria 28613
105 Ga0209256_1001398 3300025299 Bacteria 25156
106 Ga0207426_1000779 3300025302 Bacteria 34961
107 Ga0207656_10040155 3300025321 Bacteria 1983
108 Ga0207710_10012667 3300025900 Bacteria 3548
109 Ga0207710_10092693 3300025900 Bacteria 1416
110 Ga0207684_10085628 3300025910 Bacteria 2684
111 Ga0207654_10077086 3300025911 Bacteria 1997
112 Ga0207707_10087741 3300025912 Bacteria 2718
113 Ga0207695_10186869 3300025913 Bacteria 1991
114 Ga0207657_10142946 3300025919 Bacteria 1954
115 Ga0207694_10099842 3300025924 Bacteria 2299
116 Ga0207679_10213491 3300025945 Bacteria 1620
117 Ga0207667_10307309 3300025949 Bacteria 1620
118 Ga0207667_10392594 3300025949 Bacteria 1413
119 Ga0207712_10000054 3300025961 Bacteria 148878
120 Ga0207712_10009711 3300025961 Bacteria 6098
121 Ga0207668_10127424 3300025972 Bacteria 1938
122 Ga0207640_10273330 3300025981 Bacteria 1323
123 Ga0207639_10011470 3300026041 Bacteria 6157
124 Ga0207678_10100384 3300026067 Bacteria 2472
125 Ga0207641_10008688 3300026088 Bacteria 8388
126 Ga0207674_10007240 3300026116 Bacteria 12947
127 Ga0207698_10291189 3300026142 Bacteria 1515
128 Ga0209813_10000027 3300027866 Bacteria 69637
129 Ga0268266_10307920 3300028379 Bacteria 1479
130 Ga0268265_10000182 3300028380 Bacteria 74651
131 Ga0268264_10003017 3300028381 Bacteria 14599
132 Ga0268264_10750260 3300028381 Bacteria 972
133 Ga0307515_10355730 3300028794 Bacteria 1108
134 Ga0307509_10172726 3300031507 Bacteria 2038
135 Ga0307508_10000090 3300031616 Bacteria 106893
136 Ga0307508_10265721 3300031616 Bacteria 1310
137 Ga0373955_0062225 3300035172 Bacteria 2064
138 Ga0373925_0165807 3300037068 Bacteria 1742
139 Ga0395900_0010066 3300037418 Bacteria 9672
140 Ga0395898_0371066 3300037466 Bacteria 1365
141 Ga0395905_0346203 3300037471 Bacteria 1378
142 Ga0395901_0046355 3300038443 Bacteria 4515
143 Ga0395901_0079329 3300038443 Bacteria 3428
144 Ga0436360_0803520 3300039438 Bacteria 1160
145 Ga0436360_0860069 3300039438 Bacteria 1339
146 Ga0436360_1211757 3300039438 Bacteria 1086
147 Ga0451791_1426729 3300041451 Bacteria 987
148 Ga0439448_0102717 3300042005 Bacteria 973
149 Ga0439435_0000469 3300042436 Bacteria 6391
150 Ga0495592_0217058 3300046454 Bacteria 1281
151 Ga0495629_0199232 3300046459 Bacteria 1385
152 Ga0495629_0245793 3300046459 Bacteria 1232
153 Ga0495638_0009959 3300046460 Bacteria 6627
154 Ga0495638_0060940 3300046460 Bacteria 2332
155 Ga0495639_0221740 3300046475 Bacteria 930
156 Ga0495648_0114698 3300046524 Bacteria 1459
157 Ga0495668_0075078 3300046616 Bacteria 1857
158 Ga0496102_0563229 3300048905 Bacteria 1062
159 Ga0496103_0109638 3300048906 Bacteria 1753
160 Ga0496107_0034512 3300048910 Bacteria 3624
161 Ga0496109_0100483 3300048912 Bacteria 2684
162 Ga0496113_0549743 3300048916 Bacteria 926
163 Ga0496121_0165241 3300048924 Bacteria 1614
164 Ga0496121_0235864 3300048924 Bacteria 1278
165 Ga0496124_0319439 3300048927 Bacteria 1112
166 Ga0496125_0086478 3300048928 Bacteria 2371
167 Ga0496126_0019907 3300048929 Bacteria 6597
168 Ga0496126_0390011 3300048929 Bacteria 1132
169 Ga0501031_0000036 3300049568 Bacteria 73760
170 Ga0501031_0000068 3300049568 Bacteria 56283
171 Ga0501031_0023006 3300049568 Bacteria 4064
172 Ga0501032_0000100 3300049569 Bacteria 73505
173 Ga0501032_0000103 3300049569 Bacteria 72143
174 Ga0501032_0004376 3300049569 Bacteria 10655
175 Ga0501032_0095544 3300049569 Bacteria 1970
176 Ga0501032_0308402 3300049569 Bacteria 1022
177 Ga0501033_0000088 3300049570 Bacteria 87638
178 Ga0501033_0000778 3300049570 Bacteria 29323
