F421762
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 360 | 221 | 293 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300005288|Ga0065714_10008366|Ga0065714_100083662 |
| Length | 240 |
| Sequence | VSPQKKRGRAIRCNLLCRTPAQKDLHYYPSHSRIHKXIKDMKKIFIINGSQNFAHSGGKFNQTVTDWTIEYLTNSKQFEIKTTDIKQDFNLDEEVEKFVWADVVVYHTPVWWFQLPXLFKKYIDDVFTAGHNKGIYRXDGRTRTNPDINYGTGGQLHGRKYXLTTSWNAPATAFTIPGEFFEETTVDEGAMFGFHKMNKFVGMEKLNSFHFHDVEKGATAENIDIFKENYTKHLEKTFNF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 3 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 4 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 5 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 6 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 7 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 8 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 9 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 10 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 11 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 12 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 13 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 14 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 15 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 16 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 17 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 18 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 19 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 20 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 21 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 22 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 23 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 24 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 25 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 26 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 27 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 28 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 29 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 30 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 31 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 32 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 33 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 34 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 35 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 36 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 37 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 38 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 39 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 40 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 41 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 42 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 43 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 44 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 45 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 46 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 47 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 48 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 49 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 50 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 51 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 52 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 53 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 54 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 55 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 56 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 57 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 58 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 59 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 60 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 61 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 62 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 63 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 64 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 65 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 66 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 67 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 68 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 69 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 70 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 71 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 72 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 73 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 74 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 75 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 76 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 77 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 78 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 80 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 81 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 82 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 83 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 84 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 85 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 94 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 144 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 146 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 151 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 152 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 154 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 155 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 156 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 157 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 158 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 159 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 160 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 161 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 162 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 163 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 164 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 165 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 195 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 196 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 197 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 198 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 199 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 200 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 203 