F421762

General Info

Members Datasets Scaffolds Average Seq Length
360 221 293 206

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10008366|Ga0065714_100083662
Length 240
Sequence VSPQKKRGRAIRCNLLCRTPAQKDLHYYPSHSRIHKXIKDMKKIFIINGSQNFAHSGGKFNQTVTDWTIEYLTNSKQFEIKTTDIKQDFNLDEEVEKFVWADVVVYHTPVWWFQLPXLFKKYIDDVFTAGHNKGIYRXDGRTRTNPDINYGTGGQLHGRKYXLTTSWNAPATAFTIPGEFFEETTVDEGAMFGFHKMNKFVGMEKLNSFHFHDVEKGATAENIDIFKENYTKHLEKTFNF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
4 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
5 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
6 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
7 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
8 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
9 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
10 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
11 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
12 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
13 2738541283 Pedobacter sp. OK701 Isolate Unclassified
14 2738541284 Pedobacter sp. YR016 Isolate Unclassified
15 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
16 2738541302 Pedobacter sp. CF074 Isolate Unclassified
17 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
18 2738543023 Pedobacter sp. OK628 Isolate Unclassified
19 2739367651 Pedobacter sp. OK291 Isolate Unclassified
20 2739367656 Pedobacter sp. CF523 Isolate Unclassified
21 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
22 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
23 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
24 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
25 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
26 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
27 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
28 2818991437 Pedobacter terrae 518 Isolate Unclassified
29 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
30 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
31 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
32 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
33 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
34 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
35 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
36 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
37 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
38 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
39 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
40 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
41 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
42 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
43 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
44 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
45 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
46 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
47 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
48 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
49 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
50 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
51 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
52 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
53 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
54 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
55 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
56 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
57 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
58 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
59 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
60 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
61 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
62 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
63 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
64 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
65 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
66 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
67 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
68 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
69 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
70 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
71 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
72 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
73 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
74 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
75 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
76 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
77 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
78 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
79 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
80 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
81 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
82 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
83 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
84 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
85 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
86 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
87 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
144 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