179 Ga0501033_0003728 3300049570 Bacteria 12395
180 Ga0501033_0009764 3300049570 Bacteria 7372
181 Ga0501033_0075297 3300049570 Bacteria 2477
182 Ga0501034_0000365 3300049571 Bacteria 77224
183 Ga0501034_0000397 3300049571 Bacteria 73511
184 Ga0501034_0004282 3300049571 Bacteria 15914
185 Ga0501034_0005317 3300049571 Bacteria 14111
186 Ga0501034_0039512 3300049571 Bacteria 4779
187 Ga0501034_0158801 3300049571 Bacteria 2233
188 Ga0501036_0000056 3300049572 Bacteria 73511
189 Ga0501036_0000058 3300049572 Bacteria 72516
190 Ga0501036_0000544 3300049572 Bacteria 27031
191 Ga0501036_0016280 3300049572 Bacteria 6211
192 Ga0501036_0031967 3300049572 Bacteria 4447
193 Ga0501037_0000119 3300049573 Bacteria 73510
194 Ga0501037_0000157 3300049573 Bacteria 63800
195 Ga0501037_0007051 3300049573 Bacteria 8208
196 Ga0501037_0136455 3300049573 Bacteria 1757
197 Ga0501037_0218352 3300049573 Bacteria 1342
198 Ga0501038_0000091 3300049574 Bacteria 77224
199 Ga0501038_0000098 3300049574 Bacteria 73471
200 Ga0501038_0000837 3300049574 Bacteria 27392
201 Ga0501038_0001470 3300049574 Bacteria 21665
202 Ga0501038_0014937 3300049574 Bacteria 7070
203 Ga0501038_0080716 3300049574 Bacteria 2741
204 Ga0501039_0000013 3300049575 Bacteria 234418
205 Ga0501039_0000071 3300049575 Bacteria 77224
206 Ga0501039_0001124 3300049575 Bacteria 19671
207 Ga0501040_0197695 3300049576 Bacteria 1427
208 Ga0501041_0188180 3300049577 Bacteria 1293
209 Ga0501042_0039549 3300049578 Bacteria 3352
210 Ga0501043_0001191 3300049579 Bacteria 22880
211 Ga0501043_0001914 3300049579 Bacteria 17825
212 Ga0501043_0081327 3300049579 Bacteria 2545
213 Ga0501043_0223913 3300049579 Bacteria 1454
214 Ga0501046_0003472 3300049580 Bacteria 14468
215 Ga0501046_0039551 3300049580 Bacteria 3776
216 Ga0501046_0204670 3300049580 Bacteria 1467
217 Ga0501047_0000797 3300049581 Bacteria 32944
218 Ga0501047_0014437 3300049581 Bacteria 7511
219 Ga0501047_0030775 3300049581 Bacteria 5173
220 Ga0501047_0185821 3300049581 Bacteria 1943
221 Ga0501048_0000925 3300049582 Bacteria 21630
222 Ga0501048_0054840 3300049582 Bacteria 2831
223 Ga0501068_0039477 3300049584 Bacteria 2830
224 Ga0501070_0072704 3300049586 Bacteria 2846
225 Ga0501070_0093675 3300049586 Bacteria 2485
226 Ga0501070_0105549 3300049586 Bacteria 2329
227 Ga0501073_0042427 3300049589 Bacteria 3211
228 Ga0501073_0075193 3300049589 Bacteria 2351
229 Ga0501073_0408823 3300049589 Bacteria 938
230 Ga0501074_0006277 3300049590 Bacteria 8581
231 Ga0501076_0154681 3300049592 Bacteria 1866
232 Ga0501079_0111904 3300049741 Bacteria 2122
233 Ga0501080_0008286 3300049742 Bacteria 9417
234 Ga0501080_0013473 3300049742 Bacteria 7523
235 Ga0501081_0076013 3300049743 Bacteria 2345
236 Ga0501083_0106249 3300049744 Bacteria 1848
237 Ga0501083_0239318 3300049744 Bacteria 1182
238 Ga0501035_0000053 3300049822 Bacteria 142860
239 Ga0501035_0000503 3300049822 Bacteria 44064
240 Ga0501035_0005592 3300049822 Bacteria 11870
241 Ga0501035_0013016 3300049822 Bacteria 7677
242 Ga0501035_0013388 3300049822 Bacteria 7572
243 Ga0501035_0140082 3300049822 Bacteria 2103
244 Ga0501035_0163268 3300049822 Bacteria 1927
245 Ga0501035_0424938 3300049822 Bacteria 1103
246 Ga0501044_0000214 3300049823 Bacteria 73483
247 Ga0501044_0000225 3300049823 Bacteria 71586
248 Ga0501044_0023441 3300049823 Bacteria 6564
249 Ga0501044_0042224 3300049823 Bacteria 4744
250 nmdc:mga05p37_318786_c1 3300050507 Bacteria 1840
251 nmdc:mga0n895_25121_c1 3300050512 Bacteria 5625