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 204 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 205 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 206 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 207 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 208 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 209 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 210 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 211 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 212 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 213 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 214 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 215 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 216 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 217 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 218 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 219 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 220 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 221 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.39 |
| Metatranscriptomes | 0 |
| Isolates | 18.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 10.56 |
| Nodule | 1.11 |
| Rhizoplane | 1.11 |
| Rhizosphere | 70 |
| Stem | 0 |
| Stem Tuber | 0.83 |
| Unclassified | 16.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_493616 | 2162886007 | Bacteria | 15810 |
| 2 | JGI24740J21852_10057255 | 3300001979 | Bacteria | 1089 |
| 3 | JGI24735J21928_10000015 | 3300002067 | Bacteria | 167231 |
| 4 | JGI25162J39368_1000171 | 3300002737 | Bacteria | 71375 |
| 5 | JGI25152J39213_1000080 | 3300002773 | Bacteria | 65432 |
| 6 | JGI25150J39212_1000003 | 3300002774 | Bacteria | 508651 |
| 7 | JGI25150J39212_1000004 | 3300002774 | Bacteria | 417320 |
| 8 | JGI25151J46595_10000002 | 3300003187 | Bacteria | 731381 |
| 9 | JGI25153J46596_10000015 | 3300003215 | Bacteria | 289820 |
| 10 | rootH1_10022763 | 3300003316 | Bacteria | 25979 |
| 11 | rootH1_10104739 | 3300003316 | Bacteria | 1544 |
| 12 | rootH1_10170388 | 3300003316 | Bacteria | 4226 |
| 13 | rootH2_10145843 | 3300003320 | Bacteria | 3446 |
| 14 | rootH2_10151793 | 3300003320 | Bacteria | 2164 |
| 15 | rootH2_10184950 | 3300003320 | Bacteria | 3337 |
| 16 | rootL2_10054374 | 3300003322 | Bacteria | 7717 |
| 17 | rootL2_10144509 | 3300003322 | Bacteria | 2864 |
| 18 | rootL2_10233825 | 3300003322 | Bacteria | 2497 |
| 19 | rootL2_10353207 | 3300003322 | Bacteria | 1866 |
| 20 | rootH1_10028500 | 3300003323 | Bacteria | 3154 |
| 21 | rootH1_10057376 | 3300003323 | Bacteria | 8484 |
| 22 | rootH1_10240674 | 3300003323 | Bacteria | 3618 |
| 23 | Ga0055536_1000006 | 3300003781 | Bacteria | 347733 |
| 24 | Ga0055536_1009709 | 3300003781 | Bacteria | 3936 |
| 25 | Ga0055530_10006662 | 3300003791 | Bacteria | 5092 |
| 26 | Ga0055531_10002510 | 3300003794 | Bacteria | 12238 |
| 27 | Ga0058692_1000007 | 3300003856 | Bacteria | 366313 |
| 28 | Ga0065165_1000032 | 3300005262 | Bacteria | 216051 |
| 29 | Ga0065165_1003607 | 3300005262 | Bacteria | 10627 |
| 30 | Ga0065703_1000518 | 3300005272 | Bacteria | 17476 |
| 31 | Ga0065714_10005243 | 3300005288 | Bacteria | 6984 |
| 32 | Ga0065714_10005588 | 3300005288 | Bacteria | 9018 |
| 33 | Ga0065714_10008366 | 3300005288 | Bacteria | 5187 |
| 34 | Ga0065714_10064455 | 3300005288 | Bacteria | 72722 |
| 35 | Ga0065714_10064606 | 3300005288 | Bacteria | 29406 |
| 36 | Ga0065714_10064664 | 3300005288 | Bacteria | 25064 |
| 37 | Ga0065714_10071025 | 3300005288 | Bacteria | 3688 |
| 38 | Ga0065714_10219981 | 3300005288 | Bacteria | 843 |
| 39 | Ga0065704_10000193 | 3300005289 | Bacteria | 203271 |
| 40 | Ga0065704_10075292 | 3300005289 | Bacteria | 5676 |
| 41 | Ga0065704_10171380 | 3300005289 | Bacteria | 1288 |
| 42 | Ga0065704_10185969 | 3300005289 | Bacteria | 1213 |
| 43 | Ga0065704_10338918 | 3300005289 | Bacteria | 826 |
| 44 | Ga0065704_10492518 | 3300005289 | Bacteria | 673 |
| 45 | Ga0070683_100003403 | 3300005329 | Bacteria | 12899 |
| 46 | Ga0070669_100001186 | 3300005353 | Bacteria | 18974 |
| 47 | Ga0070673_100063767 | 3300005364 | Bacteria | 2933 |
| 48 | Ga0070684_100018835 | 3300005535 | Bacteria | 5697 |
| 49 | Ga0068853_100037329 | 3300005539 | Bacteria | 4133 |
| 50 | Ga0070665_100003763 | 3300005548 | Bacteria | 16056 |
| 51 | Ga0068855_100049932 | 3300005563 | Bacteria | 4932 |
| 52 | Ga0068855_100064190 | 3300005563 | Bacteria | 4282 |
| 53 | Ga0068855_100085816 | 3300005563 | Bacteria | 3642 |
| 54 | Ga0068857_100180364 | 3300005577 | Bacteria | 1922 |
| 55 | Ga0068854_100021448 | 3300005578 | Bacteria | 4384 |
| 56 | Ga0099826_10067979 | 3300006948 | Bacteria | 2277 |
| 57 | Ga0105251_10039533 | 3300009011 | Bacteria | 2304 |
| 58 | Ga0105251_10044188 | 3300009011 | Bacteria | 2153 |
| 59 | Ga0105251_10101541 | 3300009011 | Bacteria | 1315 |
| 60 | Ga0105251_10342046 | 3300009011 | Bacteria | 682 |
| 61 | Ga0105251_10342048 | 3300009011 | Bacteria | 682 |
| 62 | Ga0105244_10000002 | 3300009036 | Bacteria | 495554 |
| 63 | Ga0105244_10009783 | 3300009036 | Bacteria | 5857 |
| 64 | Ga0105244_10014711 | 3300009036 | Bacteria | 4517 |
| 65 | Ga0105244_10015422 | 3300009036 | Bacteria | 4383 |
| 66 | Ga0105244_10029561 | 3300009036 | Bacteria | 2926 |
| 67 | Ga0105244_10041228 | 3300009036 | Bacteria | 2393 |
| 68 | Ga0105244_10053045 | 3300009036 | Bacteria | 2062 |
| 69 | Ga0105244_10080307 | 3300009036 | Bacteria | 1615 |
| 70 | Ga0105250_10000432 | 3300009092 | Bacteria | 30665 |
| 71 | Ga0105250_10018375 | 3300009092 | Bacteria | 2832 |
| 72 | Ga0105250_10223974 | 3300009092 | Bacteria | 798 |
| 73 | Ga0105240_10000242 | 3300009093 | Bacteria | 108001 |
| 74 | Ga0105240_10000339 | 3300009093 | Bacteria | 87543 |
| 75 | Ga0105240_10003913 | 3300009093 | Bacteria | 23003 |
| 76 | Ga0105240_10262067 | 3300009093 | Bacteria | 1993 |
| 77 | Ga0105247_10000887 | 3300009101 | Bacteria | 22551 |
| 78 | Ga0105243_10000835 | 3300009148 | Bacteria | 29277 |
| 79 | Ga0105241_10558396 | 3300009174 | Bacteria | 1029 |
| 80 | Ga0105237_10010324 | 3300009545 | Bacteria | 9948 |
| 81 | Ga0105237_10013808 | 3300009545 | Bacteria | 8453 |
| 82 | Ga0105237_10976174 | 3300009545 | Unclassified | 854 |
| 83 | Ga0105249_10002538 | 3300009553 | Bacteria | 15801 |
| 84 | Ga0105239_10000446 | 3300010375 | Bacteria | 60289 |
| 85 | Ga0105239_10000639 | 3300010375 | Bacteria | 49788 |
| 86 | Ga0105239_10011656 | 3300010375 | Bacteria | 9813 |
| 87 | Ga0105239_10117721 | 3300010375 | Bacteria | 2948 |