146 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
158 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
159 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
201 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
202 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
203 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
204 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
209 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
215 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
216 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
217 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
220 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
221 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.39
Metatranscriptomes 0
Isolates 18.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 10.56
Nodule 1.11
Rhizoplane 1.11
Rhizosphere 70
Stem 0
Stem Tuber 0.83
Unclassified 16.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_493616 2162886007 Bacteria 15810
2 JGI24740J21852_10057255 3300001979 Bacteria 1089
3 JGI24735J21928_10000015 3300002067 Bacteria 167231
4 JGI25162J39368_1000171 3300002737 Bacteria 71375
5 JGI25152J39213_1000080 3300002773 Bacteria 65432
6 JGI25150J39212_1000003 3300002774 Bacteria 508651
7 JGI25150J39212_1000004 3300002774 Bacteria 417320
8 JGI25151J46595_10000002 3300003187 Bacteria 731381
9 JGI25153J46596_10000015 3300003215 Bacteria 289820
10 rootH1_10022763 3300003316 Bacteria 25979
11 rootH1_10104739 3300003316 Bacteria 1544
12 rootH1_10170388 3300003316 Bacteria 4226
13 rootH2_10145843 3300003320 Bacteria 3446
14 rootH2_10151793 3300003320 Bacteria 2164
15 rootH2_10184950 3300003320 Bacteria 3337
16 rootL2_10054374 3300003322 Bacteria 7717
17 rootL2_10144509 3300003322 Bacteria 2864
18 rootL2_10233825 3300003322 Bacteria 2497
19 rootL2_10353207 3300003322 Bacteria 1866
20 rootH1_10028500 3300003323 Bacteria 3154
21 rootH1_10057376 3300003323 Bacteria 8484
22 rootH1_10240674 3300003323 Bacteria 3618
23 Ga0055536_1000006 3300003781 Bacteria 347733
24 Ga0055536_1009709 3300003781 Bacteria 3936
25 Ga0055530_10006662 3300003791 Bacteria 5092
26 Ga0055531_10002510 3300003794 Bacteria 12238
27 Ga0058692_1000007 3300003856 Bacteria 366313
28 Ga0065165_1000032 3300005262 Bacteria 216051
29 Ga0065165_1003607 3300005262 Bacteria 10627
30 Ga0065703_1000518 3300005272 Bacteria 17476
31 Ga0065714_10005243 3300005288 Bacteria 6984
32 Ga0065714_10005588 3300005288 Bacteria 9018
33 Ga0065714_10008366 3300005288 Bacteria 5187
34 Ga0065714_10064455 3300005288 Bacteria 72722
35 Ga0065714_10064606 3300005288 Bacteria 29406
36 Ga0065714_10064664 3300005288 Bacteria 25064
37 Ga0065714_10071025 3300005288 Bacteria 3688
38 Ga0065714_10219981 3300005288 Bacteria 843
39 Ga0065704_10000193 3300005289 Bacteria 203271
40 Ga0065704_10075292 3300005289 Bacteria 5676
41 Ga0065704_10171380 3300005289 Bacteria 1288
42 Ga0065704_10185969 3300005289 Bacteria 1213
43 Ga0065704_10338918 3300005289 Bacteria 826
44 Ga0065704_10492518 3300005289 Bacteria 673
45 Ga0070683_100003403 3300005329 Bacteria 12899
46 Ga0070669_100001186 3300005353 Bacteria 18974
47 Ga0070673_100063767 3300005364 Bacteria 2933
48 Ga0070684_100018835 3300005535 Bacteria 5697
49 Ga0068853_100037329 3300005539 Bacteria 4133
50 Ga0070665_100003763 3300005548 Bacteria 16056
51 Ga0068855_100049932 3300005563 Bacteria 4932
52 Ga0068855_100064190 3300005563 Bacteria 4282
53 Ga0068855_100085816 3300005563 Bacteria 3642
54 Ga0068857_100180364 3300005577 Bacteria 1922
55 Ga0068854_100021448 3300005578 Bacteria 4384
56 Ga0099826_10067979 3300006948 Bacteria 2277
57 Ga0105251_10039533 3300009011 Bacteria 2304
58 Ga0105251_10044188 3300009011 Bacteria 2153
59 Ga0105251_10101541 3300009011 Bacteria 1315
60 Ga0105251_10342046 3300009011 Bacteria 682
61 Ga0105251_10342048 3300009011 Bacteria 682
62 Ga0105244_10000002 3300009036 Bacteria 495554
63 Ga0105244_10009783 3300009036 Bacteria 5857
64 Ga0105244_10014711 3300009036 Bacteria 4517
65 Ga0105244_10015422 3300009036 Bacteria 4383
66 Ga0105244_10029561 3300009036 Bacteria 2926
67 Ga0105244_10041228 3300009036 Bacteria 2393
68 Ga0105244_10053045 3300009036 Bacteria 2062
69 Ga0105244_10080307 3300009036 Bacteria 1615
70 Ga0105250_10000432 3300009092 Bacteria 30665
71 Ga0105250_10018375 3300009092 Bacteria 2832
72 Ga0105250_10223974 3300009092 Bacteria 798
73 Ga0105240_10000242 3300009093 Bacteria 108001
74 Ga0105240_10000339 3300009093 Bacteria 87543
75 Ga0105240_10003913 3300009093 Bacteria 23003
76 Ga0105240_10262067 3300009093 Bacteria 1993
77 Ga0105247_10000887 3300009101 Bacteria 22551
78 Ga0105243_10000835 3300009148 Bacteria 29277
79 Ga0105241_10558396 3300009174 Bacteria 1029
80 Ga0105237_10010324 3300009545 Bacteria 9948
81 Ga0105237_10013808 3300009545 Bacteria 8453
82 Ga0105237_10976174 3300009545 Unclassified 854
83 Ga0105249_10002538 3300009553 Bacteria 15801
84 Ga0105239_10000446 3300010375 Bacteria 60289
85 Ga0105239_10000639 3300010375 Bacteria 49788
86 Ga0105239_10011656 3300010375 Bacteria 9813
87 Ga0105239_10117721 3300010375 Bacteria 2948
88 Ga0105239_10118772 3300010375 Bacteria 2934
89 Ga0157373_10000136 3300013100 Bacteria 57912
90 Ga0157373_10003024 3300013100 Bacteria 12688
91 Ga0157373_10024869 3300013100 Bacteria 4336
92 Ga0157373_10157620 3300013100 Bacteria 1597
93 Ga0157371_10000296 3300013102 Bacteria 66267