252 nmdc:mga08x19_149348_c1 3300050514 Bacteria 1581
253 Ga0500562_060411 3300053108 Bacteria 1018
254 Ga0500559_0078423 3300053136 Bacteria 1498
255 Ga0500622_0027369 3300053156 Bacteria 3005
256 Ga0500636_0014831 3300053177 Bacteria 4587
257 Ga0500645_049412 3300053730 Bacteria 1230
258 Ga0500601_006494 3300053737 Bacteria 1288

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025949 Ga0207667_10307309 Ga0207667_103073092 205
2 3300046459 Ga0495629_0199232 Ga0495629_0199232_407_1192 235
3 3300028794 Ga0307515_10355730 Ga0307515_103557301 236
4 iso_pu_bacteria 2510461069 2510844023 236
5 3300049586 Ga0501070_0105549 Ga0501070_0105549_808_1551 237
6 iso_pu_bacteria 2842341865 2842342724 238
7 iso_pu_bacteria 2961170736 2961176952 238
8 iso_pu_bacteria 2970503327 2970509625 238
9 iso_pu_bacteria 2979808191 2979814412 238
10 iso_pu_bacteria 3005474847 3005480979 238
11 iso_pu_bacteria 2513237137 2513856251 239
12 iso_pu_bacteria 2513237144 2513912841 239
13 iso_pu_bacteria 2513237145 2513918154 239
14 iso_pu_bacteria 2513237146 2513924087 239
15 iso_pu_bacteria 2517572143 2517891607 239
16 iso_pu_bacteria 2524023228 2524538633 239
17 iso_pu_bacteria 2599185170 2599416133 239
18 iso_pu_bacteria 2838035591 2838036254 239
19 iso_pu_bacteria 2885326080 2885332568 239
20 iso_pu_bacteria 2904699407 2904704668 239
21 iso_pu_bacteria 2906635258 2906640142 239
22 iso_pu_bacteria 2906660503 2906667109 239
23 iso_pu_bacteria 8006933436 8006939733 239
24 iso_pu_bacteria 8006973647 8006979483 239
25 3300005539 Ga0068853_100155546 Ga0068853_1001555462 240
26 3300009978 Ga0105148_100139 Ga0105148_1001392 240
27 3300025949 Ga0207667_10392594 Ga0207667_103925941 240
28 3300049744 Ga0501083_0239318 Ga0501083_0239318_252_995 240
29 iso_pu_bacteria 2643221551 2643775497 240
30 iso_pu_bacteria 2643221555 2643793943 240
31 iso_pu_bacteria 2667528175 2671118620 240
32 iso_pu_bacteria 2718217882 2719183649 240
33 iso_pu_bacteria 2718218009 2719728090 240
34 iso_pu_bacteria 2718218363 2721144951 240
35 iso_pu_bacteria 2718218365 2721155687 240
36 iso_pu_bacteria 2718218366 2721167038 240
37 iso_pu_bacteria 2721755514 2722838016 240
38 iso_pu_bacteria 2721755810 2724042284 240
39 iso_pu_bacteria 2728369365 2730161789 240
40 iso_pu_bacteria 2728369397 2730300794 240
41 iso_pu_bacteria 2791355263 2793340375 240
42 iso_pu_bacteria 2791355264 2793346133 240
43 iso_pu_bacteria 2791355266 2793358025 240
44 iso_pu_bacteria 2838022645 2838024974 240
45 iso_pu_bacteria 2838042994 2838048587 240
46 iso_pu_bacteria 2841734538 2841737603 240
47 iso_pu_bacteria 2842198810 2842202058 240
48 iso_pu_bacteria 2871474448 2871481213 240
49 iso_pu_bacteria 2878788777 2878790196 240
50 iso_pu_bacteria 2881147464 2881155038 240
51 iso_pu_bacteria 2906610324 2906616780 240
52 iso_pu_bacteria 2922425934 2922431161 240
53 iso_pu_bacteria 2936381700 2936385517 240
54 iso_pu_bacteria 2937836603 2937840162 240
55 iso_pu_bacteria 2958071322 2958072779 240
56 iso_pu_bacteria 3004268573 3004268984 240
57 iso_pu_bacteria 8003570095 8003575338 240
58 iso_pu_bacteria 8004633249 8004633893 240
59 iso_pu_bacteria 8019555841 8019565630 240
60 iso_pu_bacteria 8019565922 8019575726 240
61 3300003214 JGI25165J46597_1000041 JGI25165J46597_100004121 241
62 3300005336 Ga0070680_100076235 Ga0070680_1000762355 241
63 3300005339 Ga0070660_100173860 Ga0070660_1001738602 241
64 3300005344 Ga0070661_100006990 Ga0070661_1000069905 241
65 3300005353 Ga0070669_100258573 Ga0070669_1002585731 241
66 3300005458 Ga0070681_10025743 Ga0070681_100257432 241