| 88 | Ga0105239_10118772 | 3300010375 | Bacteria | 2934 |
| 89 | Ga0157373_10000136 | 3300013100 | Bacteria | 57912 |
| 90 | Ga0157373_10003024 | 3300013100 | Bacteria | 12688 |
| 91 | Ga0157373_10024869 | 3300013100 | Bacteria | 4336 |
| 92 | Ga0157373_10157620 | 3300013100 | Bacteria | 1597 |
| 93 | Ga0157371_10000296 | 3300013102 | Bacteria | 66267 |
| 94 | Ga0157371_10008252 | 3300013102 | Bacteria | 8323 |
| 95 | Ga0157371_10009342 | 3300013102 | Bacteria | 7729 |
| 96 | Ga0157371_10023987 | 3300013102 | Bacteria | 4456 |
| 97 | Ga0157371_10093708 | 3300013102 | Bacteria | 2128 |
| 98 | Ga0157370_10000197 | 3300013104 | Bacteria | 75846 |
| 99 | Ga0157370_10001827 | 3300013104 | Bacteria | 26213 |
| 100 | Ga0157370_10004056 | 3300013104 | Bacteria | 16989 |
| 101 | Ga0157370_10010170 | 3300013104 | Bacteria | 9934 |
| 102 | Ga0157370_10012813 | 3300013104 | Bacteria | 8668 |
| 103 | Ga0157370_10021434 | 3300013104 | Bacteria | 6439 |
| 104 | Ga0157370_10055256 | 3300013104 | Bacteria | 3783 |
| 105 | Ga0157370_10073031 | 3300013104 | Bacteria | 3237 |
| 106 | Ga0157370_10127533 | 3300013104 | Bacteria | 2375 |
| 107 | Ga0157370_10906770 | 3300013104 | Bacteria | 800 |
| 108 | Ga0157369_10000164 | 3300013105 | Bacteria | 94229 |
| 109 | Ga0157369_10255347 | 3300013105 | Bacteria | 1829 |
| 110 | Ga0163162_10000065 | 3300013306 | Bacteria | 102191 |
| 111 | Ga0163162_10015976 | 3300013306 | Bacteria | 7337 |
| 112 | Ga0157372_10008795 | 3300013307 | Bacteria | 10724 |
| 113 | Ga0157375_10899861 | 3300013308 | Bacteria | 1029 |
| 114 | Ga0182008_10000018 | 3300014497 | Bacteria | 230609 |
| 115 | Ga0182008_10000082 | 3300014497 | Bacteria | 74716 |
| 116 | Ga0182008_10007064 | 3300014497 | Bacteria | 6224 |
| 117 | Ga0182008_10195776 | 3300014497 | Bacteria | 1027 |
| 118 | Ga0182006_1000194 | 3300015261 | Bacteria | 62654 |
| 119 | Ga0182006_1000324 | 3300015261 | Bacteria | 41463 |
| 120 | Ga0182006_1007528 | 3300015261 | Bacteria | 4976 |
| 121 | Ga0182006_1032996 | 3300015261 | Bacteria | 2078 |
| 122 | Ga0182007_10000005 | 3300015262 | Bacteria | 442702 |
| 123 | Ga0182007_10009115 | 3300015262 | Bacteria | 4033 |
| 124 | Ga0182007_10033102 | 3300015262 | Bacteria | 1753 |
| 125 | Ga0182007_10049684 | 3300015262 | Bacteria | 1385 |
| 126 | Ga0182007_10094038 | 3300015262 | Bacteria | 988 |
| 127 | Ga0182005_1000224 | 3300015265 | Bacteria | 37425 |
| 128 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 129 | Ga0163161_10000043 | 3300017792 | Bacteria | 135014 |
| 130 | Ga0163161_10000135 | 3300017792 | Bacteria | 69859 |
| 131 | Ga0163161_10000141 | 3300017792 | Bacteria | 66482 |
| 132 | Ga0163161_10000479 | 3300017792 | Bacteria | 32921 |
| 133 | Ga0163161_10002742 | 3300017792 | Bacteria | 12533 |
| 134 | Ga0163161_10006401 | 3300017792 | Bacteria | 8155 |
| 135 | Ga0163161_10055825 | 3300017792 | Bacteria | 2868 |
| 136 | Ga0163161_10440400 | 3300017792 | Bacteria | 1052 |
| 137 | Ga0209437_100134 | 3300025233 | Bacteria | 178305 |
| 138 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 139 | Ga0209129_1000014 | 3300025258 | Bacteria | 509018 |
| 140 | Ga0209129_1009459 | 3300025258 | Bacteria | 2565 |
| 141 | Ga0209676_1000039 | 3300025292 | Bacteria | 443158 |
| 142 | Ga0209676_1000774 | 3300025292 | Bacteria | 42719 |
| 143 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 144 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 145 | Ga0209050_1000033 | 3300025298 | Bacteria | 442615 |
| 146 | Ga0207426_1005705 | 3300025302 | Bacteria | 5612 |
| 147 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 148 | Ga0207696_1000433 | 3300025711 | Bacteria | 38070 |
| 149 | Ga0207696_1010189 | 3300025711 | Bacteria | 3460 |
| 150 | Ga0207696_1033118 | 3300025711 | Bacteria | 1550 |
| 151 | Ga0207655_1000012 | 3300025728 | Bacteria | 640488 |
| 152 | Ga0207655_1002839 | 3300025728 | Bacteria | 13411 |
| 153 | Ga0207655_1003363 | 3300025728 | Bacteria | 11964 |
| 154 | Ga0207655_1004872 | 3300025728 | Bacteria | 9316 |
| 155 | Ga0207655_1005266 | 3300025728 | Bacteria | 8872 |
| 156 | Ga0207655_1016439 | 3300025728 | Bacteria | 4045 |
| 157 | Ga0207713_1019789 | 3300025735 | Bacteria | 3281 |
| 158 | Ga0207713_1048107 | 3300025735 | Bacteria | 1720 |
| 159 | Ga0207713_1151351 | 3300025735 | Bacteria | 749 |
| 160 | Ga0207710_10000760 | 3300025900 | Bacteria | 17687 |
| 161 | Ga0207647_10141886 | 3300025904 | Unclassified | 1408 |
| 162 | Ga0207695_10000066 | 3300025913 | Bacteria | 334103 |
| 163 | Ga0207695_10000469 | 3300025913 | Bacteria | 87551 |
| 164 | Ga0207695_10019062 | 3300025913 | Bacteria | 7912 |
| 165 | Ga0207695_10203606 | 3300025913 | Bacteria | 1892 |
| 166 | Ga0207671_10003405 | 3300025914 | Bacteria | 15902 |
| 167 | Ga0207671_10003991 | 3300025914 | Bacteria | 14342 |
| 168 | Ga0207671_10005390 | 3300025914 | Bacteria | 11809 |
| 169 | Ga0207671_10656726 | 3300025914 | Unclassified | 835 |
| 170 | Ga0207681_10003300 | 3300025923 | Bacteria | 10104 |
| 171 | Ga0207709_10000016 | 3300025935 | Bacteria | 478406 |
| 172 | Ga0207661_10000810 | 3300025944 | Bacteria | 20443 |
| 173 | Ga0207667_10060373 | 3300025949 | Bacteria | 3969 |
| 174 | Ga0207651_10165254 | 3300025960 | Bacteria | 1739 |
| 175 | Ga0207712_10001691 | 3300025961 | Bacteria | 14816 |
| 176 | Ga0207640_10022230 | 3300025981 | Bacteria | 3792 |
| 177 | Ga0207639_10021190 | 3300026041 | Bacteria | 4665 |
| 178 | Ga0207674_10195386 | 3300026116 | Bacteria | 1973 |
| 179 | Ga0209281_1000276 | 3300027111 | Bacteria | 97890 |
| 180 | Ga0209371_1000024 | 3300027312 | Bacteria | 477286 |
| 181 | Ga0209489_113929 | 3300027361 | Bacteria | 6073 |
| 182 | Ga0209282_1095936 | 3300027666 | Bacteria | 1540 |
| 183 | Ga0268266_10012563 | 3300028379 | Bacteria | 7318 |
| 184 | Ga0268256_1000026 | 3300030500 | Bacteria | 477260 |
| 185 | Ga0307405_10000001 | 3300031731 | Bacteria | 1731270 |
| 186 | Ga0307405_10000094 | 3300031731 | Bacteria | 37829 |
| 187 | Ga0307406_10002843 | 3300031901 | Bacteria | 9433 |
| 188 | Ga0307407_10000001 | 3300031903 | Bacteria | 570048 |
| 189 | Ga0307412_10000077 | 3300031911 | Bacteria | 96375 |
| 190 | Ga0307412_10862202 | 3300031911 | Bacteria | 791 |
| 191 | Ga0307409_100701531 | 3300031995 | Bacteria | 1011 |
| 192 | Ga0307416_100000026 | 3300032002 | Bacteria | 172622 |
| 193 | Ga0307416_100153805 | 3300032002 | Bacteria | 2114 |
| 194 | Ga0307414_10000004 | 3300032004 | Bacteria | 472218 |
| 195 | Ga0307414_10000951 | 3300032004 | Bacteria | 14797 |