94 Ga0157371_10008252 3300013102 Bacteria 8323
95 Ga0157371_10009342 3300013102 Bacteria 7729
96 Ga0157371_10023987 3300013102 Bacteria 4456
97 Ga0157371_10093708 3300013102 Bacteria 2128
98 Ga0157370_10000197 3300013104 Bacteria 75846
99 Ga0157370_10001827 3300013104 Bacteria 26213
100 Ga0157370_10004056 3300013104 Bacteria 16989
101 Ga0157370_10010170 3300013104 Bacteria 9934
102 Ga0157370_10012813 3300013104 Bacteria 8668
103 Ga0157370_10021434 3300013104 Bacteria 6439
104 Ga0157370_10055256 3300013104 Bacteria 3783
105 Ga0157370_10073031 3300013104 Bacteria 3237
106 Ga0157370_10127533 3300013104 Bacteria 2375
107 Ga0157370_10906770 3300013104 Bacteria 800
108 Ga0157369_10000164 3300013105 Bacteria 94229
109 Ga0157369_10255347 3300013105 Bacteria 1829
110 Ga0163162_10000065 3300013306 Bacteria 102191
111 Ga0163162_10015976 3300013306 Bacteria 7337
112 Ga0157372_10008795 3300013307 Bacteria 10724
113 Ga0157375_10899861 3300013308 Bacteria 1029
114 Ga0182008_10000018 3300014497 Bacteria 230609
115 Ga0182008_10000082 3300014497 Bacteria 74716
116 Ga0182008_10007064 3300014497 Bacteria 6224
117 Ga0182008_10195776 3300014497 Bacteria 1027
118 Ga0182006_1000194 3300015261 Bacteria 62654
119 Ga0182006_1000324 3300015261 Bacteria 41463
120 Ga0182006_1007528 3300015261 Bacteria 4976
121 Ga0182006_1032996 3300015261 Bacteria 2078
122 Ga0182007_10000005 3300015262 Bacteria 442702
123 Ga0182007_10009115 3300015262 Bacteria 4033
124 Ga0182007_10033102 3300015262 Bacteria 1753
125 Ga0182007_10049684 3300015262 Bacteria 1385
126 Ga0182007_10094038 3300015262 Bacteria 988
127 Ga0182005_1000224 3300015265 Bacteria 37425
128 Ga0183373_1002 3300015682 Bacteria 990153
129 Ga0163161_10000043 3300017792 Bacteria 135014
130 Ga0163161_10000135 3300017792 Bacteria 69859
131 Ga0163161_10000141 3300017792 Bacteria 66482
132 Ga0163161_10000479 3300017792 Bacteria 32921
133 Ga0163161_10002742 3300017792 Bacteria 12533
134 Ga0163161_10006401 3300017792 Bacteria 8155
135 Ga0163161_10055825 3300017792 Bacteria 2868
136 Ga0163161_10440400 3300017792 Bacteria 1052
137 Ga0209437_100134 3300025233 Bacteria 178305
138 Ga0207425_1000003 3300025245 Bacteria 1145342
139 Ga0209129_1000014 3300025258 Bacteria 509018
140 Ga0209129_1009459 3300025258 Bacteria 2565
141 Ga0209676_1000039 3300025292 Bacteria 443158
142 Ga0209676_1000774 3300025292 Bacteria 42719
143 Ga0209025_1000007 3300025294 Bacteria 1145109
144 Ga0209758_1000012 3300025297 Bacteria 949866
145 Ga0209050_1000033 3300025298 Bacteria 442615
146 Ga0207426_1005705 3300025302 Bacteria 5612
147 Ga0209257_1000004 3300025304 Bacteria 1678347
148 Ga0207696_1000433 3300025711 Bacteria 38070
149 Ga0207696_1010189 3300025711 Bacteria 3460
150 Ga0207696_1033118 3300025711 Bacteria 1550
151 Ga0207655_1000012 3300025728 Bacteria 640488
152 Ga0207655_1002839 3300025728 Bacteria 13411
153 Ga0207655_1003363 3300025728 Bacteria 11964
154 Ga0207655_1004872 3300025728 Bacteria 9316
155 Ga0207655_1005266 3300025728 Bacteria 8872
156 Ga0207655_1016439 3300025728 Bacteria 4045
157 Ga0207713_1019789 3300025735 Bacteria 3281
158 Ga0207713_1048107 3300025735 Bacteria 1720
159 Ga0207713_1151351 3300025735 Bacteria 749
160 Ga0207710_10000760 3300025900 Bacteria 17687
161 Ga0207647_10141886 3300025904 Unclassified 1408
162 Ga0207695_10000066 3300025913 Bacteria 334103
163 Ga0207695_10000469 3300025913 Bacteria 87551
164 Ga0207695_10019062 3300025913 Bacteria 7912
165 Ga0207695_10203606 3300025913 Bacteria 1892
166 Ga0207671_10003405 3300025914 Bacteria 15902
167 Ga0207671_10003991 3300025914 Bacteria 14342
168 Ga0207671_10005390 3300025914 Bacteria 11809
169 Ga0207671_10656726 3300025914 Unclassified 835
170 Ga0207681_10003300 3300025923 Bacteria 10104
171 Ga0207709_10000016 3300025935 Bacteria 478406
172 Ga0207661_10000810 3300025944 Bacteria 20443
173 Ga0207667_10060373 3300025949 Bacteria 3969
174 Ga0207651_10165254 3300025960 Bacteria 1739
175 Ga0207712_10001691 3300025961 Bacteria 14816
176 Ga0207640_10022230 3300025981 Bacteria 3792
177 Ga0207639_10021190 3300026041 Bacteria 4665
178 Ga0207674_10195386 3300026116 Bacteria 1973
179 Ga0209281_1000276 3300027111 Bacteria 97890
180 Ga0209371_1000024 3300027312 Bacteria 477286
181 Ga0209489_113929 3300027361 Bacteria 6073
182 Ga0209282_1095936 3300027666 Bacteria 1540
183 Ga0268266_10012563 3300028379 Bacteria 7318
184 Ga0268256_1000026 3300030500 Bacteria 477260
185 Ga0307405_10000001 3300031731 Bacteria 1731270
186 Ga0307405_10000094 3300031731 Bacteria 37829
187 Ga0307406_10002843 3300031901 Bacteria 9433
188 Ga0307407_10000001 3300031903 Bacteria 570048
189 Ga0307412_10000077 3300031911 Bacteria 96375
190 Ga0307412_10862202 3300031911 Bacteria 791
191 Ga0307409_100701531 3300031995 Bacteria 1011
192 Ga0307416_100000026 3300032002 Bacteria 172622
193 Ga0307416_100153805 3300032002 Bacteria 2114
194 Ga0307414_10000004 3300032004 Bacteria 472218
195 Ga0307414_10000951 3300032004 Bacteria 14797
196 Ga0307414_10001142 3300032004 Bacteria 13596
197 Ga0307414_10029157 3300032004 Bacteria 3588
198 Ga0307414_10051027 3300032004 Bacteria 2869
199 Ga0307414_10072145 3300032004 Bacteria 2493
200 Ga0307414_10573203 3300032004 Bacteria 1009
201 Ga0307411_10000012 3300032005 Bacteria 161467
202 Ga0439447_007726 3300041407 Bacteria 3386
203 Ga0439466_0000486 3300041411 Bacteria 15069