67 3300005530 Ga0070679_100058603 Ga0070679_1000586033 241
68 3300005539 Ga0068853_100030185 Ga0068853_1000301855 241
69 3300005614 Ga0068856_100143004 Ga0068856_1001430042 241
70 3300005616 Ga0068852_100293557 Ga0068852_1002935572 241
71 3300005985 Ga0081539_10001801 Ga0081539_1000180123 241
72 3300009093 Ga0105240_10011604 Ga0105240_100116044 241
73 3300009551 Ga0105238_10052222 Ga0105238_100522222 241
74 3300010375 Ga0105239_10045181 Ga0105239_100451812 241
75 3300013104 Ga0157370_10203875 Ga0157370_102038752 241
76 3300013105 Ga0157369_10010432 Ga0157369_1001043211 241
77 3300025233 Ga0209437_108954 Ga0209437_1089543 241
78 3300025261 Ga0209233_1000104 Ga0209233_100010421 241
79 3300025912 Ga0207707_10087741 Ga0207707_100877412 241
80 3300025913 Ga0207695_10186869 Ga0207695_101868692 241
81 3300025919 Ga0207657_10142946 Ga0207657_101429463 241
82 3300025981 Ga0207640_10273330 Ga0207640_102733302 241
83 3300026142 Ga0207698_10291189 Ga0207698_102911892 241
84 3300048924 Ga0496121_0235864 Ga0496121_0235864_273_1016 241
85 iso_pu_bacteria 2524023209 2524460929 241
86 iso_pu_bacteria 2643221607 2644047521 241
87 iso_pu_bacteria 2643221610 2644070272 241
88 iso_pu_bacteria 2643221675 2644421034 241
89 iso_pu_bacteria 2643221680 2644454557 241
90 iso_pu_bacteria 2643221686 2644480988 241
91 iso_pu_bacteria 2643221726 2644692496 241
92 iso_pu_bacteria 2837678835 2837681480 241
93 iso_pu_bacteria 2842298080 2842298942 241
94 iso_pu_bacteria 2842357229 2842359190 241
95 iso_pu_bacteria 2874123672 2874126743 241
96 iso_pu_bacteria 2874139085 2874143602 241
97 iso_pu_bacteria 2876369609 2876375151 241
98 iso_pu_bacteria 8004695233 8004699806 241
99 3300005347 Ga0070668_100147561 Ga0070668_1001475612 242
100 3300005548 Ga0070665_100351507 Ga0070665_1003515072 242
101 3300006871 Ga0075434_100122890 Ga0075434_1001228903 242
102 3300009553 Ga0105249_10211897 Ga0105249_102118972 242
103 3300013306 Ga0163162_10472758 Ga0163162_104727581 242
104 3300025961 Ga0207712_10009711 Ga0207712_100097117 242
105 3300025972 Ga0207668_10127424 Ga0207668_101274242 242
106 3300028379 Ga0268266_10307920 Ga0268266_103079202 242
107 3300039438 Ga0436360_0860069 Ga0436360_0860069_431_1174 242
108 3300049569 Ga0501032_0308402 Ga0501032_0308402_61_825 242
109 3300049572 Ga0501036_0016280 Ga0501036_0016280_4849_5769 242
110 3300049573 Ga0501037_0136455 Ga0501037_0136455_619_1539 242
111 3300049579 Ga0501043_0223913 Ga0501043_0223913_106_870 242
112 3300049581 Ga0501047_0185821 Ga0501047_0185821_230_1150 242
113 3300049582 Ga0501048_0054840 Ga0501048_0054840_229_1149 242
114 3300049586 Ga0501070_0072704 Ga0501070_0072704_1212_2132 242
115 3300049589 Ga0501073_0042427 Ga0501073_0042427_2049_2969 242
116 3300049590 Ga0501074_0006277 Ga0501074_0006277_49_813 242
117 3300049742 Ga0501080_0008286 Ga0501080_0008286_8441_9205 242
118 3300049744 Ga0501083_0106249 Ga0501083_0106249_330_1250 242
119 3300049822 Ga0501035_0163268 Ga0501035_0163268_794_1558 242
120 3300050512 nmdc:mga0n895_25121_c1 nmdc:mga0n895_25121_c1_1013_1774 242
121 iso_pu_bacteria 2847686936 2847691684 242
122 iso_pu_bacteria 2856314179 2856315548 242
123 iso_pu_bacteria 2874102143 2874108890 242
124 iso_pu_bacteria 2878035449 2878037220 242
125 iso_pu_bacteria 2885334103 2885341555 242
126 iso_pu_bacteria 2906328253 2906329447 242
127 iso_pu_bacteria 2906414383 2906415685 242
128 iso_pu_bacteria 2937891427 2937895790 242
129 iso_pu_bacteria 2937994558 2937994845 242
130 iso_pu_bacteria 2958115193 2958122067 242