| 196 | Ga0307414_10001142 | 3300032004 | Bacteria | 13596 |
| 197 | Ga0307414_10029157 | 3300032004 | Bacteria | 3588 |
| 198 | Ga0307414_10051027 | 3300032004 | Bacteria | 2869 |
| 199 | Ga0307414_10072145 | 3300032004 | Bacteria | 2493 |
| 200 | Ga0307414_10573203 | 3300032004 | Bacteria | 1009 |
| 201 | Ga0307411_10000012 | 3300032005 | Bacteria | 161467 |
| 202 | Ga0439447_007726 | 3300041407 | Bacteria | 3386 |
| 203 | Ga0439466_0000486 | 3300041411 | Bacteria | 15069 |
| 204 | Ga0439466_0003079 | 3300041411 | Bacteria | 6488 |
| 205 | Ga0451807_2747157 | 3300041486 | Bacteria | 1180 |
| 206 | Ga0439449_0119814 | 3300042007 | Bacteria | 977 |
| 207 | Ga0439462_0070800 | 3300042015 | Bacteria | 947 |
| 208 | Ga0439446_0226537 | 3300042156 | Bacteria | 638 |
| 209 | Ga0466972_0000074 | 3300044658 | Bacteria | 95327 |
| 210 | Ga0466972_0104118 | 3300044658 | Bacteria | 1342 |
| 211 | Ga0466970_0000894 | 3300044765 | Bacteria | 14397 |
| 212 | Ga0495627_002698 | 3300046453 | Bacteria | 8307 |
| 213 | Ga0495638_0168179 | 3300046460 | Bacteria | 1260 |
| 214 | Ga0495650_0000144 | 3300046471 | Bacteria | 165957 |
| 215 | Ga0495585_0000348 | 3300046492 | Bacteria | 44925 |
| 216 | Ga0495585_0001200 | 3300046492 | Bacteria | 21074 |
| 217 | Ga0495607_0010799 | 3300046501 | Bacteria | 6112 |
| 218 | Ga0495607_0162824 | 3300046501 | Bacteria | 1132 |
| 219 | Ga0495583_0048454 | 3300046506 | Bacteria | 1950 |
| 220 | Ga0495606_0000430 | 3300046507 | Bacteria | 69872 |
| 221 | Ga0495606_0119811 | 3300046507 | Bacteria | 1576 |
| 222 | Ga0495606_0263032 | 3300046507 | Bacteria | 951 |
| 223 | Ga0495606_0312572 | 3300046507 | Unclassified | 847 |
| 224 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 225 | Ga0495610_0000048 | 3300046512 | Bacteria | 150249 |
| 226 | Ga0495610_0000367 | 3300046512 | Bacteria | 46922 |
| 227 | Ga0495610_0001428 | 3300046512 | Bacteria | 21136 |
| 228 | Ga0495616_0002973 | 3300046513 | Bacteria | 11008 |
| 229 | Ga0495616_0010785 | 3300046513 | Bacteria | 5268 |
| 230 | Ga0495631_0270719 | 3300046518 | Bacteria | 723 |
| 231 | Ga0495632_0007070 | 3300046519 | Bacteria | 7110 |
| 232 | Ga0495637_0029178 | 3300046520 | Bacteria | 2457 |
| 233 | Ga0495643_0000606 | 3300046522 | Bacteria | 43168 |
| 234 | Ga0495643_0045223 | 3300046522 | Bacteria | 2390 |
| 235 | Ga0495648_0229418 | 3300046524 | Bacteria | 910 |
| 236 | Ga0495663_0001211 | 3300046525 | Bacteria | 8287 |
| 237 | Ga0495652_0061123 | 3300046529 | Bacteria | 3182 |
| 238 | Ga0495609_0007461 | 3300046538 | Bacteria | 5458 |
| 239 | Ga0495609_0164183 | 3300046538 | Bacteria | 940 |
| 240 | Ga0495633_0002893 | 3300046558 | Bacteria | 11770 |
| 241 | Ga0495633_0004852 | 3300046558 | Bacteria | 8414 |
| 242 | Ga0495668_0000075 | 3300046616 | Bacteria | 163092 |
| 243 | Ga0495611_0102692 | 3300046648 | Bacteria | 1328 |
| 244 | Ga0495625_0000059 | 3300046660 | Bacteria | 180330 |
| 245 | Ga0495625_0002634 | 3300046660 | Bacteria | 19161 |
| 246 | Ga0495625_0017102 | 3300046660 | Bacteria | 5683 |
| 247 | Ga0495625_0035872 | 3300046660 | Bacteria | 3650 |
| 248 | Ga0495625_0043780 | 3300046660 | Bacteria | 3244 |
| 249 | Ga0495625_0116797 | 3300046660 | Bacteria | 1820 |
| 250 | Ga0495661_0003520 | 3300046665 | Bacteria | 11542 |
| 251 | Ga0495661_0020676 | 3300046665 | Bacteria | 4294 |
| 252 | Ga0495661_0026187 | 3300046665 | Bacteria | 3758 |
| 253 | Ga0495661_0043258 | 3300046665 | Bacteria | 2770 |
| 254 | Ga0495588_0001904 | 3300046674 | Bacteria | 8909 |
| 255 | Ga0495671_0152237 | 3300046692 | Bacteria | 1126 |
| 256 | Ga0495649_0000031 | 3300046694 | Bacteria | 151547 |
| 257 | Ga0495660_0270038 | 3300046810 | Bacteria | 782 |
| 258 | Ga0495681_0009766 | 3300047470 | Bacteria | 5874 |
| 259 | Ga0495681_0021150 | 3300047470 | Bacteria | 3511 |
| 260 | Ga0495681_0023713 | 3300047470 | Bacteria | 3253 |
| 261 | Ga0495686_0000112 | 3300047472 | Bacteria | 168354 |
| 262 | Ga0495686_0001299 | 3300047472 | Bacteria | 28153 |
| 263 | Ga0495686_0156449 | 3300047472 | Bacteria | 1335 |
| 264 | Ga0496101_0377470 | 3300048904 | Bacteria | 1115 |
| 265 | Ga0496115_0015445 | 3300048918 | Bacteria | 5791 |
| 266 | Ga0496121_0063516 | 3300048924 | Bacteria | 3016 |
| 267 | Ga0496122_0000869 | 3300048925 | Bacteria | 56890 |
| 268 | Ga0496122_0009810 | 3300048925 | Bacteria | 10000 |
| 269 | Ga0496123_0003807 | 3300048926 | Bacteria | 16488 |
| 270 | Ga0496125_0000185 | 3300048928 | Bacteria | 135607 |
| 271 | Ga0496125_0060230 | 3300048928 | Bacteria | 3053 |
| 272 | Ga0496125_0124478 | 3300048928 | Bacteria | 1830 |
| 273 | Ga0496126_0173712 | 3300048929 | Bacteria | 1834 |
| 274 | Ga0495678_007805 | 3300049459 | Bacteria | 5505 |
| 275 | Ga0495682_0004526 | 3300049460 | Bacteria | 5928 |
| 276 | Ga0501241_002962 | 3300049758 | Bacteria | 3246 |
| 277 | Ga0501263_021869 | 3300049760 | Bacteria | 865 |
| 278 | Ga0501266_000017 | 3300049763 | Bacteria | 155699 |
| 279 | nmdc:mga0k408_5204_c1 | 3300050493 | Bacteria | 6900 |
| 280 | Ga0500578_0050774 | 3300053086 | Bacteria | 2659 |
| 281 | Ga0500651_0000218 | 3300053093 | Bacteria | 35905 |
| 282 | Ga0500618_000005 | 3300053125 | Bacteria | 253092 |
| 283 | Ga0500642_0021676 | 3300053130 | Bacteria | 2549 |
| 284 | Ga0500658_0000009 | 3300053134 | Bacteria | 270303 |
| 285 | Ga0500568_0063333 | 3300053139 | Bacteria | 1427 |
| 286 | Ga0500616_0079391 | 3300053153 | Bacteria | 1652 |
| 287 | Ga0500622_0000249 | 3300053156 | Bacteria | 54675 |
| 288 | Ga0500622_0000986 | 3300053156 | Bacteria | 24174 |
| 289 | Ga0500624_000108 | 3300053157 | Bacteria | 39257 |
| 290 | Ga0500627_0033464 | 3300053158 | Bacteria | 2172 |
| 291 | Ga0500636_0234127 | 3300053177 | Bacteria | 948 |
| 292 | Ga0500584_005874 | 3300053726 | Bacteria | 5210 |
| 293 | Ga0500645_053446 | 3300053730 | Bacteria | 1175 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046518 | Ga0495631_0270719 | Ga0495631_0270719_208_705 | 165 |
| 2 | 3300009036 | Ga0105244_10041228 | Ga0105244_100412283 | 179 |
| 3 | 3300009092 | Ga0105250_10000432 | Ga0105250_100004327 | 179 |
| 4 | 3300025711 | Ga0207696_1000433 | Ga0207696_100043310 | 179 |
| 5 | 3300025728 | Ga0207655_1016439 | Ga0207655_10164392 | 179 |
| 6 | 3300046674 | Ga0495588_0001904 | Ga0495588_0001904_1972_2553 | 179 |
| 7 | 3300047470 | Ga0495681_0023713 | Ga0495681_0023713_17_598 | 179 |
| 8 | 3300009036 | Ga0105244_10014711 | Ga0105244_100147113 | 187 |
| 9 | 3300025728 | Ga0207655_1005266 | Ga0207655_10052664 | 187 |
| 10 | iso_pu_bacteria | 2643221665 | 2644362275 | 189 |