204 Ga0439466_0003079 3300041411 Bacteria 6488
205 Ga0451807_2747157 3300041486 Bacteria 1180
206 Ga0439449_0119814 3300042007 Bacteria 977
207 Ga0439462_0070800 3300042015 Bacteria 947
208 Ga0439446_0226537 3300042156 Bacteria 638
209 Ga0466972_0000074 3300044658 Bacteria 95327
210 Ga0466972_0104118 3300044658 Bacteria 1342
211 Ga0466970_0000894 3300044765 Bacteria 14397
212 Ga0495627_002698 3300046453 Bacteria 8307
213 Ga0495638_0168179 3300046460 Bacteria 1260
214 Ga0495650_0000144 3300046471 Bacteria 165957
215 Ga0495585_0000348 3300046492 Bacteria 44925
216 Ga0495585_0001200 3300046492 Bacteria 21074
217 Ga0495607_0010799 3300046501 Bacteria 6112
218 Ga0495607_0162824 3300046501 Bacteria 1132
219 Ga0495583_0048454 3300046506 Bacteria 1950
220 Ga0495606_0000430 3300046507 Bacteria 69872
221 Ga0495606_0119811 3300046507 Bacteria 1576
222 Ga0495606_0263032 3300046507 Bacteria 951
223 Ga0495606_0312572 3300046507 Unclassified 847
224 Ga0495610_0000001 3300046512 Bacteria 1620061
225 Ga0495610_0000048 3300046512 Bacteria 150249
226 Ga0495610_0000367 3300046512 Bacteria 46922
227 Ga0495610_0001428 3300046512 Bacteria 21136
228 Ga0495616_0002973 3300046513 Bacteria 11008
229 Ga0495616_0010785 3300046513 Bacteria 5268
230 Ga0495631_0270719 3300046518 Bacteria 723
231 Ga0495632_0007070 3300046519 Bacteria 7110
232 Ga0495637_0029178 3300046520 Bacteria 2457
233 Ga0495643_0000606 3300046522 Bacteria 43168
234 Ga0495643_0045223 3300046522 Bacteria 2390
235 Ga0495648_0229418 3300046524 Bacteria 910
236 Ga0495663_0001211 3300046525 Bacteria 8287
237 Ga0495652_0061123 3300046529 Bacteria 3182
238 Ga0495609_0007461 3300046538 Bacteria 5458
239 Ga0495609_0164183 3300046538 Bacteria 940
240 Ga0495633_0002893 3300046558 Bacteria 11770
241 Ga0495633_0004852 3300046558 Bacteria 8414
242 Ga0495668_0000075 3300046616 Bacteria 163092
243 Ga0495611_0102692 3300046648 Bacteria 1328
244 Ga0495625_0000059 3300046660 Bacteria 180330
245 Ga0495625_0002634 3300046660 Bacteria 19161
246 Ga0495625_0017102 3300046660 Bacteria 5683
247 Ga0495625_0035872 3300046660 Bacteria 3650
248 Ga0495625_0043780 3300046660 Bacteria 3244
249 Ga0495625_0116797 3300046660 Bacteria 1820
250 Ga0495661_0003520 3300046665 Bacteria 11542
251 Ga0495661_0020676 3300046665 Bacteria 4294
252 Ga0495661_0026187 3300046665 Bacteria 3758
253 Ga0495661_0043258 3300046665 Bacteria 2770
254 Ga0495588_0001904 3300046674 Bacteria 8909
255 Ga0495671_0152237 3300046692 Bacteria 1126
256 Ga0495649_0000031 3300046694 Bacteria 151547
257 Ga0495660_0270038 3300046810 Bacteria 782
258 Ga0495681_0009766 3300047470 Bacteria 5874
259 Ga0495681_0021150 3300047470 Bacteria 3511
260 Ga0495681_0023713 3300047470 Bacteria 3253
261 Ga0495686_0000112 3300047472 Bacteria 168354
262 Ga0495686_0001299 3300047472 Bacteria 28153
263 Ga0495686_0156449 3300047472 Bacteria 1335
264 Ga0496101_0377470 3300048904 Bacteria 1115
265 Ga0496115_0015445 3300048918 Bacteria 5791
266 Ga0496121_0063516 3300048924 Bacteria 3016
267 Ga0496122_0000869 3300048925 Bacteria 56890
268 Ga0496122_0009810 3300048925 Bacteria 10000
269 Ga0496123_0003807 3300048926 Bacteria 16488
270 Ga0496125_0000185 3300048928 Bacteria 135607
271 Ga0496125_0060230 3300048928 Bacteria 3053
272 Ga0496125_0124478 3300048928 Bacteria 1830
273 Ga0496126_0173712 3300048929 Bacteria 1834
274 Ga0495678_007805 3300049459 Bacteria 5505
275 Ga0495682_0004526 3300049460 Bacteria 5928
276 Ga0501241_002962 3300049758 Bacteria 3246
277 Ga0501263_021869 3300049760 Bacteria 865
278 Ga0501266_000017 3300049763 Bacteria 155699
279 nmdc:mga0k408_5204_c1 3300050493 Bacteria 6900
280 Ga0500578_0050774 3300053086 Bacteria 2659
281 Ga0500651_0000218 3300053093 Bacteria 35905
282 Ga0500618_000005 3300053125 Bacteria 253092
283 Ga0500642_0021676 3300053130 Bacteria 2549
284 Ga0500658_0000009 3300053134 Bacteria 270303
285 Ga0500568_0063333 3300053139 Bacteria 1427
286 Ga0500616_0079391 3300053153 Bacteria 1652
287 Ga0500622_0000249 3300053156 Bacteria 54675
288 Ga0500622_0000986 3300053156 Bacteria 24174
289 Ga0500624_000108 3300053157 Bacteria 39257
290 Ga0500627_0033464 3300053158 Bacteria 2172
291 Ga0500636_0234127 3300053177 Bacteria 948
292 Ga0500584_005874 3300053726 Bacteria 5210
293 Ga0500645_053446 3300053730 Bacteria 1175

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046518 Ga0495631_0270719 Ga0495631_0270719_208_705 165
2 3300009036 Ga0105244_10041228 Ga0105244_100412283 179
3 3300009092 Ga0105250_10000432 Ga0105250_100004327 179
4 3300025711 Ga0207696_1000433 Ga0207696_100043310 179
5 3300025728 Ga0207655_1016439 Ga0207655_10164392 179
6 3300046674 Ga0495588_0001904 Ga0495588_0001904_1972_2553 179
7 3300047470 Ga0495681_0023713 Ga0495681_0023713_17_598 179
8 3300009036 Ga0105244_10014711 Ga0105244_100147113 187
9 3300025728 Ga0207655_1005266 Ga0207655_10052664 187
10 iso_pu_bacteria 2643221665 2644362275 189
11 iso_pu_bacteria 2706794495 2707101097 189
12 iso_pu_bacteria 2744054655 2745160698 189
13 iso_pu_bacteria 2791354903 2791925146 189
14 iso_pu_bacteria 2855195626 2855196697 189
15 iso_pu_bacteria 2871282230 2871282898 189
16 iso_pu_bacteria 2891670763 2891674723 189
17 iso_pu_bacteria 2900051742 2900056250 189
18 iso_pu_bacteria 2928515477 2928517839 189
19 iso_pu_bacteria 3000376612 3000377626 189
20 iso_pu_bacteria 8054844752 8054848118 189