131 iso_pu_bacteria 2958165035 2958165325 242
132 iso_pu_bacteria 2961163497 2961163783 242
133 iso_pu_bacteria 2965018300 2965018588 242
134 iso_pu_bacteria 2968097103 2968102907 242
135 iso_pu_bacteria 2968117919 2968118305 242
136 iso_pu_bacteria 2968128360 2968131054 242
137 iso_pu_bacteria 2968171901 2968172189 242
138 iso_pu_bacteria 2970554993 2970555279 242
139 iso_pu_bacteria 2977858184 2977861366 242
140 iso_pu_bacteria 2979779861 2979780410 242
141 iso_pu_bacteria 2987659509 2987659795 242
142 iso_pu_bacteria 3004188549 3004188842 242
143 iso_pu_bacteria 8004445564 8004448183 242
144 iso_pu_bacteria 8004703790 8004712930 242
145 3300003771 Ga0055526_1009369 Ga0055526_10093692 243
146 3300003771 Ga0055526_1013021 Ga0055526_10130212 243
147 3300003775 Ga0055524_1022021 Ga0055524_10220212 243
148 3300003790 Ga0055528_1005587 Ga0055528_10055874 243
149 3300005344 Ga0070661_100085961 Ga0070661_1000859612 243
150 3300005530 Ga0070679_100191857 Ga0070679_1001918572 243
151 3300005539 Ga0068853_100003239 Ga0068853_10000323914 243
152 3300005577 Ga0068857_100011976 Ga0068857_1000119763 243
153 3300005834 Ga0068851_10046841 Ga0068851_100468412 243
154 3300006237 Ga0097621_100602994 Ga0097621_1006029941 243
155 3300006358 Ga0068871_100700658 Ga0068871_1007006581 243
156 3300006931 Ga0097620_100179476 Ga0097620_1001794763 243
157 3300009093 Ga0105240_10587441 Ga0105240_105874411 243
158 3300009101 Ga0105247_10243393 Ga0105247_102433932 243
159 3300010375 Ga0105239_10003590 Ga0105239_100035909 243
160 3300010375 Ga0105239_10037776 Ga0105239_100377763 243
161 3300013297 Ga0157378_10559866 Ga0157378_105598662 243
162 3300025273 Ga0209673_1000022 Ga0209673_1000022259 243
163 3300025295 Ga0209564_1000163 Ga0209564_10001639 243
164 3300025299 Ga0209256_1001398 Ga0209256_10013989 243
165 3300025321 Ga0207656_10040155 Ga0207656_100401553 243
166 3300025900 Ga0207710_10092693 Ga0207710_100926932 243
167 3300025911 Ga0207654_10077086 Ga0207654_100770863 243
168 3300026041 Ga0207639_10011470 Ga0207639_100114706 243
169 3300026116 Ga0207674_10007240 Ga0207674_100072407 243
170 3300042436 Ga0439435_0000469 Ga0439435_0000469_4945_5730 243
171 3300046460 Ga0495638_0060940 Ga0495638_0060940_900_1670 243
172 3300048910 Ga0496107_0034512 Ga0496107_0034512_1098_1871 243
173 iso_pu_bacteria 8045864390 8045868466 243
174 3300005334 Ga0068869_100056720 Ga0068869_1000567202 244
175 3300005338 Ga0068868_100373557 Ga0068868_1003735572 244
176 3300005347 Ga0070668_100120499 Ga0070668_1001204993 244
177 3300005455 Ga0070663_100138787 Ga0070663_1001387872 244
178 3300005563 Ga0068855_100492197 Ga0068855_1004921971 244
179 3300005578 Ga0068854_100358906 Ga0068854_1003589061 244
180 3300005841 Ga0068863_100003503 Ga0068863_1000035032 244
181 3300005843 Ga0068860_100001008 Ga0068860_1000010082 244
182 3300005844 Ga0068862_100000163 Ga0068862_10000016327 244
183 3300005937 Ga0081455_10049130 Ga0081455_100491305 244
184 3300005983 Ga0081540_1006315 Ga0081540_10063157 244
185 3300006051 Ga0075364_10197761 Ga0075364_101977612 244
186 3300009094 Ga0111539_10480277 Ga0111539_104802772 244
187 3300009101 Ga0105247_10020612 Ga0105247_100206123 244
188 3300009553 Ga0105249_10000067 Ga0105249_1000006721 244
189 3300013306 Ga0163162_10169418 Ga0163162_101694182 244
190 3300014326 Ga0157380_10465176 Ga0157380_104651761 244
191 3300014497 Ga0182008_10128163 Ga0182008_101281631 244
192 3300025272 Ga0209455_1001350 Ga0209455_10013503 244
193 3300025900 Ga0207710_10012667 Ga0207710_100126673 244