| 11 | iso_pu_bacteria | 2706794495 | 2707101097 | 189 |
| 12 | iso_pu_bacteria | 2744054655 | 2745160698 | 189 |
| 13 | iso_pu_bacteria | 2791354903 | 2791925146 | 189 |
| 14 | iso_pu_bacteria | 2855195626 | 2855196697 | 189 |
| 15 | iso_pu_bacteria | 2871282230 | 2871282898 | 189 |
| 16 | iso_pu_bacteria | 2891670763 | 2891674723 | 189 |
| 17 | iso_pu_bacteria | 2900051742 | 2900056250 | 189 |
| 18 | iso_pu_bacteria | 2928515477 | 2928517839 | 189 |
| 19 | iso_pu_bacteria | 3000376612 | 3000377626 | 189 |
| 20 | iso_pu_bacteria | 8054844752 | 8054848118 | 189 |
| 21 | iso_pu_bacteria | 2551306352 | 2552747617 | 191 |
| 22 | iso_pu_bacteria | 2675903507 | 2678229160 | 191 |
| 23 | iso_pu_bacteria | 2773857761 | 2774390311 | 191 |
| 24 | iso_pu_bacteria | 2773857770 | 2774437834 | 191 |
| 25 | iso_pu_bacteria | 2916699645 | 2916700307 | 191 |
| 26 | iso_pu_bacteria | 2919182534 | 2919184667 | 191 |
| 27 | iso_pu_bacteria | 2919506607 | 2919507609 | 191 |
| 28 | iso_pu_bacteria | 2738541279 | 2738733588 | 192 |
| 29 | iso_pu_bacteria | 2738541285 | 2738766126 | 192 |
| 30 | iso_pu_bacteria | 2738543007 | 2739215169 | 192 |
| 31 | 3300009011 | Ga0105251_10044188 | Ga0105251_100441883 | 193 |
| 32 | 3300009092 | Ga0105250_10018375 | Ga0105250_100183752 | 193 |
| 33 | 3300009553 | Ga0105249_10002538 | Ga0105249_100025385 | 193 |
| 34 | 3300013102 | Ga0157371_10008252 | Ga0157371_100082522 | 193 |
| 35 | 3300025728 | Ga0207655_1004872 | Ga0207655_10048724 | 193 |
| 36 | 3300025961 | Ga0207712_10001691 | Ga0207712_1000169118 | 193 |
| 37 | iso_pu_bacteria | 2643221667 | 2644373482 | 193 |
| 38 | iso_pu_bacteria | 2739367857 | 2740001657 | 193 |
| 39 | iso_pu_bacteria | 2739367858 | 2740006473 | 193 |
| 40 | iso_pu_bacteria | 2857613821 | 2857616137 | 193 |
| 41 | iso_pu_bacteria | 2857618242 | 2857622722 | 193 |
| 42 | iso_pu_bacteria | 2904419702 | 2904423573 | 193 |
| 43 | iso_pu_bacteria | 2929150217 | 2929154390 | 193 |
| 44 | iso_pu_bacteria | 8054307821 | 8054309484 | 193 |
| 45 | iso_pu_bacteria | 2519899754 | 2520882213 | 194 |
| 46 | iso_pu_bacteria | 2643221600 | 2644010126 | 194 |
| 47 | iso_pu_bacteria | 2643221716 | 2644640313 | 194 |
| 48 | iso_pu_bacteria | 2818991442 | 2819573060 | 194 |
| 49 | iso_pu_bacteria | 2881359912 | 2881360327 | 194 |
| 50 | iso_pu_bacteria | 2919191525 | 2919191755 | 194 |
| 51 | iso_pu_bacteria | 8055592153 | 8055592640 | 194 |
| 52 | 3300003856 | Ga0058692_1000007 | Ga0058692_100000718 | 195 |
| 53 | 3300005272 | Ga0065703_1000518 | Ga0065703_100051813 | 195 |
| 54 | 3300005289 | Ga0065704_10171380 | Ga0065704_101713802 | 195 |
| 55 | 3300005353 | Ga0070669_100001186 | Ga0070669_10000118614 | 195 |
| 56 | 3300005364 | Ga0070673_100063767 | Ga0070673_1000637674 | 195 |
| 57 | 3300005548 | Ga0070665_100003763 | Ga0070665_10000376315 | 195 |
| 58 | 3300009011 | Ga0105251_10039533 | Ga0105251_100395333 | 195 |
| 59 | 3300009011 | Ga0105251_10101541 | Ga0105251_101015413 | 195 |
| 60 | 3300009011 | Ga0105251_10342046 | Ga0105251_103420461 | 195 |
| 61 | 3300009011 | Ga0105251_10342048 | Ga0105251_103420481 | 195 |
| 62 | 3300009036 | Ga0105244_10009783 | Ga0105244_100097835 | 195 |
| 63 | 3300009036 | Ga0105244_10029561 | Ga0105244_100295613 | 195 |
| 64 | 3300009036 | Ga0105244_10053045 | Ga0105244_100530452 | 195 |
| 65 | 3300009092 | Ga0105250_10223974 | Ga0105250_102239742 | 195 |
| 66 | 3300009093 | Ga0105240_10003913 | Ga0105240_100039137 | 195 |
| 67 | 3300009101 | Ga0105247_10000887 | Ga0105247_100008877 | 195 |
| 68 | 3300009148 | Ga0105243_10000835 | Ga0105243_1000083515 | 195 |
| 69 | 3300013100 | Ga0157373_10157620 | Ga0157373_101576202 | 195 |
| 70 | 3300013102 | Ga0157371_10093708 | Ga0157371_100937082 | 195 |
| 71 | 3300017792 | Ga0163161_10006401 | Ga0163161_100064015 | 195 |
| 72 | 3300025711 | Ga0207696_1010189 | Ga0207696_10101895 | 195 |
| 73 | 3300025711 | Ga0207696_1033118 | Ga0207696_10331183 | 195 |
| 74 | 3300025728 | Ga0207655_1002839 | Ga0207655_10028395 | 195 |
| 75 | 3300025728 | Ga0207655_1003363 | Ga0207655_10033635 | 195 |
| 76 | 3300025735 | Ga0207713_1019789 | Ga0207713_10197891 | 195 |
| 77 | 3300025735 | Ga0207713_1048107 | Ga0207713_10481073 | 195 |
| 78 | 3300025735 | Ga0207713_1151351 | Ga0207713_11513511 | 195 |
| 79 | 3300025900 | Ga0207710_10000760 | Ga0207710_100007604 | 195 |
| 80 | 3300025913 | Ga0207695_10203606 | Ga0207695_102036062 | 195 |
| 81 | 3300025923 | Ga0207681_10003300 | Ga0207681_100033005 | 195 |
| 82 | 3300025935 | Ga0207709_10000016 | Ga0207709_10000016143 | 195 |
| 83 | 3300025960 | Ga0207651_10165254 | Ga0207651_101652542 | 195 |
| 84 | 3300027312 | Ga0209371_1000024 | Ga0209371_1000024335 | 195 |
| 85 | 3300028379 | Ga0268266_10012563 | Ga0268266_100125635 | 195 |
| 86 | 3300030500 | Ga0268256_1000026 | Ga0268256_1000026335 | 195 |
| 87 | 3300041411 | Ga0439466_0003079 | Ga0439466_0003079_4886_5473 | 195 |
| 88 | 3300046501 | Ga0495607_0010799 | Ga0495607_0010799_4767_5354 | 195 |
| 89 | 3300046519 | Ga0495632_0007070 | Ga0495632_0007070_1981_2568 | 195 |
| 90 | 3300046522 | Ga0495643_0045223 | Ga0495643_0045223_31_618 | 195 |
| 91 | 3300046525 | Ga0495663_0001211 | Ga0495663_0001211_1358_1945 | 195 |
| 92 | 3300046558 | Ga0495633_0004852 | Ga0495633_0004852_3099_3686 | 195 |
| 93 | 3300046665 | Ga0495661_0026187 | Ga0495661_0026187_1978_2565 | 195 |
| 94 | 3300047470 | Ga0495681_0009766 | Ga0495681_0009766_3313_3900 | 195 |
| 95 | 3300049460 | Ga0495682_0004526 | Ga0495682_0004526_3363_3950 | 195 |
| 96 | 3300009036 | Ga0105244_10000002 | Ga0105244_1000000286 | 196 |
| 97 | 3300017792 | Ga0163161_10000043 | Ga0163161_100000439 | 196 |
| 98 | 3300025728 | Ga0207655_1000012 | Ga0207655_1000012118 | 196 |
| 99 | 3300046501 | Ga0495607_0162824 | Ga0495607_0162824_407_997 | 196 |
| 100 | 3300053726 | Ga0500584_005874 | Ga0500584_005874_3558_4157 | 196 |
| 101 | iso_pu_bacteria | 2821136567 | 2821139500 | 196 |
| 102 | iso_pu_bacteria | 2904467357 | 2904471867 | 196 |
| 103 | 3300005289 | Ga0065704_10075292 | Ga0065704_100752924 | 197 |
| 104 | 3300013104 | Ga0157370_10004056 | Ga0157370_1000405613 | 197 |
| 105 | 3300013104 | Ga0157370_10010170 | Ga0157370_100101708 | 197 |
| 106 | 3300015261 | Ga0182006_1007528 | Ga0182006_10075287 | 197 |
| 107 | 3300031731 | Ga0307405_10000001 | Ga0307405_10000001423 | 197 |
| 108 | 3300031901 | Ga0307406_10002843 | Ga0307406_100028437 | 197 |
| 109 | 3300032005 | Ga0307411_10000012 | Ga0307411_1000001262 | 197 |