21 iso_pu_bacteria 2551306352 2552747617 191
22 iso_pu_bacteria 2675903507 2678229160 191
23 iso_pu_bacteria 2773857761 2774390311 191
24 iso_pu_bacteria 2773857770 2774437834 191
25 iso_pu_bacteria 2916699645 2916700307 191
26 iso_pu_bacteria 2919182534 2919184667 191
27 iso_pu_bacteria 2919506607 2919507609 191
28 iso_pu_bacteria 2738541279 2738733588 192
29 iso_pu_bacteria 2738541285 2738766126 192
30 iso_pu_bacteria 2738543007 2739215169 192
31 3300009011 Ga0105251_10044188 Ga0105251_100441883 193
32 3300009092 Ga0105250_10018375 Ga0105250_100183752 193
33 3300009553 Ga0105249_10002538 Ga0105249_100025385 193
34 3300013102 Ga0157371_10008252 Ga0157371_100082522 193
35 3300025728 Ga0207655_1004872 Ga0207655_10048724 193
36 3300025961 Ga0207712_10001691 Ga0207712_1000169118 193
37 iso_pu_bacteria 2643221667 2644373482 193
38 iso_pu_bacteria 2739367857 2740001657 193
39 iso_pu_bacteria 2739367858 2740006473 193
40 iso_pu_bacteria 2857613821 2857616137 193
41 iso_pu_bacteria 2857618242 2857622722 193
42 iso_pu_bacteria 2904419702 2904423573 193
43 iso_pu_bacteria 2929150217 2929154390 193
44 iso_pu_bacteria 8054307821 8054309484 193
45 iso_pu_bacteria 2519899754 2520882213 194
46 iso_pu_bacteria 2643221600 2644010126 194
47 iso_pu_bacteria 2643221716 2644640313 194
48 iso_pu_bacteria 2818991442 2819573060 194
49 iso_pu_bacteria 2881359912 2881360327 194
50 iso_pu_bacteria 2919191525 2919191755 194
51 iso_pu_bacteria 8055592153 8055592640 194
52 3300003856 Ga0058692_1000007 Ga0058692_100000718 195
53 3300005272 Ga0065703_1000518 Ga0065703_100051813 195
54 3300005289 Ga0065704_10171380 Ga0065704_101713802 195
55 3300005353 Ga0070669_100001186 Ga0070669_10000118614 195
56 3300005364 Ga0070673_100063767 Ga0070673_1000637674 195
57 3300005548 Ga0070665_100003763 Ga0070665_10000376315 195
58 3300009011 Ga0105251_10039533 Ga0105251_100395333 195
59 3300009011 Ga0105251_10101541 Ga0105251_101015413 195
60 3300009011 Ga0105251_10342046 Ga0105251_103420461 195
61 3300009011 Ga0105251_10342048 Ga0105251_103420481 195
62 3300009036 Ga0105244_10009783 Ga0105244_100097835 195
63 3300009036 Ga0105244_10029561 Ga0105244_100295613 195
64 3300009036 Ga0105244_10053045 Ga0105244_100530452 195
65 3300009092 Ga0105250_10223974 Ga0105250_102239742 195
66 3300009093 Ga0105240_10003913 Ga0105240_100039137 195
67 3300009101 Ga0105247_10000887 Ga0105247_100008877 195
68 3300009148 Ga0105243_10000835 Ga0105243_1000083515 195
69 3300013100 Ga0157373_10157620 Ga0157373_101576202 195
70 3300013102 Ga0157371_10093708 Ga0157371_100937082 195
71 3300017792 Ga0163161_10006401 Ga0163161_100064015 195
72 3300025711 Ga0207696_1010189 Ga0207696_10101895 195
73 3300025711 Ga0207696_1033118 Ga0207696_10331183 195
74 3300025728 Ga0207655_1002839 Ga0207655_10028395 195
75 3300025728 Ga0207655_1003363 Ga0207655_10033635 195
76 3300025735 Ga0207713_1019789 Ga0207713_10197891 195
77 3300025735 Ga0207713_1048107 Ga0207713_10481073 195
78 3300025735 Ga0207713_1151351 Ga0207713_11513511 195
79 3300025900 Ga0207710_10000760 Ga0207710_100007604 195
80 3300025913 Ga0207695_10203606 Ga0207695_102036062 195
81 3300025923 Ga0207681_10003300 Ga0207681_100033005 195
82 3300025935 Ga0207709_10000016 Ga0207709_10000016143 195
83 3300025960 Ga0207651_10165254 Ga0207651_101652542 195
84 3300027312 Ga0209371_1000024 Ga0209371_1000024335 195
85 3300028379 Ga0268266_10012563 Ga0268266_100125635 195
86 3300030500 Ga0268256_1000026 Ga0268256_1000026335 195
87 3300041411 Ga0439466_0003079 Ga0439466_0003079_4886_5473 195
88 3300046501 Ga0495607_0010799 Ga0495607_0010799_4767_5354 195
89 3300046519 Ga0495632_0007070 Ga0495632_0007070_1981_2568 195
90 3300046522 Ga0495643_0045223 Ga0495643_0045223_31_618 195
91 3300046525 Ga0495663_0001211 Ga0495663_0001211_1358_1945 195
92 3300046558 Ga0495633_0004852 Ga0495633_0004852_3099_3686 195
93 3300046665 Ga0495661_0026187 Ga0495661_0026187_1978_2565 195
94 3300047470 Ga0495681_0009766 Ga0495681_0009766_3313_3900 195
95 3300049460 Ga0495682_0004526 Ga0495682_0004526_3363_3950 195
96 3300009036 Ga0105244_10000002 Ga0105244_1000000286 196
97 3300017792 Ga0163161_10000043 Ga0163161_100000439 196
98 3300025728 Ga0207655_1000012 Ga0207655_1000012118 196
99 3300046501 Ga0495607_0162824 Ga0495607_0162824_407_997 196
100 3300053726 Ga0500584_005874 Ga0500584_005874_3558_4157 196
101 iso_pu_bacteria 2821136567 2821139500 196
102 iso_pu_bacteria 2904467357 2904471867 196
103 3300005289 Ga0065704_10075292 Ga0065704_100752924 197
104 3300013104 Ga0157370_10004056 Ga0157370_1000405613 197
105 3300013104 Ga0157370_10010170 Ga0157370_100101708 197
106 3300015261 Ga0182006_1007528 Ga0182006_10075287 197
107 3300031731 Ga0307405_10000001 Ga0307405_10000001423 197
108 3300031901 Ga0307406_10002843 Ga0307406_100028437 197
109 3300032005 Ga0307411_10000012 Ga0307411_1000001262 197
110 3300041407 Ga0439447_007726 Ga0439447_007726_1177_1779 197
111 3300042156 Ga0439446_0226537 Ga0439446_0226537_25_627 197
112 iso_pu_bacteria 2582581873 2585424323 197
113 iso_pu_bacteria 2842083920 2842085522 197
114 3300006948 Ga0099826_10067979 Ga0099826_100679792 198
115 3300009036 Ga0105244_10080307 Ga0105244_100803072 198
116 3300013104 Ga0157370_10073031 Ga0157370_100730313 198
117 3300015261 Ga0182006_1032996 Ga0182006_10329962 198
118 3300015265 Ga0182005_1000224 Ga0182005_100022425 198
119 3300027111 Ga0209281_1000276 Ga0209281_100027621 198
120 3300027361 Ga0209489_113929 Ga0209489_1139298 198
121 3300027666 Ga0209282_1095936 Ga0209282_10959361 198
122 3300032002 Ga0307416_100153805 Ga0307416_1001538052 198
123 3300041411 Ga0439466_0000486 Ga0439466_0000486_2259_2864 198
124 3300048924 Ga0496121_0063516 Ga0496121_0063516_1420_2025 198
125 3300049763 Ga0501266_000017 Ga0501266_000017_16519_17124 198
126 3300053134 Ga0500658_0000009 Ga0500658_0000009_50887_51492 198
127 iso_pu_bacteria 2946019816 2946020165 198
128 3300003316 rootH1_10170388 rootH1_101703886 199
129 3300003320 rootH2_10145843 rootH2_101458432 199
130 3300003322 rootL2_10054374 rootL2_100543747 199
131 3300003322 rootL2_10144509 rootL2_101445094 199
132 3300003322 rootL2_10233825 rootL2_102338253 199
133 3300003323 rootH1_10057376 rootH1_100573765 199
134 3300003794 Ga0055531_10002510 Ga0055531_100025103 199
135 3300010375 Ga0105239_10118772 Ga0105239_101187723 199
136 3300025304 Ga0209257_1000004 Ga0209257_10000041350 199
137 3300042007 Ga0439449_0119814 Ga0439449_0119814_36_635 199
138 3300048904 Ga0496101_0377470 Ga0496101_0377470_238_837 199
139 3300048929 Ga0496126_0173712 Ga0496126_0173712_37_636 199
140 3300049758 Ga0501241_002962 Ga0501241_002962_2194_2793 199
141 3300049760 Ga0501263_021869 Ga0501263_021869_130_729 199
142 3300053156 Ga0500622_0000249 Ga0500622_0000249_48825_49424 199
143 3300053156 Ga0500622_0000986 Ga0500622_0000986_13266_13889 199
144 3300005262 Ga0065165_1003607 Ga0065165_10036072 200
145 3300025302 Ga0207426_1005705 Ga0207426_10057052 200
146 3300041486 Ga0451807_2747157 Ga0451807_2747157_75_692 200
147 3300042015 Ga0439462_0070800 Ga0439462_0070800_234_836 200
148 iso_pu_bacteria 2902048731 2902051490 200
149 3300013104 Ga0157370_10001827 Ga0157370_1000182716 201
150 3300017792 Ga0163161_10055825 Ga0163161_100558254 201
151 3300044658 Ga0466972_0104118 Ga0466972_0104118_490_1104 201
152 3300046453 Ga0495627_002698 Ga0495627_002698_3592_4200 201
153 3300046512 Ga0495610_0000001 Ga0495610_0000001_311906_312520 201
154 3300046522 Ga0495643_0000606 Ga0495643_0000606_10903_11508 201
155 3300046660 Ga0495625_0043780 Ga0495625_0043780_1469_2074 201
156 3300046810 Ga0495660_0270038 Ga0495660_0270038_41_649 201
157 3300048918 Ga0496115_0015445 Ga0496115_0015445_5106_5711 201
158 3300048925 Ga0496122_0009810 Ga0496122_0009810_3582_4196 201
159 3300048928 Ga0496125_0000185 Ga0496125_0000185_91022_91627 201
160 3300048928 Ga0496125_0060230 Ga0496125_0060230_2197_2811 201
161 iso_pu_bacteria 2881247448 2881249807 201
162 iso_pu_bacteria 2919186247 2919186462 201
163 iso_pu_bacteria 2939664404 2939666267 201
164 3300002773 JGI25152J39213_1000080 JGI25152J39213_100008021 202
165 3300002774 JGI25150J39212_1000003 JGI25150J39212_1000003444 202
166 3300002774 JGI25150J39212_1000004 JGI25150J39212_1000004181 202
167 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002444 202
168 3300003215 JGI25153J46596_10000015 JGI25153J46596_10000015255 202
169 3300005288 Ga0065714_10071025 Ga0065714_100710252 202
170 3300005289 Ga0065704_10492518 Ga0065704_104925181 202
171 3300025245 Ga0207425_1000003 Ga0207425_1000003402 202
172 3300025258 Ga0209129_1000014 Ga0209129_1000014431 202
173 3300025294 Ga0209025_1000007 Ga0209025_1000007401 202
174 3300025297 Ga0209758_1000012 Ga0209758_1000012402 202
175 3300032004 Ga0307414_10000004 Ga0307414_10000004210 202
176 3300005329 Ga0070683_100003403 Ga0070683_10000340311 203
177 3300005535 Ga0070684_100018835 Ga0070684_1000188356 203
178 3300009093 Ga0105240_10000242 Ga0105240_1000024277 203
179 3300009093 Ga0105240_10000339 Ga0105240_1000033956 203
180 3300009545 Ga0105237_10976174 Ga0105237_109761742 203
181 3300010375 Ga0105239_10000639 Ga0105239_100006396 203
182 3300025913 Ga0207695_10000066 Ga0207695_10000066197 203
183 3300025913 Ga0207695_10000469 Ga0207695_1000046957 203
184 3300025914 Ga0207671_10656726 Ga0207671_106567261 203
185 3300025944 Ga0207661_10000810 Ga0207661_1000081019 203
186 3300053153 Ga0500616_0079391 Ga0500616_0079391_851_1471 203
187 3300053730 Ga0500645_053446 Ga0500645_053446_29_649 203
188 iso_pu_bacteria 2738541302 2738855032 203
189 iso_pu_bacteria 2739367651 2739586862 203
190 iso_pu_bacteria 2739367656 2739615176 203
191 iso_pu_bacteria 2818991437 2819547318 203
192 iso_pu_bacteria 2842722452 2842727697 203
193 iso_pu_bacteria 2842909656 2842911099 203
194 iso_pu_bacteria 2849281842 2849283051 203
195 iso_pu_bacteria 2857627736 2857627890 203
196 iso_pu_bacteria 2904445276 2904447786 203
197 iso_pu_bacteria 2919437846 2919440182 203
198 iso_pu_bacteria 2945997725 2945997789 203
199 iso_pu_bacteria 2954016120 2954020245 203
200 3300003316 rootH1_10104739 rootH1_101047392 204
201 3300003320 rootH2_10184950 rootH2_101849503 204
202 3300003322 rootL2_10353207 rootL2_103532071 204
203 3300003323 rootH1_10240674 rootH1_102406746 204
204 3300003781 Ga0055536_1009709 Ga0055536_10097093 204
205 3300005262 Ga0065165_1000032 Ga0065165_100003231 204
206 3300005289 Ga0065704_10185969 Ga0065704_101859692 204
207 3300005289 Ga0065704_10338918 Ga0065704_103389181 204
208 3300025292 Ga0209676_1000774 Ga0209676_100077419 204
209 3300032004 Ga0307414_10051027 Ga0307414_100510272 204
210 iso_pu_bacteria 2929154850 2929159049 204
211 3300005288 Ga0065714_10005243 Ga0065714_100052432 205
212 3300031911 Ga0307412_10862202 Ga0307412_108622021 205
213 3300053158 Ga0500627_0033464 Ga0500627_0033464_468_1109 205
214 3300053130 Ga0500642_0021676 Ga0500642_0021676_266_910 206
215 iso_pu_bacteria 2599185184 2599481674 206
216 iso_pu_bacteria 2928078545 2928082159 206
217 iso_pu_bacteria 2928147474 2928149265 206
218 iso_pu_bacteria 2932082852 2932087676 206
219 3300003781 Ga0055536_1000006 Ga0055536_1000006338 207
220 3300003791 Ga0055530_10006662 Ga0055530_100066629 207
221 3300005288 Ga0065714_10005588 Ga0065714_100055885 207
222 3300005288 Ga0065714_10064606 Ga0065714_1006460615 207
223 3300005288 Ga0065714_10219981 Ga0065714_102199811 207
224 3300005563 Ga0068855_100049932 Ga0068855_1000499323 207
225 3300009036 Ga0105244_10015422 Ga0105244_100154222 207
226 3300013100 Ga0157373_10024869 Ga0157373_100248693 207
227 3300013102 Ga0157371_10000296 Ga0157371_1000029615 207
228 3300013104 Ga0157370_10055256 Ga0157370_100552563 207
229 3300013104 Ga0157370_10906770 Ga0157370_109067701 207
230 3300013105 Ga0157369_10000164 Ga0157369_1000016414 207
231 3300013308 Ga0157375_10899861 Ga0157375_108998612 207
232 3300015261 Ga0182006_1000324 Ga0182006_100032422 207
233 3300015262 Ga0182007_10000005 Ga0182007_1000000513 207
234 3300015682 Ga0183373_1002 Ga0183373_1002598 207
235 3300017792 Ga0163161_10000135 Ga0163161_1000013515 207
236 3300017792 Ga0163161_10000479 Ga0163161_1000047920 207
237 3300025292 Ga0209676_1000039 Ga0209676_1000039431 207
238 3300025298 Ga0209050_1000033 Ga0209050_100003318 207
239 3300025949 Ga0207667_10060373 Ga0207667_100603731 207
240 3300031731 Ga0307405_10000094 Ga0307405_1000009420 207
241 3300031903 Ga0307407_10000001 Ga0307407_10000001444 207
242 3300031995 Ga0307409_100701531 Ga0307409_1007015312 207
243 3300032002 Ga0307416_100000026 Ga0307416_100000026109 207
244 3300032004 Ga0307414_10072145 Ga0307414_100721454 207
245 3300046507 Ga0495606_0263032 Ga0495606_0263032_190_819 207
246 3300046507 Ga0495606_0312572 Ga0495606_0312572_149_784 207
247 3300046512 Ga0495610_0000048 Ga0495610_0000048_80359_80988 207
248 3300046512 Ga0495610_0000367 Ga0495610_0000367_34197_34826 207
249 3300046513 Ga0495616_0002973 Ga0495616_0002973_2800_3435 207
250 3300046520 Ga0495637_0029178 Ga0495637_0029178_1523_2152 207
251 3300046524 Ga0495648_0229418 Ga0495648_0229418_241_873 207
252 3300046648 Ga0495611_0102692 Ga0495611_0102692_353_988 207
253 3300046660 Ga0495625_0017102 Ga0495625_0017102_3015_3650 207
254 3300046660 Ga0495625_0035872 Ga0495625_0035872_1001_1636 207
255 3300047470 Ga0495681_0021150 Ga0495681_0021150_1627_2256 207
256 3300047472 Ga0495686_0000112 Ga0495686_0000112_157244_157879 207
257 3300047472 Ga0495686_0156449 Ga0495686_0156449_162_797 207
258 3300049459 Ga0495678_007805 Ga0495678_007805_2580_3215 207
259 3300002737 JGI25162J39368_1000171 JGI25162J39368_10001713 208
260 3300005563 Ga0068855_100085816 Ga0068855_1000858163 208
261 3300005578 Ga0068854_100021448 Ga0068854_1000214483 208
262 3300009093 Ga0105240_10262067 Ga0105240_102620672 208
263 3300009545 Ga0105237_10010324 Ga0105237_100103243 208
264 3300009545 Ga0105237_10013808 Ga0105237_100138083 208
265 3300010375 Ga0105239_10000446 Ga0105239_1000044631 208
266 3300010375 Ga0105239_10011656 Ga0105239_1001165610 208
267 3300017792 Ga0163161_10000141 Ga0163161_1000014114 208
268 3300017792 Ga0163161_10002742 Ga0163161_100027428 208
269 3300025233 Ga0209437_100134 Ga0209437_100134161 208
270 3300025258 Ga0209129_1009459 Ga0209129_10094593 208
271 3300025914 Ga0207671_10003405 Ga0207671_100034059 208
272 3300025914 Ga0207671_10003991 Ga0207671_100039918 208
273 3300025981 Ga0207640_10022230 Ga0207640_100222304 208
274 3300044658 Ga0466972_0000074 Ga0466972_0000074_13464_14102 208
275 3300044765 Ga0466970_0000894 Ga0466970_0000894_515_1153 208
276 3300046492 Ga0495585_0001200 Ga0495585_0001200_11529_12170 208
277 3300046660 Ga0495625_0002634 Ga0495625_0002634_9021_9662 208
278 3300053157 Ga0500624_000108 Ga0500624_000108_29137_29769 208
279 3300001979 JGI24740J21852_10057255 JGI24740J21852_100572551 210
280 3300002067 JGI24735J21928_10000015 JGI24735J21928_1000001572 210
281 3300003316 rootH1_10022763 rootH1_1002276320 210
282 3300003320 rootH2_10151793 rootH2_101517932 210
283 3300003323 rootH1_10028500 rootH1_100285003 210
284 3300005563 Ga0068855_100064190 Ga0068855_1000641902 210
285 3300005577 Ga0068857_100180364 Ga0068857_1001803644 210
286 3300010375 Ga0105239_10117721 Ga0105239_101177214 210
287 3300013102 Ga0157371_10023987 Ga0157371_100239874 210
288 3300013105 Ga0157369_10255347 Ga0157369_102553471 210
289 3300013306 Ga0163162_10015976 Ga0163162_100159764 210
290 3300013307 Ga0157372_10008795 Ga0157372_100087958 210
291 3300026116 Ga0207674_10195386 Ga0207674_101953864 210
292 3300032004 Ga0307414_10573203 Ga0307414_105732032 210
293 3300046460 Ga0495638_0168179 Ga0495638_0168179_84_722 210
294 3300046471 Ga0495650_0000144 Ga0495650_0000144_57319_57957 210
295 3300046492 Ga0495585_0000348 Ga0495585_0000348_32842_33480 210
296 3300046506 Ga0495583_0048454 Ga0495583_0048454_127_765 210
297 3300046507 Ga0495606_0000430 Ga0495606_0000430_55126_55764 210
298 3300046507 Ga0495606_0119811 Ga0495606_0119811_582_1220 210
299 3300046512 Ga0495610_0001428 Ga0495610_0001428_13248_13886 210
300 3300046513 Ga0495616_0010785 Ga0495616_0010785_1721_2359 210
301 3300046529 Ga0495652_0061123 Ga0495652_0061123_1227_1865 210
302 3300046538 Ga0495609_0007461 Ga0495609_0007461_2669_3307 210
303 3300046538 Ga0495609_0164183 Ga0495609_0164183_190_828 210
304 3300046558 Ga0495633_0002893 Ga0495633_0002893_3255_3893 210
305 3300046616 Ga0495668_0000075 Ga0495668_0000075_140566_141204 210
306 3300046660 Ga0495625_0000059 Ga0495625_0000059_119624_120262 210
307 3300046660 Ga0495625_0116797 Ga0495625_0116797_796_1434 210
308 3300046665 Ga0495661_0003520 Ga0495661_0003520_7611_8249 210
309 3300046665 Ga0495661_0020676 Ga0495661_0020676_128_766 210
310 3300046665 Ga0495661_0043258 Ga0495661_0043258_1206_1844 210
311 3300046692 Ga0495671_0152237 Ga0495671_0152237_208_846 210
312 3300046694 Ga0495649_0000031 Ga0495649_0000031_90848_91486 210
313 3300048925 Ga0496122_0000869 Ga0496122_0000869_14446_15087 210
314 3300048926 Ga0496123_0003807 Ga0496123_0003807_12900_13541 210
315 3300048928 Ga0496125_0124478 Ga0496125_0124478_1139_1780 210
316 3300050493 nmdc:mga0k408_5204_c1 nmdc:mga0k408_5204_c1_739_1377 210
317 3300053086 Ga0500578_0050774 Ga0500578_0050774_204_839 210
318 3300053125 Ga0500618_000005 Ga0500618_000005_184517_185155 210
319 3300053177 Ga0500636_0234127 Ga0500636_0234127_66_704 210
320 3300005539 Ga0068853_100037329 Ga0068853_1000373292 211
321 3300009174 Ga0105241_10558396 Ga0105241_105583962 211
322 3300025904 Ga0207647_10141886 Ga0207647_101418863 211
323 3300025913 Ga0207695_10019062 Ga0207695_100190627 211
324 3300026041 Ga0207639_10021190 Ga0207639_100211906 211
325 iso_pu_bacteria 2984606641 2984610518 211
326 3300005288 Ga0065714_10008366 Ga0065714_100083662 213
327 3300014497 Ga0182008_10195776 Ga0182008_101957762 213
328 3300015262 Ga0182007_10033102 Ga0182007_100331022 213
329 3300015262 Ga0182007_10094038 Ga0182007_100940381 213
330 iso_pu_bacteria 2775506987 2776613194 213
331 3300032004 Ga0307414_10000951 Ga0307414_100009515 214
332 3300013104 Ga0157370_10127533 Ga0157370_101275333 215
333 3300014497 Ga0182008_10007064 Ga0182008_100070643 215
334 3300015262 Ga0182007_10009115 Ga0182007_100091153 215
335 3300015262 Ga0182007_10049684 Ga0182007_100496841 215
336 3300032004 Ga0307414_10029157 Ga0307414_100291573 215
337 3300015261 Ga0182006_1000194 Ga0182006_100019450 216
338 3300013104 Ga0157370_10021434 Ga0157370_100214343 221
339 3300013306 Ga0163162_10000065 Ga0163162_1000006519 221
340 iso_pu_bacteria 2738541283 2738755392 221
341 3300013100 Ga0157373_10003024 Ga0157373_1000302412 223
342 3300013104 Ga0157370_10000197 Ga0157370_1000019716 224
343 3300014497 Ga0182008_10000082 Ga0182008_1000008227 224
344 3300025914 Ga0207671_10005390 Ga0207671_100053907 224
345 iso_pu_bacteria 2738543023 2739301329 225
346 3300047472 Ga0495686_0001299 Ga0495686_0001299_19963_20667 231
347 3300017792 Ga0163161_10440400 Ga0163161_104404002 232
348 iso_pu_bacteria 2738541284 2738761007 240
349 2162886007 SwRhRL2b_contig_493616 SwRhRL2b_0792.00006160 244
350 3300005288 Ga0065714_10064455 Ga0065714_1006445565 244
351 3300005288 Ga0065714_10064664 Ga0065714_1006466426 244
352 3300005289 Ga0065704_10000193 Ga0065704_1000019374 244
353 3300013100 Ga0157373_10000136 Ga0157373_1000013625 244
354 3300013102 Ga0157371_10009342 Ga0157371_100093425 244
355 3300013104 Ga0157370_10012813 Ga0157370_100128135 244
356 3300014497 Ga0182008_10000018 Ga0182008_10000018128 244
357 3300031911 Ga0307412_10000077 Ga0307412_1000007716 244
358 3300032004 Ga0307414_10001142 Ga0307414_1000114214 244
359 3300053093 Ga0500651_0000218 Ga0500651_0000218_26279_27013 244
360 3300053139 Ga0500568_0063333 Ga0500568_0063333_323_1057 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02525

Flavodoxin_2

Flavodoxin-like fold

42

234

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2amj-assembly1.cif.gz_A crystal structure of modulator of drug activity b from escherichia coli o157:h7 0.9297 32 220
4s24-assembly1.cif.gz_A-2 1.7 angstrom crystal structure of of putative modulator of drug activity (apo- form) from yersinia pestis co92 0.9235 30 222
2b3d-assembly1.cif.gz_B crystal structure of modulator of drug activity b in complex with flavin adenine dinucleotide 0.9176 31 224
3rpe-assembly1.cif.gz_B 1.1 angstrom crystal structure of putative modulator of drug activity (mdab) from yersinia pestis co92. 0.9154 30 222
2amj-assembly1.cif.gz_B crystal structure of modulator of drug activity b from escherichia coli o157:h7 0.9104 30 220
ID Description Score Start End Superfamily
4s24A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9065 31 222 3.40.50.360
4s24A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8788 31 222 3.40.50.360
af_A0A2R8PW65_111_288_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7698 99 224 3.40.50.360
af_P0A756_6_178_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7524 31 222 3.40.50.360
4d02A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7467 33 223 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A4Y7U5D1-F1-model_v4 Flavodoxin family protein 0.9631 31 119
AF-A0A439C948-F1-model_v4 deleted 0.945 31 115
AF-A0A495LKE2-F1-model_v4 Putative NADPH-quinone reductase 0.9445 31 226
AF-H7FV39-F1-model_v4 NAD(P)H dehydrogenase (Quinone) 0.9406 26 226
AF-A0A0U1KKJ5-F1-model_v4 Modulator of drug activity B 0.9406 31 223

Feature Viewer

pLDDT pTM Quality
86.8 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map