194 3300025945 Ga0207679_10213491 Ga0207679_102134912 244
195 3300025961 Ga0207712_10000054 Ga0207712_1000005419 244
196 3300026067 Ga0207678_10100384 Ga0207678_101003842 244
197 3300026088 Ga0207641_10008688 Ga0207641_100086882 244
198 3300028380 Ga0268265_10000182 Ga0268265_1000018228 244
199 3300028381 Ga0268264_10003017 Ga0268264_100030176 244
200 3300031507 Ga0307509_10172726 Ga0307509_101727261 244
201 3300031616 Ga0307508_10000090 Ga0307508_1000009047 244
202 3300031616 Ga0307508_10265721 Ga0307508_102657211 244
203 3300037471 Ga0395905_0346203 Ga0395905_0346203_114_869 244
204 3300039438 Ga0436360_0803520 Ga0436360_0803520_154_912 244
205 3300039438 Ga0436360_1211757 Ga0436360_1211757_163_930 244
206 3300041451 Ga0451791_1426729 Ga0451791_1426729_177_944 244
207 3300042005 Ga0439448_0102717 Ga0439448_0102717_61_828 244
208 3300046454 Ga0495592_0217058 Ga0495592_0217058_447_1220 244
209 3300046459 Ga0495629_0245793 Ga0495629_0245793_335_1144 244
210 3300046460 Ga0495638_0009959 Ga0495638_0009959_1563_2324 244
211 3300046616 Ga0495668_0075078 Ga0495668_0075078_465_1220 244
212 3300048905 Ga0496102_0563229 Ga0496102_0563229_194_958 244
213 3300048906 Ga0496103_0109638 Ga0496103_0109638_303_1067 244
214 3300048912 Ga0496109_0100483 Ga0496109_0100483_1096_1863 244
215 3300048916 Ga0496113_0549743 Ga0496113_0549743_11_778 244
216 3300048924 Ga0496121_0165241 Ga0496121_0165241_651_1442 244
217 3300048927 Ga0496124_0319439 Ga0496124_0319439_113_883 244
218 3300048928 Ga0496125_0086478 Ga0496125_0086478_1366_2136 244
219 3300048929 Ga0496126_0019907 Ga0496126_0019907_4681_5472 244
220 3300049574 Ga0501038_0000837 Ga0501038_0000837_6010_6777 244
221 3300049822 Ga0501035_0424938 Ga0501035_0424938_17_784 244
222 3300050507 nmdc:mga05p37_318786_c1 nmdc:mga05p37_318786_c1_161_952 244
223 3300050514 nmdc:mga08x19_149348_c1 nmdc:mga08x19_149348_c1_142_909 244
224 3300053108 Ga0500562_060411 Ga0500562_060411_133_900 244
225 3300053177 Ga0500636_0014831 Ga0500636_0014831_3235_4005 244
226 3300053730 Ga0500645_049412 Ga0500645_049412_11_778 244
227 3300053737 Ga0500601_006494 Ga0500601_006494_141_911 244
228 iso_pu_bacteria 2508501127 2509142334 244
229 iso_pu_bacteria 2885312484 2885313001 244
230 iso_pu_bacteria 2941507105 2941510901 244
231 iso_pu_bacteria 2941515067 2941518285 244
232 iso_pu_bacteria 2941523033 2941526844 244
233 3300002987 JGI25159J45721_1000175 JGI25159J45721_10001756 245
234 3300003187 JGI25151J46595_10000373 JGI25151J46595_1000037352 245
235 3300003187 JGI25151J46595_10001163 JGI25151J46595_100011632 245
236 3300003215 JGI25153J46596_10003023 JGI25153J46596_100030233 245
237 3300003354 JGI25160J50197_1000365 JGI25160J50197_10003656 245
238 3300003354 JGI25160J50197_1039406 JGI25160J50197_10394061 245
239 3300003374 JGI25161J50226_1000280 JGI25161J50226_100028035 245
240 3300003771 Ga0055526_1001092 Ga0055526_10010927 245
241 3300003775 Ga0055524_1008274 Ga0055524_10082742 245
242 3300003781 Ga0055536_1009544 Ga0055536_10095444 245
243 3300003790 Ga0055528_1000638 Ga0055528_10006385 245
244 3300003791 Ga0055530_10021428 Ga0055530_100214283 245
245 3300003794 Ga0055531_10011368 Ga0055531_100113684 245
246 3300004625 Ga0055543_1000372 Ga0055543_10003726 245
247 3300005262 Ga0065165_1001221 Ga0065165_10012216 245
248 3300005331 Ga0070670_100366761 Ga0070670_1003667611 245
249 3300005355 Ga0070671_100056896 Ga0070671_1000568963 245
250 3300005471 Ga0070698_100460374 Ga0070698_1004603742 245
251 3300005536 Ga0070697_100145997 Ga0070697_1001459971 245