| 110 | 3300041407 | Ga0439447_007726 | Ga0439447_007726_1177_1779 | 197 |
| 111 | 3300042156 | Ga0439446_0226537 | Ga0439446_0226537_25_627 | 197 |
| 112 | iso_pu_bacteria | 2582581873 | 2585424323 | 197 |
| 113 | iso_pu_bacteria | 2842083920 | 2842085522 | 197 |
| 114 | 3300006948 | Ga0099826_10067979 | Ga0099826_100679792 | 198 |
| 115 | 3300009036 | Ga0105244_10080307 | Ga0105244_100803072 | 198 |
| 116 | 3300013104 | Ga0157370_10073031 | Ga0157370_100730313 | 198 |
| 117 | 3300015261 | Ga0182006_1032996 | Ga0182006_10329962 | 198 |
| 118 | 3300015265 | Ga0182005_1000224 | Ga0182005_100022425 | 198 |
| 119 | 3300027111 | Ga0209281_1000276 | Ga0209281_100027621 | 198 |
| 120 | 3300027361 | Ga0209489_113929 | Ga0209489_1139298 | 198 |
| 121 | 3300027666 | Ga0209282_1095936 | Ga0209282_10959361 | 198 |
| 122 | 3300032002 | Ga0307416_100153805 | Ga0307416_1001538052 | 198 |
| 123 | 3300041411 | Ga0439466_0000486 | Ga0439466_0000486_2259_2864 | 198 |
| 124 | 3300048924 | Ga0496121_0063516 | Ga0496121_0063516_1420_2025 | 198 |
| 125 | 3300049763 | Ga0501266_000017 | Ga0501266_000017_16519_17124 | 198 |
| 126 | 3300053134 | Ga0500658_0000009 | Ga0500658_0000009_50887_51492 | 198 |
| 127 | iso_pu_bacteria | 2946019816 | 2946020165 | 198 |
| 128 | 3300003316 | rootH1_10170388 | rootH1_101703886 | 199 |
| 129 | 3300003320 | rootH2_10145843 | rootH2_101458432 | 199 |
| 130 | 3300003322 | rootL2_10054374 | rootL2_100543747 | 199 |
| 131 | 3300003322 | rootL2_10144509 | rootL2_101445094 | 199 |
| 132 | 3300003322 | rootL2_10233825 | rootL2_102338253 | 199 |
| 133 | 3300003323 | rootH1_10057376 | rootH1_100573765 | 199 |
| 134 | 3300003794 | Ga0055531_10002510 | Ga0055531_100025103 | 199 |
| 135 | 3300010375 | Ga0105239_10118772 | Ga0105239_101187723 | 199 |
| 136 | 3300025304 | Ga0209257_1000004 | Ga0209257_10000041350 | 199 |
| 137 | 3300042007 | Ga0439449_0119814 | Ga0439449_0119814_36_635 | 199 |
| 138 | 3300048904 | Ga0496101_0377470 | Ga0496101_0377470_238_837 | 199 |
| 139 | 3300048929 | Ga0496126_0173712 | Ga0496126_0173712_37_636 | 199 |
| 140 | 3300049758 | Ga0501241_002962 | Ga0501241_002962_2194_2793 | 199 |
| 141 | 3300049760 | Ga0501263_021869 | Ga0501263_021869_130_729 | 199 |
| 142 | 3300053156 | Ga0500622_0000249 | Ga0500622_0000249_48825_49424 | 199 |
| 143 | 3300053156 | Ga0500622_0000986 | Ga0500622_0000986_13266_13889 | 199 |
| 144 | 3300005262 | Ga0065165_1003607 | Ga0065165_10036072 | 200 |
| 145 | 3300025302 | Ga0207426_1005705 | Ga0207426_10057052 | 200 |
| 146 | 3300041486 | Ga0451807_2747157 | Ga0451807_2747157_75_692 | 200 |
| 147 | 3300042015 | Ga0439462_0070800 | Ga0439462_0070800_234_836 | 200 |
| 148 | iso_pu_bacteria | 2902048731 | 2902051490 | 200 |
| 149 | 3300013104 | Ga0157370_10001827 | Ga0157370_1000182716 | 201 |
| 150 | 3300017792 | Ga0163161_10055825 | Ga0163161_100558254 | 201 |
| 151 | 3300044658 | Ga0466972_0104118 | Ga0466972_0104118_490_1104 | 201 |
| 152 | 3300046453 | Ga0495627_002698 | Ga0495627_002698_3592_4200 | 201 |
| 153 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_311906_312520 | 201 |
| 154 | 3300046522 | Ga0495643_0000606 | Ga0495643_0000606_10903_11508 | 201 |
| 155 | 3300046660 | Ga0495625_0043780 | Ga0495625_0043780_1469_2074 | 201 |
| 156 | 3300046810 | Ga0495660_0270038 | Ga0495660_0270038_41_649 | 201 |
| 157 | 3300048918 | Ga0496115_0015445 | Ga0496115_0015445_5106_5711 | 201 |
| 158 | 3300048925 | Ga0496122_0009810 | Ga0496122_0009810_3582_4196 | 201 |
| 159 | 3300048928 | Ga0496125_0000185 | Ga0496125_0000185_91022_91627 | 201 |
| 160 | 3300048928 | Ga0496125_0060230 | Ga0496125_0060230_2197_2811 | 201 |
| 161 | iso_pu_bacteria | 2881247448 | 2881249807 | 201 |
| 162 | iso_pu_bacteria | 2919186247 | 2919186462 | 201 |
| 163 | iso_pu_bacteria | 2939664404 | 2939666267 | 201 |
| 164 | 3300002773 | JGI25152J39213_1000080 | JGI25152J39213_100008021 | 202 |
| 165 | 3300002774 | JGI25150J39212_1000003 | JGI25150J39212_1000003444 | 202 |
| 166 | 3300002774 | JGI25150J39212_1000004 | JGI25150J39212_1000004181 | 202 |
| 167 | 3300003187 | JGI25151J46595_10000002 | JGI25151J46595_10000002444 | 202 |
| 168 | 3300003215 | JGI25153J46596_10000015 | JGI25153J46596_10000015255 | 202 |
| 169 | 3300005288 | Ga0065714_10071025 | Ga0065714_100710252 | 202 |
| 170 | 3300005289 | Ga0065704_10492518 | Ga0065704_104925181 | 202 |
| 171 | 3300025245 | Ga0207425_1000003 | Ga0207425_1000003402 | 202 |
| 172 | 3300025258 | Ga0209129_1000014 | Ga0209129_1000014431 | 202 |
| 173 | 3300025294 | Ga0209025_1000007 | Ga0209025_1000007401 | 202 |
| 174 | 3300025297 | Ga0209758_1000012 | Ga0209758_1000012402 | 202 |
| 175 | 3300032004 | Ga0307414_10000004 | Ga0307414_10000004210 | 202 |
| 176 | 3300005329 | Ga0070683_100003403 | Ga0070683_10000340311 | 203 |
| 177 | 3300005535 | Ga0070684_100018835 | Ga0070684_1000188356 | 203 |
| 178 | 3300009093 | Ga0105240_10000242 | Ga0105240_1000024277 | 203 |
| 179 | 3300009093 | Ga0105240_10000339 | Ga0105240_1000033956 | 203 |
| 180 | 3300009545 | Ga0105237_10976174 | Ga0105237_109761742 | 203 |
| 181 | 3300010375 | Ga0105239_10000639 | Ga0105239_100006396 | 203 |
| 182 | 3300025913 | Ga0207695_10000066 | Ga0207695_10000066197 | 203 |
| 183 | 3300025913 | Ga0207695_10000469 | Ga0207695_1000046957 | 203 |
| 184 | 3300025914 | Ga0207671_10656726 | Ga0207671_106567261 | 203 |
| 185 | 3300025944 | Ga0207661_10000810 | Ga0207661_1000081019 | 203 |
| 186 | 3300053153 | Ga0500616_0079391 | Ga0500616_0079391_851_1471 | 203 |
| 187 | 3300053730 | Ga0500645_053446 | Ga0500645_053446_29_649 | 203 |
| 188 | iso_pu_bacteria | 2738541302 | 2738855032 | 203 |
| 189 | iso_pu_bacteria | 2739367651 | 2739586862 | 203 |
| 190 | iso_pu_bacteria | 2739367656 | 2739615176 | 203 |
| 191 | iso_pu_bacteria | 2818991437 | 2819547318 | 203 |
| 192 | iso_pu_bacteria | 2842722452 | 2842727697 | 203 |
| 193 | iso_pu_bacteria | 2842909656 | 2842911099 | 203 |
| 194 | iso_pu_bacteria | 2849281842 | 2849283051 | 203 |
| 195 | iso_pu_bacteria | 2857627736 | 2857627890 | 203 |
| 196 | iso_pu_bacteria | 2904445276 | 2904447786 | 203 |
| 197 | iso_pu_bacteria | 2919437846 | 2919440182 | 203 |
| 198 | iso_pu_bacteria | 2945997725 | 2945997789 | 203 |
| 199 | iso_pu_bacteria | 2954016120 | 2954020245 | 203 |
| 200 | 3300003316 | rootH1_10104739 | rootH1_101047392 | 204 |
| 201 | 3300003320 | rootH2_10184950 | rootH2_101849503 | 204 |
| 202 | 3300003322 | rootL2_10353207 | rootL2_103532071 | 204 |
| 203 | 3300003323 | rootH1_10240674 | rootH1_102406746 | 204 |
| 204 | 3300003781 | Ga0055536_1009709 | Ga0055536_10097093 | 204 |
| 205 | 3300005262 | Ga0065165_1000032 | Ga0065165_100003231 | 204 |
| 206 | 3300005289 | Ga0065704_10185969 | Ga0065704_101859692 | 204 |
| 207 | 3300005289 | Ga0065704_10338918 | Ga0065704_103389181 | 204 |
| 208 | 3300025292 | Ga0209676_1000774 | Ga0209676_100077419 | 204 |
| 209 | 3300032004 | Ga0307414_10051027 | Ga0307414_100510272 | 204 |
| 210 | iso_pu_bacteria | 2929154850 | 2929159049 | 204 |
| 211 | 3300005288 | Ga0065714_10005243 | Ga0065714_100052432 | 205 |
| 212 | 3300031911 | Ga0307412_10862202 | Ga0307412_108622021 | 205 |
| 213 | 3300053158 | Ga0500627_0033464 | Ga0500627_0033464_468_1109 | 205 |
| 214 | 3300053130 | Ga0500642_0021676 | Ga0500642_0021676_266_910 | 206 |
| 215 | iso_pu_bacteria | 2599185184 | 2599481674 | 206 |
| 216 | iso_pu_bacteria | 2928078545 | 2928082159 | 206 |
| 217 | iso_pu_bacteria | 2928147474 | 2928149265 | 206 |
| 218 | iso_pu_bacteria | 2932082852 | 2932087676 | 206 |
| 219 | 3300003781 | Ga0055536_1000006 | Ga0055536_1000006338 | 207 |
| 220 | 3300003791 | Ga0055530_10006662 | Ga0055530_100066629 | 207 |
| 221 | 3300005288 | Ga0065714_10005588 | Ga0065714_100055885 | 207 |
| 222 | 3300005288 | Ga0065714_10064606 | Ga0065714_1006460615 | 207 |
| 223 | 3300005288 | Ga0065714_10219981 | Ga0065714_102199811 | 207 |
| 224 | 3300005563 | Ga0068855_100049932 | Ga0068855_1000499323 | 207 |
| 225 | 3300009036 | Ga0105244_10015422 | Ga0105244_100154222 | 207 |
| 226 | 3300013100 | Ga0157373_10024869 | Ga0157373_100248693 | 207 |
| 227 | 3300013102 | Ga0157371_10000296 | Ga0157371_1000029615 | 207 |
| 228 | 3300013104 | Ga0157370_10055256 | Ga0157370_100552563 | 207 |
| 229 | 3300013104 | Ga0157370_10906770 | Ga0157370_109067701 | 207 |
| 230 | 3300013105 | Ga0157369_10000164 | Ga0157369_1000016414 | 207 |
| 231 | 3300013308 | Ga0157375_10899861 | Ga0157375_108998612 | 207 |
| 232 | 3300015261 | Ga0182006_1000324 | Ga0182006_100032422 | 207 |
| 233 | 3300015262 | Ga0182007_10000005 | Ga0182007_1000000513 | 207 |
| 234 | 3300015682 | Ga0183373_1002 | Ga0183373_1002598 | 207 |
| 235 | 3300017792 | Ga0163161_10000135 | Ga0163161_1000013515 | 207 |
| 236 | 3300017792 | Ga0163161_10000479 | Ga0163161_1000047920 | 207 |
| 237 | 3300025292 | Ga0209676_1000039 | Ga0209676_1000039431 | 207 |
| 238 | 3300025298 | Ga0209050_1000033 | Ga0209050_100003318 | 207 |
| 239 | 3300025949 | Ga0207667_10060373 | Ga0207667_100603731 | 207 |
| 240 | 3300031731 | Ga0307405_10000094 | Ga0307405_1000009420 | 207 |
| 241 | 3300031903 | Ga0307407_10000001 | Ga0307407_10000001444 | 207 |
| 242 | 3300031995 | Ga0307409_100701531 | Ga0307409_1007015312 | 207 |
| 243 | 3300032002 | Ga0307416_100000026 | Ga0307416_100000026109 | 207 |
| 244 | 3300032004 | Ga0307414_10072145 | Ga0307414_100721454 | 207 |
| 245 | 3300046507 | Ga0495606_0263032 | Ga0495606_0263032_190_819 | 207 |
| 246 | 3300046507 | Ga0495606_0312572 | Ga0495606_0312572_149_784 | 207 |
| 247 | 3300046512 | Ga0495610_0000048 | Ga0495610_0000048_80359_80988 | 207 |
| 248 | 3300046512 | Ga0495610_0000367 | Ga0495610_0000367_34197_34826 | 207 |
| 249 | 3300046513 | Ga0495616_0002973 | Ga0495616_0002973_2800_3435 | 207 |
| 250 | 3300046520 | Ga0495637_0029178 | Ga0495637_0029178_1523_2152 | 207 |
| 251 | 3300046524 | Ga0495648_0229418 | Ga0495648_0229418_241_873 | 207 |
| 252 | 3300046648 | Ga0495611_0102692 | Ga0495611_0102692_353_988 | 207 |
| 253 | 3300046660 | Ga0495625_0017102 | Ga0495625_0017102_3015_3650 | 207 |
| 254 | 3300046660 | Ga0495625_0035872 | Ga0495625_0035872_1001_1636 | 207 |
| 255 | 3300047470 | Ga0495681_0021150 | Ga0495681_0021150_1627_2256 | 207 |
| 256 | 3300047472 | Ga0495686_0000112 | Ga0495686_0000112_157244_157879 | 207 |
| 257 | 3300047472 | Ga0495686_0156449 | Ga0495686_0156449_162_797 | 207 |
| 258 | 3300049459 | Ga0495678_007805 | Ga0495678_007805_2580_3215 | 207 |
| 259 | 3300002737 | JGI25162J39368_1000171 | JGI25162J39368_10001713 | 208 |
| 260 | 3300005563 | Ga0068855_100085816 | Ga0068855_1000858163 | 208 |
| 261 | 3300005578 | Ga0068854_100021448 | Ga0068854_1000214483 | 208 |
| 262 | 3300009093 | Ga0105240_10262067 | Ga0105240_102620672 | 208 |
| 263 | 3300009545 | Ga0105237_10010324 | Ga0105237_100103243 | 208 |
| 264 | 3300009545 | Ga0105237_10013808 | Ga0105237_100138083 | 208 |
| 265 | 3300010375 | Ga0105239_10000446 | Ga0105239_1000044631 | 208 |
| 266 | 3300010375 | Ga0105239_10011656 | Ga0105239_1001165610 | 208 |
| 267 | 3300017792 | Ga0163161_10000141 | Ga0163161_1000014114 | 208 |
| 268 | 3300017792 | Ga0163161_10002742 | Ga0163161_100027428 | 208 |
| 269 | 3300025233 | Ga0209437_100134 | Ga0209437_100134161 | 208 |
| 270 | 3300025258 | Ga0209129_1009459 | Ga0209129_10094593 | 208 |
| 271 | 3300025914 | Ga0207671_10003405 | Ga0207671_100034059 | 208 |
| 272 | 3300025914 | Ga0207671_10003991 | Ga0207671_100039918 | 208 |
| 273 | 3300025981 | Ga0207640_10022230 | Ga0207640_100222304 | 208 |
| 274 | 3300044658 | Ga0466972_0000074 | Ga0466972_0000074_13464_14102 | 208 |
| 275 | 3300044765 | Ga0466970_0000894 | Ga0466970_0000894_515_1153 | 208 |
| 276 | 3300046492 | Ga0495585_0001200 | Ga0495585_0001200_11529_12170 | 208 |
| 277 | 3300046660 | Ga0495625_0002634 | Ga0495625_0002634_9021_9662 | 208 |
| 278 | 3300053157 | Ga0500624_000108 | Ga0500624_000108_29137_29769 | 208 |
| 279 | 3300001979 | JGI24740J21852_10057255 | JGI24740J21852_100572551 | 210 |
| 280 | 3300002067 | JGI24735J21928_10000015 | JGI24735J21928_1000001572 | 210 |
| 281 | 3300003316 | rootH1_10022763 | rootH1_1002276320 | 210 |
| 282 | 3300003320 | rootH2_10151793 | rootH2_101517932 | 210 |
| 283 | 3300003323 | rootH1_10028500 | rootH1_100285003 | 210 |
| 284 | 3300005563 | Ga0068855_100064190 | Ga0068855_1000641902 | 210 |
| 285 | 3300005577 | Ga0068857_100180364 | Ga0068857_1001803644 | 210 |
| 286 | 3300010375 | Ga0105239_10117721 | Ga0105239_101177214 | 210 |
| 287 | 3300013102 | Ga0157371_10023987 | Ga0157371_100239874 | 210 |
| 288 | 3300013105 | Ga0157369_10255347 | Ga0157369_102553471 | 210 |
| 289 | 3300013306 | Ga0163162_10015976 | Ga0163162_100159764 | 210 |
| 290 | 3300013307 | Ga0157372_10008795 | Ga0157372_100087958 | 210 |
| 291 | 3300026116 | Ga0207674_10195386 | Ga0207674_101953864 | 210 |
| 292 | 3300032004 | Ga0307414_10573203 | Ga0307414_105732032 | 210 |
| 293 | 3300046460 | Ga0495638_0168179 | Ga0495638_0168179_84_722 | 210 |
| 294 | 3300046471 | Ga0495650_0000144 | Ga0495650_0000144_57319_57957 | 210 |
| 295 | 3300046492 | Ga0495585_0000348 | Ga0495585_0000348_32842_33480 | 210 |