252 3300006038 Ga0075365_10001463 Ga0075365_1000146310 245
253 3300006042 Ga0075368_10000287 Ga0075368_1000028712 245
254 3300006048 Ga0075363_100000904 Ga0075363_1000009046 245
255 3300006051 Ga0075364_10011297 Ga0075364_100112972 245
256 3300006177 Ga0075362_10001875 Ga0075362_100018758 245
257 3300006178 Ga0075367_10000871 Ga0075367_1000087111 245
258 3300006186 Ga0075369_10002398 Ga0075369_100023985 245
259 3300009011 Ga0105251_10031302 Ga0105251_100313021 245
260 3300009092 Ga0105250_10040418 Ga0105250_100404182 245
261 3300009551 Ga0105238_10020477 Ga0105238_100204775 245
262 3300010159 Ga0099796_10102566 Ga0099796_101025661 245
263 3300025208 Ga0209436_100259 Ga0209436_1002593 245
264 3300025245 Ga0207425_1003523 Ga0207425_10035232 245
265 3300025258 Ga0209129_1004554 Ga0209129_10045542 245
266 3300025284 Ga0209130_1000598 Ga0209130_10005986 245
267 3300025292 Ga0209676_1005905 Ga0209676_10059054 245
268 3300025294 Ga0209025_1000969 Ga0209025_10009696 245
269 3300025294 Ga0209025_1002488 Ga0209025_10024882 245
270 3300025295 Ga0209564_1000692 Ga0209564_100069252 245
271 3300025297 Ga0209758_1002375 Ga0209758_10023752 245
272 3300025298 Ga0209050_1006124 Ga0209050_10061245 245
273 3300025299 Ga0209256_1001225 Ga0209256_100122513 245
274 3300025302 Ga0207426_1000779 Ga0207426_10007796 245
275 3300025910 Ga0207684_10085628 Ga0207684_100856281 245
276 3300025924 Ga0207694_10099842 Ga0207694_100998423 245
277 3300027866 Ga0209813_10000027 Ga0209813_1000002757 245
278 3300028381 Ga0268264_10750260 Ga0268264_107502601 245
279 3300035172 Ga0373955_0062225 Ga0373955_0062225_715_1500 245
280 3300037068 Ga0373925_0165807 Ga0373925_0165807_714_1499 245
281 3300037418 Ga0395900_0010066 Ga0395900_0010066_7746_8501 245
282 3300037466 Ga0395898_0371066 Ga0395898_0371066_441_1196 245
283 3300038443 Ga0395901_0046355 Ga0395901_0046355_940_1719 245
284 3300038443 Ga0395901_0079329 Ga0395901_0079329_1045_1800 245
285 3300046475 Ga0495639_0221740 Ga0495639_0221740_43_828 245
286 3300046524 Ga0495648_0114698 Ga0495648_0114698_272_1018 245
287 3300048929 Ga0496126_0390011 Ga0496126_0390011_235_1020 245
288 3300049568 Ga0501031_0000036 Ga0501031_0000036_42613_43380 245
289 3300049568 Ga0501031_0000068 Ga0501031_0000068_31796_32548 245
290 3300049568 Ga0501031_0023006 Ga0501031_0023006_2084_2887 245
291 3300049569 Ga0501032_0000100 Ga0501032_0000100_30425_31192 245
292 3300049569 Ga0501032_0000103 Ga0501032_0000103_31824_32576 245
293 3300049569 Ga0501032_0004376 Ga0501032_0004376_6895_7698 245
294 3300049569 Ga0501032_0095544 Ga0501032_0095544_263_1027 245
295 3300049570 Ga0501033_0000088 Ga0501033_0000088_42314_43081 245
296 3300049570 Ga0501033_0000778 Ga0501033_0000778_4156_4908 245
297 3300049570 Ga0501033_0003728 Ga0501033_0003728_2116_2919 245
298 3300049570 Ga0501033_0009764 Ga0501033_0009764_1679_2482 245
299 3300049570 Ga0501033_0075297 Ga0501033_0075297_872_1636 245
300 3300049571 Ga0501034_0000365 Ga0501034_0000365_44649_45401 245
301 3300049571 Ga0501034_0000397 Ga0501034_0000397_30431_31198 245
302 3300049571 Ga0501034_0004282 Ga0501034_0004282_6895_7698 245
303 3300049571 Ga0501034_0005317 Ga0501034_0005317_5951_6742 245
304 3300049571 Ga0501034_0039512 Ga0501034_0039512_2489_3292 245
305 3300049571 Ga0501034_0158801 Ga0501034_0158801_1200_1946 245
306 3300049572 Ga0501036_0000056 Ga0501036_0000056_30431_31198 245
307 3300049572 Ga0501036_0000058 Ga0501036_0000058_31824_32576 245
308 3300049572 Ga0501036_0000544 Ga0501036_0000544_18168_18971 245
309 3300049572 Ga0501036_0031967 Ga0501036_0031967_564_1463 245
310 3300049573 Ga0501037_0000119 Ga0501037_0000119_30430_31197 245
311 3300049573 Ga0501037_0000157 Ga0501037_0000157_31824_32576 245
312 3300049573 Ga0501037_0007051 Ga0501037_0007051_4075_4878 245
313 3300049573 Ga0501037_0218352 Ga0501037_0218352_409_1155 245
314 3300049574 Ga0501038_0000091 Ga0501038_0000091_44649_45401 245
315 3300049574 Ga0501038_0000098 Ga0501038_0000098_30404_31171 245
316 3300049574 Ga0501038_0001470 Ga0501038_0001470_9477_10280 245
317 3300049574 Ga0501038_0014937 Ga0501038_0014937_2934_3737 245
318 3300049574 Ga0501038_0080716 Ga0501038_0080716_227_991 245
319 3300049575 Ga0501039_0000013 Ga0501039_0000013_42314_43081 245
320 3300049575 Ga0501039_0000071 Ga0501039_0000071_31824_32576 245
321 3300049575 Ga0501039_0001124 Ga0501039_0001124_12141_12944 245
322 3300049576 Ga0501040_0197695 Ga0501040_0197695_93_860 245
323 3300049577 Ga0501041_0188180 Ga0501041_0188180_236_1012 245
324 3300049578 Ga0501042_0039549 Ga0501042_0039549_544_1320 245
325 3300049579 Ga0501043_0001191 Ga0501043_0001191_14232_14999 245
326 3300049579 Ga0501043_0001914 Ga0501043_0001914_10128_10931 245
327 3300049579 Ga0501043_0081327 Ga0501043_0081327_296_1060 245
328 3300049580 Ga0501046_0003472 Ga0501046_0003472_9493_10296 245
329 3300049580 Ga0501046_0039551 Ga0501046_0039551_1756_2508 245
330 3300049580 Ga0501046_0204670 Ga0501046_0204670_88_855 245
331 3300049581 Ga0501047_0000797 Ga0501047_0000797_13885_14688 245
332 3300049581 Ga0501047_0014437 Ga0501047_0014437_1716_2468 245
333 3300049581 Ga0501047_0030775 Ga0501047_0030775_2180_2947 245
334 3300049582 Ga0501048_0000925 Ga0501048_0000925_15682_16485 245
335 3300049584 Ga0501068_0039477 Ga0501068_0039477_641_1444 245
336 3300049586 Ga0501070_0093675 Ga0501070_0093675_1239_2006 245
337 3300049589 Ga0501073_0075193 Ga0501073_0075193_841_1644 245
338 3300049589 Ga0501073_0408823 Ga0501073_0408823_83_841 245
339 3300049592 Ga0501076_0154681 Ga0501076_0154681_59_835 245
340 3300049741 Ga0501079_0111904 Ga0501079_0111904_161_937 245
341 3300049742 Ga0501080_0013473 Ga0501080_0013473_1798_2601 245
342 3300049743 Ga0501081_0076013 Ga0501081_0076013_265_1041 245
343 3300049822 Ga0501035_0000053 Ga0501035_0000053_99780_100547 245
344 3300049822 Ga0501035_0000503 Ga0501035_0000503_11489_12241 245
345 3300049822 Ga0501035_0005592 Ga0501035_0005592_6895_7698 245
346 3300049822 Ga0501035_0013016 Ga0501035_0013016_4487_5386 245
347 3300049822 Ga0501035_0013388 Ga0501035_0013388_4447_5250 245
348 3300049822 Ga0501035_0140082 Ga0501035_0140082_792_1556 245
349 3300049823 Ga0501044_0000214 Ga0501044_0000214_42314_43081 245
350 3300049823 Ga0501044_0000225 Ga0501044_0000225_39011_39763 245
351 3300049823 Ga0501044_0023441 Ga0501044_0023441_1897_2700 245
352 3300049823 Ga0501044_0042224 Ga0501044_0042224_1842_2645 245
353 3300053136 Ga0500559_0078423 Ga0500559_0078423_18_758 245
354 3300053156 Ga0500622_0027369 Ga0500622_0027369_675_1415 245
355 iso_pu_bacteria 2643221564 2643839874 245
356 iso_pu_bacteria 2968128360 2968132344 245
357 iso_pu_bacteria 2977864932 2977865024 245
358 iso_pu_bacteria 2977942078 2977944625 245
359 iso_pu_bacteria 2987636660 2987638871 245
360 iso_pu_bacteria 3004203850 3004204885 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01936

NYN

NYN domain

61

199

0.96

PF12872

OST-HTH

OST-HTH/LOTUS domain

219

287

0.88

Feature Viewer

pLDDT pTM Quality
64.21 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map