| 296 | 3300046506 | Ga0495583_0048454 | Ga0495583_0048454_127_765 | 210 |
| 297 | 3300046507 | Ga0495606_0000430 | Ga0495606_0000430_55126_55764 | 210 |
| 298 | 3300046507 | Ga0495606_0119811 | Ga0495606_0119811_582_1220 | 210 |
| 299 | 3300046512 | Ga0495610_0001428 | Ga0495610_0001428_13248_13886 | 210 |
| 300 | 3300046513 | Ga0495616_0010785 | Ga0495616_0010785_1721_2359 | 210 |
| 301 | 3300046529 | Ga0495652_0061123 | Ga0495652_0061123_1227_1865 | 210 |
| 302 | 3300046538 | Ga0495609_0007461 | Ga0495609_0007461_2669_3307 | 210 |
| 303 | 3300046538 | Ga0495609_0164183 | Ga0495609_0164183_190_828 | 210 |
| 304 | 3300046558 | Ga0495633_0002893 | Ga0495633_0002893_3255_3893 | 210 |
| 305 | 3300046616 | Ga0495668_0000075 | Ga0495668_0000075_140566_141204 | 210 |
| 306 | 3300046660 | Ga0495625_0000059 | Ga0495625_0000059_119624_120262 | 210 |
| 307 | 3300046660 | Ga0495625_0116797 | Ga0495625_0116797_796_1434 | 210 |
| 308 | 3300046665 | Ga0495661_0003520 | Ga0495661_0003520_7611_8249 | 210 |
| 309 | 3300046665 | Ga0495661_0020676 | Ga0495661_0020676_128_766 | 210 |
| 310 | 3300046665 | Ga0495661_0043258 | Ga0495661_0043258_1206_1844 | 210 |
| 311 | 3300046692 | Ga0495671_0152237 | Ga0495671_0152237_208_846 | 210 |
| 312 | 3300046694 | Ga0495649_0000031 | Ga0495649_0000031_90848_91486 | 210 |
| 313 | 3300048925 | Ga0496122_0000869 | Ga0496122_0000869_14446_15087 | 210 |
| 314 | 3300048926 | Ga0496123_0003807 | Ga0496123_0003807_12900_13541 | 210 |
| 315 | 3300048928 | Ga0496125_0124478 | Ga0496125_0124478_1139_1780 | 210 |
| 316 | 3300050493 | nmdc:mga0k408_5204_c1 | nmdc:mga0k408_5204_c1_739_1377 | 210 |
| 317 | 3300053086 | Ga0500578_0050774 | Ga0500578_0050774_204_839 | 210 |
| 318 | 3300053125 | Ga0500618_000005 | Ga0500618_000005_184517_185155 | 210 |
| 319 | 3300053177 | Ga0500636_0234127 | Ga0500636_0234127_66_704 | 210 |
| 320 | 3300005539 | Ga0068853_100037329 | Ga0068853_1000373292 | 211 |
| 321 | 3300009174 | Ga0105241_10558396 | Ga0105241_105583962 | 211 |
| 322 | 3300025904 | Ga0207647_10141886 | Ga0207647_101418863 | 211 |
| 323 | 3300025913 | Ga0207695_10019062 | Ga0207695_100190627 | 211 |
| 324 | 3300026041 | Ga0207639_10021190 | Ga0207639_100211906 | 211 |
| 325 | iso_pu_bacteria | 2984606641 | 2984610518 | 211 |
| 326 | 3300005288 | Ga0065714_10008366 | Ga0065714_100083662 | 213 |
| 327 | 3300014497 | Ga0182008_10195776 | Ga0182008_101957762 | 213 |
| 328 | 3300015262 | Ga0182007_10033102 | Ga0182007_100331022 | 213 |
| 329 | 3300015262 | Ga0182007_10094038 | Ga0182007_100940381 | 213 |
| 330 | iso_pu_bacteria | 2775506987 | 2776613194 | 213 |
| 331 | 3300032004 | Ga0307414_10000951 | Ga0307414_100009515 | 214 |
| 332 | 3300013104 | Ga0157370_10127533 | Ga0157370_101275333 | 215 |
| 333 | 3300014497 | Ga0182008_10007064 | Ga0182008_100070643 | 215 |
| 334 | 3300015262 | Ga0182007_10009115 | Ga0182007_100091153 | 215 |
| 335 | 3300015262 | Ga0182007_10049684 | Ga0182007_100496841 | 215 |
| 336 | 3300032004 | Ga0307414_10029157 | Ga0307414_100291573 | 215 |
| 337 | 3300015261 | Ga0182006_1000194 | Ga0182006_100019450 | 216 |
| 338 | 3300013104 | Ga0157370_10021434 | Ga0157370_100214343 | 221 |
| 339 | 3300013306 | Ga0163162_10000065 | Ga0163162_1000006519 | 221 |
| 340 | iso_pu_bacteria | 2738541283 | 2738755392 | 221 |
| 341 | 3300013100 | Ga0157373_10003024 | Ga0157373_1000302412 | 223 |
| 342 | 3300013104 | Ga0157370_10000197 | Ga0157370_1000019716 | 224 |
| 343 | 3300014497 | Ga0182008_10000082 | Ga0182008_1000008227 | 224 |
| 344 | 3300025914 | Ga0207671_10005390 | Ga0207671_100053907 | 224 |
| 345 | iso_pu_bacteria | 2738543023 | 2739301329 | 225 |
| 346 | 3300047472 | Ga0495686_0001299 | Ga0495686_0001299_19963_20667 | 231 |
| 347 | 3300017792 | Ga0163161_10440400 | Ga0163161_104404002 | 232 |
| 348 | iso_pu_bacteria | 2738541284 | 2738761007 | 240 |
| 349 | 2162886007 | SwRhRL2b_contig_493616 | SwRhRL2b_0792.00006160 | 244 |
| 350 | 3300005288 | Ga0065714_10064455 | Ga0065714_1006445565 | 244 |
| 351 | 3300005288 | Ga0065714_10064664 | Ga0065714_1006466426 | 244 |
| 352 | 3300005289 | Ga0065704_10000193 | Ga0065704_1000019374 | 244 |
| 353 | 3300013100 | Ga0157373_10000136 | Ga0157373_1000013625 | 244 |
| 354 | 3300013102 | Ga0157371_10009342 | Ga0157371_100093425 | 244 |
| 355 | 3300013104 | Ga0157370_10012813 | Ga0157370_100128135 | 244 |
| 356 | 3300014497 | Ga0182008_10000018 | Ga0182008_10000018128 | 244 |
| 357 | 3300031911 | Ga0307412_10000077 | Ga0307412_1000007716 | 244 |
| 358 | 3300032004 | Ga0307414_10001142 | Ga0307414_1000114214 | 244 |
| 359 | 3300053093 | Ga0500651_0000218 | Ga0500651_0000218_26279_27013 | 244 |
| 360 | 3300053139 | Ga0500568_0063333 | Ga0500568_0063333_323_1057 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2amj-assembly1.cif.gz_A | crystal structure of modulator of drug activity b from escherichia coli o157:h7 | 0.9297 | 32 | 220 |
| 4s24-assembly1.cif.gz_A-2 | 1.7 angstrom crystal structure of of putative modulator of drug activity (apo- form) from yersinia pestis co92 | 0.9235 | 30 | 222 |
| 2b3d-assembly1.cif.gz_B | crystal structure of modulator of drug activity b in complex with flavin adenine dinucleotide | 0.9176 | 31 | 224 |
| 3rpe-assembly1.cif.gz_B | 1.1 angstrom crystal structure of putative modulator of drug activity (mdab) from yersinia pestis co92. | 0.9154 | 30 | 222 |
| 2amj-assembly1.cif.gz_B | crystal structure of modulator of drug activity b from escherichia coli o157:h7 | 0.9104 | 30 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4s24A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9065 | 31 | 222 | 3.40.50.360 |
| 4s24A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8788 | 31 | 222 | 3.40.50.360 |
| af_A0A2R8PW65_111_288_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.7698 | 99 | 224 | 3.40.50.360 |
| af_P0A756_6_178_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.7524 | 31 | 222 | 3.40.50.360 |
| 4d02A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.7467 | 33 | 223 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y7U5D1-F1-model_v4 | Flavodoxin family protein | 0.9631 | 31 | 119 |
|
| AF-A0A439C948-F1-model_v4 | deleted | 0.945 | 31 | 115 |
|
| AF-A0A495LKE2-F1-model_v4 | Putative NADPH-quinone reductase | 0.9445 | 31 | 226 |
|
| AF-H7FV39-F1-model_v4 | NAD(P)H dehydrogenase (Quinone) | 0.9406 | 26 | 226 |
|
| AF-A0A0U1KKJ5-F1-model_v4 | Modulator of drug activity B | 0.9406 | 31 | 223 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar