F421669
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 359 | 177 | 359 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300049572|Ga0501036_0128448|Ga0501036_0128448_361_762 |
| Length | 133 |
| Sequence | LFLHDHARIVLGMQRAMMILIAGPYRSGTDDDPDKLAANLAYLESMAWPIFEAGHIPMIGEWVALPVMRGLGSVVGDPVSLTVLTPTAERLLQHCDAVLRLPGDSTGADNDVRIAHDRGIPVYHSIDELPRVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 125 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 128 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 129 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 131 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 132 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 133 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 135 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 136 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 137 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 142 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 150 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 151 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 152 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 154 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 155 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 156 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 157 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 158 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 159 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 160 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 170 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 172 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 173 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 174 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 175 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 176 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.72 |
| Metatranscriptomes | 0.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.67 |
| Nodule | 0 |
| Rhizoplane | 4.18 |
| Rhizosphere | 91.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10060954 | 3300001979 | Bacteria | 1040 |
| 2 | JGI24743J22301_10145652 | 3300001991 | Bacteria | 529 |
| 3 | Ga0070658_10180991 | 3300005327 | Bacteria | 1773 |
| 4 | Ga0070683_100007315 | 3300005329 | Bacteria | 9321 |
| 5 | Ga0070683_100072023 | 3300005329 | Bacteria | 3225 |
| 6 | Ga0070683_100117877 | 3300005329 | Bacteria | 2507 |
| 7 | Ga0070683_100164908 | 3300005329 | Bacteria | 2102 |
| 8 | Ga0070670_100017735 | 3300005331 | Bacteria | 6108 |
| 9 | Ga0070670_100283345 | 3300005331 | Bacteria | 1447 |
| 10 | Ga0070670_101196097 | 3300005331 | Unclassified | 695 |
| 11 | Ga0068869_100021264 | 3300005334 | Bacteria | 4462 |
| 12 | Ga0070682_100042676 | 3300005337 | Bacteria | 2802 |
| 13 | Ga0068868_100000062 | 3300005338 | Bacteria | 61833 |
| 14 | Ga0068868_100352536 | 3300005338 | Bacteria | 1261 |
| 15 | Ga0068868_100435314 | 3300005338 | Unclassified | 1138 |
| 16 | Ga0070691_10117749 | 3300005341 | Bacteria | 1335 |
| 17 | Ga0070691_10511927 | 3300005341 | Unclassified | 695 |
| 18 | Ga0070661_100008244 | 3300005344 | Bacteria | 7192 |
| 19 | Ga0070661_100288225 | 3300005344 | Bacteria | 1275 |
| 20 | Ga0070661_101291856 | 3300005344 | Unclassified | 612 |
| 21 | Ga0070692_10373546 | 3300005345 | Bacteria | 892 |
| 22 | Ga0070668_100650734 | 3300005347 | Bacteria | 926 |
| 23 | Ga0070669_101179294 | 3300005353 | Bacteria | 661 |
| 24 | Ga0070675_101077354 | 3300005354 | Bacteria | 739 |
| 25 | Ga0070675_101312349 | 3300005354 | Bacteria | 667 |
| 26 | Ga0070673_100492943 | 3300005364 | Bacteria | 1107 |
| 27 | Ga0070667_100006533 | 3300005367 | Bacteria | 9690 |
| 28 | Ga0070667_100909158 | 3300005367 | Bacteria | 819 |
| 29 | Ga0070713_100003445 | 3300005436 | Bacteria | 10442 |
| 30 | Ga0070713_100244476 | 3300005436 | Bacteria | 1635 |
| 31 | Ga0070710_11091968 | 3300005437 | Bacteria | 585 |
| 32 | Ga0070711_100346530 | 3300005439 | Bacteria | 1193 |
| 33 | Ga0070700_100006465 | 3300005441 | Bacteria | 6274 |
| 34 | Ga0070662_100349391 | 3300005457 | Bacteria | 1211 |
| 35 | Ga0068867_100832911 | 3300005459 | Bacteria | 825 |
| 36 | Ga0070684_100108138 | 3300005535 | Bacteria | 2492 |
| 37 | Ga0070684_100225565 | 3300005535 | Bacteria | 1710 |
| 38 | Ga0070684_101050364 | 3300005535 | Bacteria | 765 |
| 39 | Ga0068853_100000080 | 3300005539 | Bacteria | 66513 |
| 40 | Ga0068853_100572065 | 3300005539 | Bacteria | 1072 |
| 41 | Ga0068853_100572639 | 3300005539 | Bacteria | 1071 |
| 42 | Ga0070665_100062502 | 3300005548 | Bacteria | 3734 |
| 43 | Ga0070665_100484963 | 3300005548 | Bacteria | 1247 |
| 44 | Ga0070665_102097913 | 3300005548 | Bacteria | 570 |
| 45 | Ga0068855_100001109 | 3300005563 | Bacteria | 33489 |
| 46 | Ga0068855_100003174 | 3300005563 | Bacteria | 20121 |
| 47 | Ga0068855_100006929 | 3300005563 | Bacteria | 13746 |
| 48 | Ga0068855_100404921 | 3300005563 | Bacteria | 1495 |
| 49 | Ga0070664_100166361 | 3300005564 | Bacteria | 1954 |
| 50 | Ga0070664_100388291 | 3300005564 | Bacteria | 1275 |
| 51 | Ga0070664_101415766 | 3300005564 | Bacteria | 657 |
| 52 | Ga0070664_101774065 | 3300005564 | Bacteria | 585 |
| 53 | Ga0070664_102307834 | 3300005564 | Unclassified | 510 |
| 54 | Ga0068857_100043730 | 3300005577 | Bacteria | 3972 |
| 55 | Ga0068857_100044151 | 3300005577 | Bacteria | 3953 |
| 56 | Ga0068857_100520495 | 3300005577 | Bacteria | 1118 |
| 57 | Ga0068854_100018561 | 3300005578 | Bacteria | 4672 |
| 58 | Ga0068854_100617688 | 3300005578 | Bacteria | 927 |
| 59 | Ga0068856_100007467 | 3300005614 | Bacteria | 10672 |
| 60 | Ga0068856_100081568 | 3300005614 | Bacteria | 3209 |
| 61 | Ga0068856_100404940 | 3300005614 | Bacteria | 1384 |
| 62 | Ga0068856_100691908 | 3300005614 | Bacteria | 1040 |
| 63 | Ga0068856_100949434 | 3300005614 | Bacteria | 878 |
| 64 | Ga0070702_101341282 | 3300005615 | Bacteria | 582 |
| 65 | Ga0068852_100000225 | 3300005616 | Bacteria | 38260 |
| 66 | Ga0068852_100000287 | 3300005616 | Bacteria | 33809 |
| 67 | Ga0068852_100500083 | 3300005616 | Bacteria | 1210 |
| 68 | Ga0068852_100787580 | 3300005616 | Bacteria | 964 |
| 69 | Ga0068859_100226914 | 3300005617 | Bacteria | 1956 |
| 70 | Ga0068859_101632620 | 3300005617 | Unclassified | 712 |
| 71 | Ga0068864_100001181 | 3300005618 | Bacteria | 21761 |
| 72 | Ga0068864_100923244 | 3300005618 | Bacteria | 863 |
| 73 | Ga0068864_101193600 | 3300005618 | Bacteria | 759 |
| 74 | Ga0068861_100104993 | 3300005719 | Bacteria | 2255 |
| 75 | Ga0068861_100262877 | 3300005719 | Bacteria | 1478 |
| 76 | Ga0068861_100636757 | 3300005719 | Bacteria | 983 |
| 77 | Ga0068851_10053520 | 3300005834 | Bacteria | 2055 |
| 78 | Ga0068870_10077056 | 3300005840 | Bacteria | 1833 |
| 79 | Ga0068863_100000893 | 3300005841 | Bacteria | 30063 |
| 80 | Ga0068858_100075818 | 3300005842 | Bacteria | 3124 |
| 81 | Ga0068860_100014739 | 3300005843 | Bacteria | 7644 |
| 82 | Ga0068862_100353506 | 3300005844 | Bacteria | 1364 |
| 83 | Ga0081538_10102803 | 3300005981 | Bacteria | 1432 |
| 84 | Ga0081540_1080513 | 3300005983 | Bacteria | 1468 |
| 85 | Ga0081539_10010411 | 3300005985 | Bacteria | 7558 |
| 86 | Ga0070717_10019092 | 3300006028 | Bacteria | 5369 |
| 87 | Ga0070717_11626394 | 3300006028 | Unclassified | 585 |
| 88 | Ga0070715_10315641 | 3300006163 | Bacteria | 842 |
| 89 | Ga0070716_100242826 | 3300006173 | Unclassified | 1222 |
| 90 | Ga0070712_100319744 | 3300006175 | Unclassified | 1262 |
| 91 | Ga0097621_100013602 | 3300006237 | Bacteria | 6071 |
| 92 | Ga0097621_100688220 | 3300006237 | Bacteria | 941 |
| 93 | Ga0068871_100051957 | 3300006358 | Bacteria | 3318 |
| 94 | Ga0068871_100342098 | 3300006358 | Bacteria | 1321 |
| 95 | Ga0068871_100570455 | 3300006358 | Bacteria | 1026 |
| 96 | Ga0068871_100728513 | 3300006358 | Bacteria | 910 |
| 97 | Ga0068865_101044914 | 3300006881 | Bacteria | 717 |
| 98 | Ga0097620_100226920 | 3300006931 | Bacteria | 1956 |
| 99 | Ga0097620_101632248 | 3300006931 | Unclassified | 712 |
| 100 | Ga0105240_10001229 | 3300009093 | Bacteria | 44532 |
| 101 | Ga0105240_10001982 | 3300009093 | Bacteria | 33815 |
| 102 | Ga0105240_10002781 | 3300009093 | Bacteria | 27658 |
| 103 | Ga0105240_10007773 | 3300009093 | Bacteria | 15499 |
| 104 | Ga0105240_10016664 | 3300009093 | Bacteria | 9940 |
| 105 | Ga0105240_10069833 | 3300009093 | Unclassified | 4347 |
| 106 | Ga0105240_10197774 | 3300009093 | Bacteria | 2358 |
| 107 | Ga0105240_10550564 | 3300009093 | Bacteria | 1276 |
| 108 | Ga0105240_11458163 | 3300009093 | Bacteria | 718 |
| 109 | Ga0105240_11816793 | 3300009093 | Unclassified | 635 |
| 110 | Ga0105245_10086315 | 3300009098 | Bacteria | 2878 |
| 111 | Ga0105245_10174628 | 3300009098 | Bacteria | 2048 |
| 112 | Ga0105247_10009850 | 3300009101 | Bacteria | 5792 |
| 113 | Ga0105247_10572273 | 3300009101 | Unclassified | 834 |
| 114 | Ga0105243_10027954 | 3300009148 | Bacteria | 4326 |
| 115 | Ga0105241_10000287 | 3300009174 | Bacteria | 37524 |
| 116 | Ga0105241_10010264 | 3300009174 | Bacteria | 6877 |
| 117 | Ga0105241_10011189 | 3300009174 | Bacteria | 6580 |
| 118 | Ga0105241_10035349 | 3300009174 | Bacteria | 3758 |
| 119 | Ga0105241_10360455 | 3300009174 | Bacteria | 1265 |
| 120 | Ga0105241_10931743 | 3300009174 | Unclassified | 809 |
| 121 | Ga0105241_10976518 | 3300009174 | Unclassified | 791 |
| 122 | Ga0105241_11532345 | 3300009174 | Unclassified | 643 |
| 123 | Ga0105241_12254881 | 3300009174 | Bacteria | 541 |
| 124 | Ga0105242_10420857 | 3300009176 | Bacteria | 1252 |
| 125 | Ga0105248_10000596 | 3300009177 | Bacteria | 41138 |
| 126 | Ga0105248_10005645 | 3300009177 | Bacteria | 13741 |
| 127 | Ga0105237_10022943 | 3300009545 | Bacteria | 6400 |
| 128 | Ga0105237_10084996 | 3300009545 | Bacteria | 3154 |
| 129 | Ga0105237_10117568 | 3300009545 | Unclassified | 2652 |
| 130 | Ga0105237_10243257 | 3300009545 | Bacteria | 1801 |
| 131 | Ga0105237_10657035 | 3300009545 | Bacteria | 1055 |
| 132 | Ga0105237_10698773 | 3300009545 | Bacteria | 1021 |
| 133 | Ga0105238_10000307 | 3300009551 | Bacteria | 53404 |
| 134 | Ga0105238_10000716 | 3300009551 | Bacteria | 34688 |
| 135 | Ga0105238_10008623 | 3300009551 | Bacteria | 10200 |
| 136 | Ga0105238_10260994 | 3300009551 | Bacteria | 1712 |
| 137 | Ga0105238_10696328 | 3300009551 | Bacteria | 1028 |
| 138 | Ga0105249_10538989 | 3300009553 | Bacteria | 1216 |
| 139 | Ga0105249_11443920 | 3300009553 | Unclassified | 760 |
| 140 | Ga0105249_12551555 | 3300009553 | Bacteria | 583 |
| 141 | Ga0105239_10002150 | 3300010375 | Bacteria | 25365 |
| 142 | Ga0105239_10007632 | 3300010375 | Bacteria | 12397 |
| 143 | Ga0105239_10008040 | 3300010375 | Bacteria | 12036 |
| 144 | Ga0105239_10218110 | 3300010375 | Bacteria | 2139 |
| 145 | Ga0105239_10263687 | 3300010375 | Bacteria | 1936 |
| 146 | Ga0105239_10646711 | 3300010375 | Bacteria | 1208 |
| 147 | Ga0105239_10845503 | 3300010375 | Bacteria | 1049 |
| 148 | Ga0105239_11839458 | 3300010375 | Unclassified | 702 |
| 149 | Ga0105239_13499235 | 3300010375 | Bacteria | 510 |
| 150 | Ga0105246_10006027 | 3300011119 | Bacteria | 7399 |
| 151 | Ga0105246_10301064 | 3300011119 | Bacteria | 1295 |
| 152 | Ga0157373_10130551 | 3300013100 | Bacteria | 1767 |
| 153 | Ga0157373_10132806 | 3300013100 | Bacteria | 1750 |
| 154 | Ga0157371_10878970 | 3300013102 | Bacteria | 679 |
| 155 | Ga0157370_10001105 | 3300013104 | Bacteria | 33807 |
| 156 | Ga0157370_10759565 | 3300013104 | Bacteria | 883 |
| 157 | Ga0157369_10001102 | 3300013105 | Bacteria | 33815 |
| 158 | Ga0157369_10002503 | 3300013105 | Bacteria | 21992 |
| 159 | Ga0157369_10010466 | 3300013105 | Bacteria | 10566 |
| 160 | Ga0157369_10016092 | 3300013105 | Bacteria | 8416 |
| 161 | Ga0157369_10048883 | 3300013105 | Bacteria | 4588 |
| 162 | Ga0157369_10191645 | 3300013105 | Bacteria | 2148 |
| 163 | Ga0157369_10305795 | 3300013105 | Bacteria | 1654 |
| 164 | Ga0157369_10318766 | 3300013105 | Bacteria | 1616 |
| 165 | Ga0157369_10805778 | 3300013105 | Bacteria | 965 |
| 166 | Ga0157369_11224283 | 3300013105 | Bacteria | 766 |
| 167 | Ga0157369_12348851 | 3300013105 | Bacteria | 540 |
| 168 | Ga0157374_10013755 | 3300013296 | Bacteria | 7069 |
| 169 | Ga0157374_10020337 | 3300013296 | Bacteria | 5889 |
| 170 | Ga0157374_10036265 | 3300013296 | Bacteria | 4515 |
| 171 | Ga0157374_10097628 | 3300013296 | Bacteria | 2811 |
| 172 | Ga0157374_10118775 | 3300013296 | Bacteria | 2550 |
| 173 | Ga0157374_10191172 | 3300013296 | Bacteria | 2002 |
| 174 | Ga0157374_10685156 | 3300013296 | Unclassified | 1037 |
| 175 | Ga0157374_10994361 | 3300013296 | Unclassified | 858 |
| 176 | Ga0157378_10020019 | 3300013297 | Bacteria | 5883 |
| 177 | Ga0157378_10171682 | 3300013297 | Bacteria | 2034 |
| 178 | Ga0157378_10416198 | 3300013297 | Bacteria | 1327 |
| 179 | Ga0157378_10487323 | 3300013297 | Bacteria | 1229 |
| 180 | Ga0163162_10129884 | 3300013306 | Bacteria | 2628 |
| 181 | Ga0163162_10380173 | 3300013306 | Bacteria | 1545 |
| 182 | Ga0157372_10000816 | 3300013307 | Bacteria | 33749 |
| 183 | Ga0157372_10002569 | 3300013307 | Bacteria | 19681 |
| 184 | Ga0157372_10059260 | 3300013307 | Bacteria | 4282 |
| 185 | Ga0157372_10206495 | 3300013307 | Unclassified | 2276 |
| 186 | Ga0157372_10553923 | 3300013307 | Bacteria | 1340 |
| 187 | Ga0157372_10981538 | 3300013307 | Unclassified | 979 |
| 188 | Ga0157372_11092003 | 3300013307 | Bacteria | 923 |
| 189 | Ga0157372_11351632 | 3300013307 | Bacteria | 822 |
| 190 | Ga0157372_12074801 | 3300013307 | Unclassified | 653 |
| 191 | Ga0157372_12615014 | 3300013307 | Bacteria | 579 |
| 192 | Ga0157375_10007806 | 3300013308 | Bacteria | 9362 |
| 193 | Ga0157375_10009362 | 3300013308 | Bacteria | 8598 |
| 194 | Ga0157375_10760255 | 3300013308 | Bacteria | 1120 |
| 195 | Ga0157375_11371606 | 3300013308 | Bacteria | 832 |
| 196 | Ga0163163_10025387 | 3300014325 | Bacteria | 5649 |
| 197 | Ga0182008_10742432 | 3300014497 | Unclassified | 564 |
| 198 | Ga0157379_10034197 | 3300014968 | Bacteria | 4530 |
| 199 | Ga0157376_10044639 | 3300014969 | Bacteria | 3644 |
| 200 | Ga0157376_10118502 | 3300014969 | Bacteria | 2343 |
| 201 | Ga0157376_10123411 | 3300014969 | Bacteria | 2299 |
| 202 | Ga0157376_11506499 | 3300014969 | Unclassified | 706 |
| 203 | Ga0157376_12145065 | 3300014969 | Bacteria | 597 |
| 204 | Ga0163161_10281082 | 3300017792 | Bacteria | 1306 |
| 205 | Ga0163161_11133065 | 3300017792 | Bacteria | 674 |
| 206 | Ga0209437_100017 | 3300025233 | Bacteria | 694471 |
| 207 | Ga0207656_10021534 | 3300025321 | Unclassified | 2577 |
| 208 | Ga0207656_10038506 | 3300025321 | Bacteria | 2018 |
| 209 | Ga0207656_10608897 | 3300025321 | Unclassified | 558 |
| 210 | Ga0207692_10186424 | 3300025898 | Bacteria | 1212 |
| 211 | Ga0207710_10001093 | 3300025900 | Bacteria | 13933 |
| 212 | Ga0207685_10440735 | 3300025905 | Bacteria | 675 |
| 213 | Ga0207699_10104377 | 3300025906 | Bacteria | 1805 |
| 214 | Ga0207645_11217981 | 3300025907 | Bacteria | 505 |
| 215 | Ga0207643_10767263 | 3300025908 | Bacteria | 624 |
| 216 | Ga0207654_10000206 | 3300025911 | Bacteria | 36317 |
| 217 | Ga0207654_10000995 | 3300025911 | Bacteria | 15524 |
| 218 | Ga0207654_10005401 | 3300025911 | Bacteria | 6461 |
| 219 | Ga0207695_10000030 | 3300025913 | Bacteria | 533735 |
| 220 | Ga0207695_10000170 | 3300025913 | Bacteria | 192469 |
| 221 | Ga0207695_10000752 | 3300025913 | Bacteria | 62273 |
| 222 | Ga0207695_10001801 | 3300025913 | Bacteria | 33823 |
| 223 | Ga0207695_10021524 | 3300025913 | Bacteria | 7354 |
| 224 | Ga0207695_10052469 | 3300025913 | Bacteria | 4272 |
| 225 | Ga0207695_10057971 | 3300025913 | Bacteria | 4022 |
| 226 | Ga0207695_10210697 | 3300025913 | Bacteria | 1854 |
| 227 | Ga0207695_10228917 | 3300025913 | Bacteria | 1764 |
| 228 | Ga0207695_10322295 | 3300025913 | Unclassified | 1435 |
| 229 | Ga0207671_10000376 | 3300025914 | Bacteria | 63349 |
| 230 | Ga0207671_10000898 | 3300025914 | Bacteria | 37631 |
| 231 | Ga0207671_10128165 | 3300025914 | Bacteria | 1946 |
| 232 | Ga0207671_11028295 | 3300025914 | Unclassified | 649 |
| 233 | Ga0207663_10206457 | 3300025916 | Bacteria | 1421 |
| 234 | Ga0207649_10248039 | 3300025920 | Unclassified | 1281 |
| 235 | Ga0207649_10918788 | 3300025920 | Bacteria | 687 |
| 236 | Ga0207649_11158972 | 3300025920 | Unclassified | 610 |
| 237 | Ga0207694_10000167 | 3300025924 | Bacteria | 67706 |
| 238 | Ga0207694_10000497 | 3300025924 | Bacteria | 35591 |
| 239 | Ga0207694_10000697 | 3300025924 | Bacteria | 30202 |
| 240 | Ga0207694_10083130 | 3300025924 | Unclassified | 2517 |
| 241 | Ga0207650_10012281 | 3300025925 | Bacteria | 5912 |
| 242 | Ga0207659_10546340 | 3300025926 | Bacteria | 984 |
| 243 | Ga0207687_10003787 | 3300025927 | Bacteria | 10163 |
| 244 | Ga0207687_10012717 | 3300025927 | Bacteria | 5500 |
| 245 | Ga0207687_10863203 | 3300025927 | Bacteria | 773 |
| 246 | Ga0207700_10006810 | 3300025928 | Bacteria | 6945 |
| 247 | Ga0207700_10194239 | 3300025928 | Bacteria | 1707 |
| 248 | Ga0207706_10483667 | 3300025933 | Bacteria | 1069 |
| 249 | Ga0207709_10026091 | 3300025935 | Bacteria | 3353 |
| 250 | Ga0207711_10001551 | 3300025941 | Bacteria | 21254 |
| 251 | Ga0207711_10025902 | 3300025941 | Bacteria | 4919 |
| 252 | Ga0207689_10001915 | 3300025942 | Bacteria | 19684 |
| 253 | Ga0207689_10150698 | 3300025942 | Bacteria | 1917 |
| 254 | Ga0207661_10003807 | 3300025944 | Bacteria | 10520 |
| 255 | Ga0207661_10058133 | 3300025944 | Bacteria | 3112 |
| 256 | Ga0207661_10194028 | 3300025944 | Bacteria | 1782 |
| 257 | Ga0207661_10335762 | 3300025944 | Bacteria | 1361 |
| 258 | Ga0207661_11861970 | 3300025944 | Unclassified | 547 |
| 259 | Ga0207679_10128473 | 3300025945 | Bacteria | 2029 |
| 260 | Ga0207667_10008017 | 3300025949 | Bacteria | 12599 |
| 261 | Ga0207667_10050651 | 3300025949 | Bacteria | 4380 |
| 262 | Ga0207668_10143915 | 3300025972 | Bacteria | 1837 |
| 263 | Ga0207640_10073567 | 3300025981 | Bacteria | 2310 |
| 264 | Ga0207658_10001070 | 3300025986 | Bacteria | 22181 |
| 265 | Ga0207677_10000052 | 3300026023 | Bacteria | 99952 |
| 266 | Ga0207677_10374386 | 3300026023 | Unclassified | 1200 |
| 267 | Ga0207677_11452607 | 3300026023 | Bacteria | 633 |
| 268 | Ga0207703_10052519 | 3300026035 | Bacteria | 3310 |
| 269 | Ga0207639_10000107 | 3300026041 | Bacteria | 67097 |
| 270 | Ga0207639_10673374 | 3300026041 | Bacteria | 958 |
| 271 | Ga0207702_10003582 | 3300026078 | Bacteria | 14117 |
| 272 | Ga0207702_10077520 | 3300026078 | Bacteria | 2875 |
| 273 | Ga0207702_10291293 | 3300026078 | Bacteria | 1547 |
| 274 | Ga0207702_10759269 | 3300026078 | Bacteria | 957 |
| 275 | Ga0207702_11095958 | 3300026078 | Unclassified | 790 |
| 276 | Ga0207641_10000694 | 3300026088 | Bacteria | 36241 |
| 277 | Ga0207648_11538695 | 3300026089 | Bacteria | 625 |
| 278 | Ga0207676_10028307 | 3300026095 | Bacteria | 4184 |
| 279 | Ga0207676_10158924 | 3300026095 | Unclassified | 1956 |
| 280 | Ga0207674_10000701 | 3300026116 | Bacteria | 43653 |
| 281 | Ga0207674_10002663 | 3300026116 | Bacteria | 22291 |
| 282 | Ga0207674_10765125 | 3300026116 | Bacteria | 932 |
| 283 | Ga0207675_100644122 | 3300026118 | Bacteria | 1065 |
| 284 | Ga0207698_10000239 | 3300026142 | Bacteria | 34266 |
| 285 | Ga0207698_10143991 | 3300026142 | Bacteria | 2058 |
| 286 | Ga0207698_11161059 | 3300026142 | Bacteria | 786 |
| 287 | Ga0268266_10017115 | 3300028379 | Bacteria | 6191 |
| 288 | Ga0268266_11251694 | 3300028379 | Bacteria | 717 |
| 289 | Ga0268265_10709938 | 3300028380 | Bacteria | 972 |
| 290 | Ga0268264_10000953 | 3300028381 | Bacteria | 29838 |
| 291 | Ga0265338_10470001 | 3300028800 | Bacteria | 888 |
| 292 | Ga0265765_1053476 | 3300030879 | Bacteria | 559 |
| 293 | Ga0265316_10372466 | 3300031344 | Bacteria | 1031 |
| 294 | Ga0265316_10376881 | 3300031344 | Bacteria | 1024 |
| 295 | Ga0265313_10217201 | 3300031595 | Bacteria | 790 |
| 296 | Ga0307410_10461926 | 3300031852 | Bacteria | 1038 |
| 297 | Ga0307406_10633289 | 3300031901 | Bacteria | 886 |
| 298 | Ga0307409_102250781 | 3300031995 | Bacteria | 574 |
| 299 | Ga0307411_10193907 | 3300032005 | Bacteria | 1554 |
| 300 | Ga0307415_100260301 | 3300032126 | Bacteria | 1415 |
| 301 | Ga0373937_0231091 | 3300036401 | Unclassified | 1742 |
| 302 | Ga0395905_0235810 | 3300037471 | Bacteria | 1710 |
| 303 | Ga0436364_0766720 | 3300037853 | Unclassified | 604 |
| 304 | Ga0436364_1554103 | 3300037853 | Unclassified | 817 |
| 305 | Ga0436363_1632680 | 3300039450 | Bacteria | 636 |
| 306 | Ga0451791_1458144 | 3300041451 | Bacteria | 910 |
| 307 | Ga0451839_0031201 | 3300041496 | Bacteria | 619 |
| 308 | Ga0451843_1324787 | 3300041509 | Bacteria | 597 |
| 309 | Ga0466972_0029807 | 3300044658 | Bacteria | 2687 |
| 310 | Ga0466965_0325113 | 3300044683 | Bacteria | 838 |
| 311 | Ga0466963_0009554 | 3300044694 | Bacteria | 5843 |
| 312 | Ga0453684_0556677 | 3300044712 | Bacteria | 1262 |
| 313 | Ga0466957_0618553 | 3300044842 | Unclassified | 759 |
| 314 | Ga0466967_0001802 | 3300045976 | Bacteria | 12845 |
| 315 | Ga0466967_0254202 | 3300045976 | Bacteria | 1679 |
| 316 | Ga0495629_0709464 | 3300046459 | Unclassified | 668 |
| 317 | Ga0495580_0039886 | 3300046472 | Bacteria | 3359 |
| 318 | Ga0495623_0088265 | 3300046679 | Bacteria | 1909 |
| 319 | Ga0495613_0487482 | 3300046689 | Bacteria | 831 |
| 320 | Ga0495604_0162501 | 3300047317 | Unclassified | 1577 |
| 321 | Ga0495602_0095008 | 3300048088 | Bacteria | 2462 |
| 322 | Ga0496101_0344524 | 3300048904 | Bacteria | 1171 |
| 323 | Ga0496101_0748323 | 3300048904 | Bacteria | 771 |
| 324 | Ga0496104_0050627 | 3300048907 | Bacteria | 3919 |
| 325 | Ga0496105_0210702 | 3300048908 | Bacteria | 1584 |
| 326 | Ga0496105_1246318 | 3300048908 | Unclassified | 545 |
| 327 | Ga0496106_1559026 | 3300048909 | Bacteria | 507 |
| 328 | Ga0496109_1381077 | 3300048912 | Bacteria | 640 |
| 329 | Ga0496109_1620124 | 3300048912 | Bacteria | 581 |
| 330 | Ga0496113_0910021 | 3300048916 | Bacteria | 695 |
| 331 | Ga0496114_0045140 | 3300048917 | Bacteria | 3660 |
| 332 | Ga0496114_0092512 | 3300048917 | Bacteria | 2569 |
| 333 | Ga0496114_0118231 | 3300048917 | Bacteria | 2277 |
| 334 | Ga0496115_0079697 | 3300048918 | Bacteria | 2666 |
| 335 | Ga0496115_0253521 | 3300048918 | Bacteria | 1448 |
| 336 | Ga0496117_0002003 | 3300048920 | Bacteria | 26991 |
| 337 | Ga0496117_0559271 | 3300048920 | Bacteria | 543 |
| 338 | Ga0496122_0008386 | 3300048925 | Bacteria | 11165 |
| 339 | Ga0496123_0001019 | 3300048926 | Bacteria | 42794 |
| 340 | Ga0496123_0004024 | 3300048926 | Bacteria | 15865 |
| 341 | Ga0496124_0000959 | 3300048927 | Bacteria | 46033 |
| 342 | Ga0501036_0128448 | 3300049572 | Bacteria | 2140 |
| 343 | Ga0501039_0655403 | 3300049575 | Bacteria | 822 |
| 344 | Ga0501041_0205219 | 3300049577 | Bacteria | 1236 |
| 345 | Ga0501042_0292359 | 3300049578 | Bacteria | 1177 |
| 346 | Ga0501048_0261056 | 3300049582 | Bacteria | 1231 |
| 347 | Ga0501068_0514967 | 3300049584 | Bacteria | 777 |
| 348 | Ga0501071_0821878 | 3300049587 | Bacteria | 717 |
| 349 | Ga0501076_0227369 | 3300049592 | Bacteria | 1525 |
| 350 | Ga0501079_0615443 | 3300049741 | Bacteria | 855 |
| 351 | Ga0501241_032305 | 3300049758 | Bacteria | 992 |
| 352 | Ga0501035_1496021 | 3300049822 | Bacteria | 515 |
| 353 | nmdc:mga03n38_133485_c1 | 3300050490 | Bacteria | 1233 |
| 354 | nmdc:mga00v17_61426_c1 | 3300050491 | Bacteria | 2310 |
| 355 | Ga0500583_0074674 | 3300053092 | Bacteria | 1627 |
| 356 | Ga0500652_198526 | 3300053131 | Bacteria | 815 |
| 357 | Ga0500627_0292658 | 3300053158 | Bacteria | 712 |
| 358 | Ga0501084_0041202 | 3300054114 | Bacteria | 3863 |
| 359 | Ga0501082_0652300 | 3300060353 | Bacteria | 921 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049578 | Ga0501042_0292359 | Ga0501042_0292359_174_527 | 117 |
| 2 | 3300049587 | Ga0501071_0821878 | Ga0501071_0821878_244_597 | 117 |
| 3 | 3300049592 | Ga0501076_0227369 | Ga0501076_0227369_1085_1438 | 117 |
| 4 | 3300009553 | Ga0105249_12551555 | Ga0105249_125515552 | 121 |
| 5 | 3300025913 | Ga0207695_10000170 | Ga0207695_1000017024 | 121 |
| 6 | 3300031901 | Ga0307406_10633289 | Ga0307406_106332892 | 121 |
| 7 | 3300031995 | Ga0307409_102250781 | Ga0307409_1022507811 | 121 |
| 8 | 3300032005 | Ga0307411_10193907 | Ga0307411_101939072 | 121 |
| 9 | 3300005331 | Ga0070670_101196097 | Ga0070670_1011960971 | 122 |
| 10 | 3300005364 | Ga0070673_100492943 | Ga0070673_1004929432 | 122 |
| 11 | 3300005436 | Ga0070713_100244476 | Ga0070713_1002444762 | 122 |
| 12 | 3300005437 | Ga0070710_11091968 | Ga0070710_110919681 | 122 |
| 13 | 3300005457 | Ga0070662_100349391 | Ga0070662_1003493911 | 122 |
| 14 | 3300005564 | Ga0070664_100388291 | Ga0070664_1003882913 | 122 |
| 15 | 3300005618 | Ga0068864_100923244 | Ga0068864_1009232441 | 122 |
| 16 | 3300006237 | Ga0097621_100688220 | Ga0097621_1006882201 | 122 |
| 17 | 3300006358 | Ga0068871_100342098 | Ga0068871_1003420982 | 122 |
| 18 | 3300009093 | Ga0105240_11816793 | Ga0105240_118167931 | 122 |
| 19 | 3300009176 | Ga0105242_10420857 | Ga0105242_104208571 | 122 |
| 20 | 3300009551 | Ga0105238_10696328 | Ga0105238_106963282 | 122 |
| 21 | 3300013105 | Ga0157369_10318766 | Ga0157369_103187662 | 122 |
| 22 | 3300013297 | Ga0157378_10416198 | Ga0157378_104161981 | 122 |
| 23 | 3300013306 | Ga0163162_10380173 | Ga0163162_103801732 | 122 |
| 24 | 3300013307 | Ga0157372_10206495 | Ga0157372_102064951 | 122 |
| 25 | 3300013307 | Ga0157372_10553923 | Ga0157372_105539232 | 122 |
| 26 | 3300013308 | Ga0157375_11371606 | Ga0157375_113716062 | 122 |
| 27 | 3300025898 | Ga0207692_10186424 | Ga0207692_101864242 | 122 |
| 28 | 3300025928 | Ga0207700_10194239 | Ga0207700_101942392 | 122 |
| 29 | 3300025933 | Ga0207706_10483667 | Ga0207706_104836672 | 122 |
| 30 | 3300025944 | Ga0207661_10335762 | Ga0207661_103357622 | 122 |
| 31 | 3300025945 | Ga0207679_10128473 | Ga0207679_101284732 | 122 |
| 32 | 3300026095 | Ga0207676_10158924 | Ga0207676_101589242 | 122 |
| 33 | 3300026142 | Ga0207698_11161059 | Ga0207698_111610591 | 122 |
| 34 | 3300041496 | Ga0451839_0031201 | Ga0451839_0031201_183_578 | 122 |
| 35 | 3300006173 | Ga0070716_100242826 | Ga0070716_1002428262 | 123 |
| 36 | 3300009101 | Ga0105247_10572273 | Ga0105247_105722731 | 123 |
| 37 | 3300037471 | Ga0395905_0235810 | Ga0395905_0235810_911_1285 | 123 |
| 38 | 3300049572 | Ga0501036_0128448 | Ga0501036_0128448_361_762 | 123 |
| 39 | 3300049575 | Ga0501039_0655403 | Ga0501039_0655403_213_614 | 123 |
| 40 | 3300049577 | Ga0501041_0205219 | Ga0501041_0205219_143_544 | 123 |
| 41 | 3300049582 | Ga0501048_0261056 | Ga0501048_0261056_429_830 | 123 |
| 42 | 3300049741 | Ga0501079_0615443 | Ga0501079_0615443_27_428 | 123 |
| 43 | 3300054114 | Ga0501084_0041202 | Ga0501084_0041202_2122_2523 | 123 |
| 44 | 3300060353 | Ga0501082_0652300 | Ga0501082_0652300_44_445 | 123 |
| 45 | 3300031852 | Ga0307410_10461926 | Ga0307410_104619262 | 124 |
| 46 | 3300049758 | Ga0501241_032305 | Ga0501241_032305_218_604 | 124 |
| 47 | 3300053131 | Ga0500652_198526 | Ga0500652_198526_245_631 | 124 |
| 48 | 3300053158 | Ga0500627_0292658 | Ga0500627_0292658_312_698 | 124 |
| 49 | 3300005985 | Ga0081539_10010411 | Ga0081539_100104114 | 125 |
| 50 | 3300006028 | Ga0070717_10019092 | Ga0070717_100190924 | 125 |
| 51 | 3300009174 | Ga0105241_10360455 | Ga0105241_103604552 | 125 |
| 52 | 3300010375 | Ga0105239_10646711 | Ga0105239_106467112 | 125 |
| 53 | 3300014969 | Ga0157376_10044639 | Ga0157376_100446393 | 125 |
| 54 | 3300048920 | Ga0496117_0559271 | Ga0496117_0559271_44_427 | 125 |
| 55 | 3300048925 | Ga0496122_0008386 | Ga0496122_0008386_31_414 | 125 |
| 56 | 3300048926 | Ga0496123_0004024 | Ga0496123_0004024_4725_5108 | 125 |
| 57 | 3300048927 | Ga0496124_0000959 | Ga0496124_0000959_20568_20951 | 125 |
| 58 | 3300049822 | Ga0501035_1496021 | Ga0501035_1496021_114_497 | 125 |
| 59 | 3300001991 | JGI24743J22301_10145652 | JGI24743J22301_101456521 | 126 |
| 60 | 3300005338 | Ga0068868_100352536 | Ga0068868_1003525362 | 126 |
| 61 | 3300005341 | Ga0070691_10117749 | Ga0070691_101177492 | 126 |
| 62 | 3300005345 | Ga0070692_10373546 | Ga0070692_103735462 | 126 |
| 63 | 3300005354 | Ga0070675_101312349 | Ga0070675_1013123492 | 126 |
| 64 | 3300005441 | Ga0070700_100006465 | Ga0070700_1000064653 | 126 |
| 65 | 3300005548 | Ga0070665_100484963 | Ga0070665_1004849632 | 126 |
| 66 | 3300005563 | Ga0068855_100003174 | Ga0068855_1000031748 | 126 |
| 67 | 3300005564 | Ga0070664_100166361 | Ga0070664_1001663612 | 126 |
| 68 | 3300005578 | Ga0068854_100617688 | Ga0068854_1006176882 | 126 |
| 69 | 3300005616 | Ga0068852_100500083 | Ga0068852_1005000832 | 126 |
| 70 | 3300005719 | Ga0068861_100262877 | Ga0068861_1002628773 | 126 |
| 71 | 3300005719 | Ga0068861_100636757 | Ga0068861_1006367572 | 126 |
| 72 | 3300005840 | Ga0068870_10077056 | Ga0068870_100770562 | 126 |
| 73 | 3300005981 | Ga0081538_10102803 | Ga0081538_101028032 | 126 |
| 74 | 3300006881 | Ga0068865_101044914 | Ga0068865_1010449142 | 126 |
| 75 | 3300009093 | Ga0105240_10007773 | Ga0105240_100077739 | 126 |
| 76 | 3300009148 | Ga0105243_10027954 | Ga0105243_100279542 | 126 |
| 77 | 3300009174 | Ga0105241_12254881 | Ga0105241_122548811 | 126 |
| 78 | 3300010375 | Ga0105239_10845503 | Ga0105239_108455032 | 126 |
| 79 | 3300010375 | Ga0105239_13499235 | Ga0105239_134992352 | 126 |
| 80 | 3300013105 | Ga0157369_10016092 | Ga0157369_100160928 | 126 |
| 81 | 3300013105 | Ga0157369_10805778 | Ga0157369_108057781 | 126 |
| 82 | 3300013296 | Ga0157374_10036265 | Ga0157374_100362657 | 126 |
| 83 | 3300013307 | Ga0157372_11092003 | Ga0157372_110920032 | 126 |
| 84 | 3300017792 | Ga0163161_10281082 | Ga0163161_102810822 | 126 |
| 85 | 3300025233 | Ga0209437_100017 | Ga0209437_100017331 | 126 |
| 86 | 3300025907 | Ga0207645_11217981 | Ga0207645_112179811 | 126 |
| 87 | 3300025908 | Ga0207643_10767263 | Ga0207643_107672632 | 126 |
| 88 | 3300025913 | Ga0207695_10052469 | Ga0207695_100524691 | 126 |
| 89 | 3300025913 | Ga0207695_10057971 | Ga0207695_100579715 | 126 |
| 90 | 3300025913 | Ga0207695_10210697 | Ga0207695_102106973 | 126 |
| 91 | 3300025914 | Ga0207671_10128165 | Ga0207671_101281652 | 126 |
| 92 | 3300025935 | Ga0207709_10026091 | Ga0207709_100260912 | 126 |
| 93 | 3300025942 | Ga0207689_10150698 | Ga0207689_101506982 | 126 |
| 94 | 3300025949 | Ga0207667_10008017 | Ga0207667_1000801712 | 126 |
| 95 | 3300026023 | Ga0207677_11452607 | Ga0207677_114526072 | 126 |
| 96 | 3300026078 | Ga0207702_10077520 | Ga0207702_100775201 | 126 |
| 97 | 3300026118 | Ga0207675_100644122 | Ga0207675_1006441222 | 126 |
| 98 | 3300030879 | Ga0265765_1053476 | Ga0265765_10534761 | 126 |
| 99 | 3300031344 | Ga0265316_10372466 | Ga0265316_103724662 | 126 |
| 100 | 3300032126 | Ga0307415_100260301 | Ga0307415_1002603011 | 126 |
| 101 | 3300039450 | Ga0436363_1632680 | Ga0436363_1632680_80_460 | 126 |
| 102 | 3300041451 | Ga0451791_1458144 | Ga0451791_1458144_108_497 | 126 |
| 103 | 3300041509 | Ga0451843_1324787 | Ga0451843_1324787_41_430 | 126 |
| 104 | 3300044658 | Ga0466972_0029807 | Ga0466972_0029807_1368_1751 | 126 |
| 105 | 3300044712 | Ga0453684_0556677 | Ga0453684_0556677_527_910 | 126 |
| 106 | 3300048904 | Ga0496101_0344524 | Ga0496101_0344524_350_757 | 126 |
| 107 | 3300048917 | Ga0496114_0045140 | Ga0496114_0045140_1742_2131 | 126 |
| 108 | 3300048917 | Ga0496114_0118231 | Ga0496114_0118231_891_1298 | 126 |
| 109 | 3300048920 | Ga0496117_0002003 | Ga0496117_0002003_17679_18095 | 126 |
| 110 | 3300048926 | Ga0496123_0001019 | Ga0496123_0001019_13903_14319 | 126 |
| 111 | 3300049584 | Ga0501068_0514967 | Ga0501068_0514967_273_653 | 126 |
| 112 | 3300050490 | nmdc:mga03n38_133485_c1 | nmdc:mga03n38_133485_c1_189_575 | 126 |
| 113 | 3300050491 | nmdc:mga00v17_61426_c1 | nmdc:mga00v17_61426_c1_63_449 | 126 |
| 114 | 3300053092 | Ga0500583_0074674 | Ga0500583_0074674_1177_1560 | 126 |
| 115 | 3300005329 | Ga0070683_100007315 | Ga0070683_10000731510 | 127 |
| 116 | 3300005329 | Ga0070683_100072023 | Ga0070683_1000720235 | 127 |
| 117 | 3300005331 | Ga0070670_100017735 | Ga0070670_1000177352 | 127 |
| 118 | 3300005331 | Ga0070670_100283345 | Ga0070670_1002833452 | 127 |
| 119 | 3300005334 | Ga0068869_100021264 | Ga0068869_1000212642 | 127 |
| 120 | 3300005338 | Ga0068868_100000062 | Ga0068868_10000006221 | 127 |
| 121 | 3300005341 | Ga0070691_10511927 | Ga0070691_105119271 | 127 |
| 122 | 3300005344 | Ga0070661_100008244 | Ga0070661_1000082447 | 127 |
| 123 | 3300005344 | Ga0070661_101291856 | Ga0070661_1012918561 | 127 |
| 124 | 3300005347 | Ga0070668_100650734 | Ga0070668_1006507341 | 127 |
| 125 | 3300005353 | Ga0070669_101179294 | Ga0070669_1011792941 | 127 |
| 126 | 3300005354 | Ga0070675_101077354 | Ga0070675_1010773541 | 127 |
| 127 | 3300005367 | Ga0070667_100006533 | Ga0070667_1000065334 | 127 |
| 128 | 3300005367 | Ga0070667_100909158 | Ga0070667_1009091582 | 127 |
| 129 | 3300005459 | Ga0068867_100832911 | Ga0068867_1008329111 | 127 |
| 130 | 3300005535 | Ga0070684_100108138 | Ga0070684_1001081382 | 127 |
| 131 | 3300005535 | Ga0070684_100225565 | Ga0070684_1002255652 | 127 |
| 132 | 3300005535 | Ga0070684_101050364 | Ga0070684_1010503642 | 127 |
| 133 | 3300005539 | Ga0068853_100000080 | Ga0068853_10000008032 | 127 |
| 134 | 3300005539 | Ga0068853_100572065 | Ga0068853_1005720652 | 127 |
| 135 | 3300005548 | Ga0070665_102097913 | Ga0070665_1020979131 | 127 |
| 136 | 3300005563 | Ga0068855_100006929 | Ga0068855_1000069295 | 127 |
| 137 | 3300005563 | Ga0068855_100404921 | Ga0068855_1004049212 | 127 |
| 138 | 3300005577 | Ga0068857_100044151 | Ga0068857_1000441517 | 127 |
| 139 | 3300005577 | Ga0068857_100520495 | Ga0068857_1005204952 | 127 |
| 140 | 3300005614 | Ga0068856_100007467 | Ga0068856_1000074672 | 127 |
| 141 | 3300005614 | Ga0068856_100081568 | Ga0068856_1000815683 | 127 |
| 142 | 3300005615 | Ga0070702_101341282 | Ga0070702_1013412821 | 127 |
| 143 | 3300005616 | Ga0068852_100000225 | Ga0068852_10000022531 | 127 |
| 144 | 3300005617 | Ga0068859_100226914 | Ga0068859_1002269142 | 127 |
| 145 | 3300005618 | Ga0068864_100001181 | Ga0068864_1000011812 | 127 |
| 146 | 3300005618 | Ga0068864_101193600 | Ga0068864_1011936001 | 127 |
| 147 | 3300005719 | Ga0068861_100104993 | Ga0068861_1001049931 | 127 |
| 148 | 3300005834 | Ga0068851_10053520 | Ga0068851_100535203 | 127 |
| 149 | 3300005841 | Ga0068863_100000893 | Ga0068863_10000089312 | 127 |
| 150 | 3300005842 | Ga0068858_100075818 | Ga0068858_1000758182 | 127 |
| 151 | 3300005843 | Ga0068860_100014739 | Ga0068860_1000147392 | 127 |
| 152 | 3300005844 | Ga0068862_100353506 | Ga0068862_1003535062 | 127 |
| 153 | 3300005983 | Ga0081540_1080513 | Ga0081540_10805132 | 127 |
| 154 | 3300006028 | Ga0070717_11626394 | Ga0070717_116263941 | 127 |
| 155 | 3300006237 | Ga0097621_100013602 | Ga0097621_1000136022 | 127 |
| 156 | 3300006358 | Ga0068871_100570455 | Ga0068871_1005704552 | 127 |
| 157 | 3300006358 | Ga0068871_100728513 | Ga0068871_1007285131 | 127 |
| 158 | 3300006931 | Ga0097620_100226920 | Ga0097620_1002269203 | 127 |
| 159 | 3300009093 | Ga0105240_10001229 | Ga0105240_1000122936 | 127 |
| 160 | 3300009093 | Ga0105240_10016664 | Ga0105240_100166643 | 127 |
| 161 | 3300009093 | Ga0105240_10069833 | Ga0105240_100698332 | 127 |
| 162 | 3300009093 | Ga0105240_10197774 | Ga0105240_101977742 | 127 |
| 163 | 3300009093 | Ga0105240_11458163 | Ga0105240_114581632 | 127 |
| 164 | 3300009098 | Ga0105245_10174628 | Ga0105245_101746282 | 127 |
| 165 | 3300009101 | Ga0105247_10009850 | Ga0105247_100098504 | 127 |
| 166 | 3300009174 | Ga0105241_10000287 | Ga0105241_100002875 | 127 |
| 167 | 3300009174 | Ga0105241_10010264 | Ga0105241_100102645 | 127 |
| 168 | 3300009174 | Ga0105241_10011189 | Ga0105241_100111893 | 127 |
| 169 | 3300009177 | Ga0105248_10005645 | Ga0105248_100056454 | 127 |
| 170 | 3300009545 | Ga0105237_10022943 | Ga0105237_100229434 | 127 |
| 171 | 3300009545 | Ga0105237_10084996 | Ga0105237_100849963 | 127 |
| 172 | 3300009545 | Ga0105237_10243257 | Ga0105237_102432572 | 127 |
| 173 | 3300009545 | Ga0105237_10698773 | Ga0105237_106987732 | 127 |
| 174 | 3300009551 | Ga0105238_10000716 | Ga0105238_1000071630 | 127 |
| 175 | 3300009551 | Ga0105238_10008623 | Ga0105238_100086232 | 127 |
| 176 | 3300009553 | Ga0105249_10538989 | Ga0105249_105389892 | 127 |
| 177 | 3300009553 | Ga0105249_11443920 | Ga0105249_114439202 | 127 |
| 178 | 3300010375 | Ga0105239_10002150 | Ga0105239_100021505 | 127 |
| 179 | 3300010375 | Ga0105239_10008040 | Ga0105239_100080404 | 127 |
| 180 | 3300010375 | Ga0105239_10263687 | Ga0105239_102636872 | 127 |
| 181 | 3300010375 | Ga0105239_11839458 | Ga0105239_118394582 | 127 |
| 182 | 3300011119 | Ga0105246_10006027 | Ga0105246_100060273 | 127 |
| 183 | 3300011119 | Ga0105246_10301064 | Ga0105246_103010642 | 127 |
| 184 | 3300013100 | Ga0157373_10132806 | Ga0157373_101328062 | 127 |
| 185 | 3300013102 | Ga0157371_10878970 | Ga0157371_108789701 | 127 |
| 186 | 3300013105 | Ga0157369_10002503 | Ga0157369_100025035 | 127 |
| 187 | 3300013105 | Ga0157369_10010466 | Ga0157369_100104668 | 127 |
| 188 | 3300013105 | Ga0157369_10305795 | Ga0157369_103057952 | 127 |
| 189 | 3300013105 | Ga0157369_12348851 | Ga0157369_123488511 | 127 |
| 190 | 3300013296 | Ga0157374_10020337 | Ga0157374_100203372 | 127 |
| 191 | 3300013296 | Ga0157374_10097628 | Ga0157374_100976283 | 127 |
| 192 | 3300013296 | Ga0157374_10191172 | Ga0157374_101911722 | 127 |
| 193 | 3300013297 | Ga0157378_10487323 | Ga0157378_104873232 | 127 |
| 194 | 3300013307 | Ga0157372_10002569 | Ga0157372_100025692 | 127 |
| 195 | 3300013307 | Ga0157372_10981538 | Ga0157372_109815382 | 127 |
| 196 | 3300013307 | Ga0157372_11351632 | Ga0157372_113516321 | 127 |
| 197 | 3300013308 | Ga0157375_10007806 | Ga0157375_100078061 | 127 |
| 198 | 3300013308 | Ga0157375_10760255 | Ga0157375_107602551 | 127 |
| 199 | 3300014325 | Ga0163163_10025387 | Ga0163163_100253872 | 127 |
| 200 | 3300014497 | Ga0182008_10742432 | Ga0182008_107424321 | 127 |
| 201 | 3300014968 | Ga0157379_10034197 | Ga0157379_100341974 | 127 |
| 202 | 3300014969 | Ga0157376_10118502 | Ga0157376_101185022 | 127 |
| 203 | 3300017792 | Ga0163161_11133065 | Ga0163161_111330651 | 127 |
| 204 | 3300025321 | Ga0207656_10038506 | Ga0207656_100385063 | 127 |
| 205 | 3300025900 | Ga0207710_10001093 | Ga0207710_100010938 | 127 |
| 206 | 3300025911 | Ga0207654_10000206 | Ga0207654_1000020629 | 127 |
| 207 | 3300025911 | Ga0207654_10000995 | Ga0207654_100009951 | 127 |
| 208 | 3300025913 | Ga0207695_10000752 | Ga0207695_100007529 | 127 |
| 209 | 3300025913 | Ga0207695_10021524 | Ga0207695_100215246 | 127 |
| 210 | 3300025913 | Ga0207695_10322295 | Ga0207695_103222951 | 127 |
| 211 | 3300025914 | Ga0207671_10000376 | Ga0207671_1000037622 | 127 |
| 212 | 3300025914 | Ga0207671_10000898 | Ga0207671_1000089831 | 127 |
| 213 | 3300025914 | Ga0207671_11028295 | Ga0207671_110282951 | 127 |
| 214 | 3300025924 | Ga0207694_10000167 | Ga0207694_1000016732 | 127 |
| 215 | 3300025924 | Ga0207694_10000497 | Ga0207694_100004972 | 127 |
| 216 | 3300025925 | Ga0207650_10012281 | Ga0207650_100122812 | 127 |
| 217 | 3300025926 | Ga0207659_10546340 | Ga0207659_105463402 | 127 |
| 218 | 3300025927 | Ga0207687_10003787 | Ga0207687_100037872 | 127 |
| 219 | 3300025927 | Ga0207687_10863203 | Ga0207687_108632032 | 127 |
| 220 | 3300025941 | Ga0207711_10025902 | Ga0207711_100259024 | 127 |
| 221 | 3300025942 | Ga0207689_10001915 | Ga0207689_100019152 | 127 |
| 222 | 3300025944 | Ga0207661_10003807 | Ga0207661_100038079 | 127 |
| 223 | 3300025944 | Ga0207661_11861970 | Ga0207661_118619702 | 127 |
| 224 | 3300025949 | Ga0207667_10050651 | Ga0207667_100506516 | 127 |
| 225 | 3300025972 | Ga0207668_10143915 | Ga0207668_101439152 | 127 |
| 226 | 3300025986 | Ga0207658_10001070 | Ga0207658_1000107012 | 127 |
| 227 | 3300026023 | Ga0207677_10000052 | Ga0207677_1000005268 | 127 |
| 228 | 3300026035 | Ga0207703_10052519 | Ga0207703_100525192 | 127 |
| 229 | 3300026041 | Ga0207639_10000107 | Ga0207639_1000010729 | 127 |
| 230 | 3300026041 | Ga0207639_10673374 | Ga0207639_106733742 | 127 |
| 231 | 3300026078 | Ga0207702_10003582 | Ga0207702_100035829 | 127 |
| 232 | 3300026078 | Ga0207702_11095958 | Ga0207702_110959581 | 127 |
| 233 | 3300026088 | Ga0207641_10000694 | Ga0207641_1000069420 | 127 |
| 234 | 3300026089 | Ga0207648_11538695 | Ga0207648_115386951 | 127 |
| 235 | 3300026095 | Ga0207676_10028307 | Ga0207676_100283073 | 127 |
| 236 | 3300026116 | Ga0207674_10000701 | Ga0207674_1000070143 | 127 |
| 237 | 3300026116 | Ga0207674_10765125 | Ga0207674_107651252 | 127 |
| 238 | 3300028379 | Ga0268266_11251694 | Ga0268266_112516941 | 127 |
| 239 | 3300028380 | Ga0268265_10709938 | Ga0268265_107099382 | 127 |
| 240 | 3300028381 | Ga0268264_10000953 | Ga0268264_1000095328 | 127 |
| 241 | 3300037853 | Ga0436364_1554103 | Ga0436364_1554103_311_700 | 127 |
| 242 | 3300044683 | Ga0466965_0325113 | Ga0466965_0325113_259_642 | 127 |
| 243 | 3300045976 | Ga0466967_0254202 | Ga0466967_0254202_150_533 | 127 |
| 244 | 3300048909 | Ga0496106_1559026 | Ga0496106_1559026_63_446 | 127 |
| 245 | 3300048912 | Ga0496109_1381077 | Ga0496109_1381077_46_429 | 127 |
| 246 | 3300048912 | Ga0496109_1620124 | Ga0496109_1620124_153_536 | 127 |
| 247 | 3300048916 | Ga0496113_0910021 | Ga0496113_0910021_51_434 | 127 |
| 248 | 3300001979 | JGI24740J21852_10060954 | JGI24740J21852_100609541 | 128 |
| 249 | 3300005327 | Ga0070658_10180991 | Ga0070658_101809912 | 128 |
| 250 | 3300005329 | Ga0070683_100117877 | Ga0070683_1001178773 | 128 |
| 251 | 3300005329 | Ga0070683_100164908 | Ga0070683_1001649083 | 128 |
| 252 | 3300005337 | Ga0070682_100042676 | Ga0070682_1000426762 | 128 |
| 253 | 3300005338 | Ga0068868_100435314 | Ga0068868_1004353142 | 128 |
| 254 | 3300005344 | Ga0070661_100288225 | Ga0070661_1002882252 | 128 |
| 255 | 3300005436 | Ga0070713_100003445 | Ga0070713_1000034456 | 128 |
| 256 | 3300005439 | Ga0070711_100346530 | Ga0070711_1003465302 | 128 |
| 257 | 3300005539 | Ga0068853_100572639 | Ga0068853_1005726392 | 128 |
| 258 | 3300005548 | Ga0070665_100062502 | Ga0070665_1000625023 | 128 |
| 259 | 3300005563 | Ga0068855_100001109 | Ga0068855_1000011094 | 128 |
| 260 | 3300005564 | Ga0070664_101415766 | Ga0070664_1014157662 | 128 |
| 261 | 3300005564 | Ga0070664_101774065 | Ga0070664_1017740652 | 128 |
| 262 | 3300005564 | Ga0070664_102307834 | Ga0070664_1023078341 | 128 |
| 263 | 3300005577 | Ga0068857_100043730 | Ga0068857_1000437306 | 128 |
| 264 | 3300005578 | Ga0068854_100018561 | Ga0068854_1000185616 | 128 |
| 265 | 3300005614 | Ga0068856_100404940 | Ga0068856_1004049401 | 128 |
| 266 | 3300005614 | Ga0068856_100691908 | Ga0068856_1006919082 | 128 |
| 267 | 3300005614 | Ga0068856_100949434 | Ga0068856_1009494341 | 128 |
| 268 | 3300005616 | Ga0068852_100000287 | Ga0068852_10000028728 | 128 |
| 269 | 3300005616 | Ga0068852_100787580 | Ga0068852_1007875801 | 128 |
| 270 | 3300005617 | Ga0068859_101632620 | Ga0068859_1016326202 | 128 |
| 271 | 3300006163 | Ga0070715_10315641 | Ga0070715_103156411 | 128 |
| 272 | 3300006175 | Ga0070712_100319744 | Ga0070712_1003197442 | 128 |
| 273 | 3300006358 | Ga0068871_100051957 | Ga0068871_1000519573 | 128 |
| 274 | 3300006931 | Ga0097620_101632248 | Ga0097620_1016322482 | 128 |
| 275 | 3300009093 | Ga0105240_10001982 | Ga0105240_100019824 | 128 |
| 276 | 3300009093 | Ga0105240_10002781 | Ga0105240_100027813 | 128 |
| 277 | 3300009093 | Ga0105240_10550564 | Ga0105240_105505643 | 128 |
| 278 | 3300009098 | Ga0105245_10086315 | Ga0105245_100863152 | 128 |
| 279 | 3300009174 | Ga0105241_10035349 | Ga0105241_100353494 | 128 |
| 280 | 3300009174 | Ga0105241_10931743 | Ga0105241_109317431 | 128 |
| 281 | 3300009174 | Ga0105241_10976518 | Ga0105241_109765182 | 128 |
| 282 | 3300009174 | Ga0105241_11532345 | Ga0105241_115323451 | 128 |
| 283 | 3300009177 | Ga0105248_10000596 | Ga0105248_1000059613 | 128 |
| 284 | 3300009545 | Ga0105237_10117568 | Ga0105237_101175682 | 128 |
| 285 | 3300009545 | Ga0105237_10657035 | Ga0105237_106570353 | 128 |
| 286 | 3300009551 | Ga0105238_10000307 | Ga0105238_1000030733 | 128 |
| 287 | 3300009551 | Ga0105238_10260994 | Ga0105238_102609942 | 128 |
| 288 | 3300010375 | Ga0105239_10007632 | Ga0105239_1000763213 | 128 |
| 289 | 3300010375 | Ga0105239_10218110 | Ga0105239_102181103 | 128 |
| 290 | 3300013100 | Ga0157373_10130551 | Ga0157373_101305513 | 128 |
| 291 | 3300013104 | Ga0157370_10001105 | Ga0157370_100011054 | 128 |
| 292 | 3300013104 | Ga0157370_10759565 | Ga0157370_107595652 | 128 |
| 293 | 3300013105 | Ga0157369_10001102 | Ga0157369_100011024 | 128 |
| 294 | 3300013105 | Ga0157369_10048883 | Ga0157369_100488834 | 128 |
| 295 | 3300013105 | Ga0157369_10191645 | Ga0157369_101916453 | 128 |
| 296 | 3300013105 | Ga0157369_11224283 | Ga0157369_112242831 | 128 |
| 297 | 3300013296 | Ga0157374_10013755 | Ga0157374_100137556 | 128 |
| 298 | 3300013296 | Ga0157374_10118775 | Ga0157374_101187751 | 128 |
| 299 | 3300013296 | Ga0157374_10685156 | Ga0157374_106851562 | 128 |
| 300 | 3300013296 | Ga0157374_10994361 | Ga0157374_109943612 | 128 |
| 301 | 3300013297 | Ga0157378_10020019 | Ga0157378_100200194 | 128 |
| 302 | 3300013297 | Ga0157378_10171682 | Ga0157378_101716821 | 128 |
| 303 | 3300013306 | Ga0163162_10129884 | Ga0163162_101298843 | 128 |
| 304 | 3300013307 | Ga0157372_10000816 | Ga0157372_100008164 | 128 |
| 305 | 3300013307 | Ga0157372_10059260 | Ga0157372_100592602 | 128 |
| 306 | 3300013307 | Ga0157372_12074801 | Ga0157372_120748011 | 128 |
| 307 | 3300013307 | Ga0157372_12615014 | Ga0157372_126150142 | 128 |
| 308 | 3300013308 | Ga0157375_10009362 | Ga0157375_100093625 | 128 |
| 309 | 3300014969 | Ga0157376_10123411 | Ga0157376_101234112 | 128 |
| 310 | 3300014969 | Ga0157376_11506499 | Ga0157376_115064992 | 128 |
| 311 | 3300014969 | Ga0157376_12145065 | Ga0157376_121450652 | 128 |
| 312 | 3300025321 | Ga0207656_10021534 | Ga0207656_100215341 | 128 |
| 313 | 3300025321 | Ga0207656_10608897 | Ga0207656_106088971 | 128 |
| 314 | 3300025905 | Ga0207685_10440735 | Ga0207685_104407351 | 128 |
| 315 | 3300025906 | Ga0207699_10104377 | Ga0207699_101043772 | 128 |
| 316 | 3300025911 | Ga0207654_10005401 | Ga0207654_100054014 | 128 |
| 317 | 3300025913 | Ga0207695_10000030 | Ga0207695_10000030370 | 128 |
| 318 | 3300025913 | Ga0207695_10001801 | Ga0207695_1000180127 | 128 |
| 319 | 3300025913 | Ga0207695_10228917 | Ga0207695_102289172 | 128 |
| 320 | 3300025916 | Ga0207663_10206457 | Ga0207663_102064572 | 128 |
| 321 | 3300025920 | Ga0207649_10248039 | Ga0207649_102480392 | 128 |
| 322 | 3300025920 | Ga0207649_10918788 | Ga0207649_109187881 | 128 |
| 323 | 3300025920 | Ga0207649_11158972 | Ga0207649_111589721 | 128 |
| 324 | 3300025924 | Ga0207694_10000697 | Ga0207694_1000069718 | 128 |
| 325 | 3300025924 | Ga0207694_10083130 | Ga0207694_100831302 | 128 |
| 326 | 3300025927 | Ga0207687_10012717 | Ga0207687_100127175 | 128 |
| 327 | 3300025928 | Ga0207700_10006810 | Ga0207700_100068105 | 128 |
| 328 | 3300025941 | Ga0207711_10001551 | Ga0207711_100015518 | 128 |
| 329 | 3300025944 | Ga0207661_10058133 | Ga0207661_100581333 | 128 |
| 330 | 3300025944 | Ga0207661_10194028 | Ga0207661_101940282 | 128 |
| 331 | 3300025981 | Ga0207640_10073567 | Ga0207640_100735673 | 128 |
| 332 | 3300026023 | Ga0207677_10374386 | Ga0207677_103743861 | 128 |
| 333 | 3300026078 | Ga0207702_10291293 | Ga0207702_102912932 | 128 |
| 334 | 3300026078 | Ga0207702_10759269 | Ga0207702_107592692 | 128 |
| 335 | 3300026116 | Ga0207674_10002663 | Ga0207674_100026636 | 128 |
| 336 | 3300026142 | Ga0207698_10000239 | Ga0207698_1000023927 | 128 |
| 337 | 3300026142 | Ga0207698_10143991 | Ga0207698_101439912 | 128 |
| 338 | 3300028379 | Ga0268266_10017115 | Ga0268266_100171153 | 128 |
| 339 | 3300028800 | Ga0265338_10470001 | Ga0265338_104700012 | 128 |
| 340 | 3300031344 | Ga0265316_10376881 | Ga0265316_103768811 | 128 |
| 341 | 3300031595 | Ga0265313_10217201 | Ga0265313_102172011 | 128 |
| 342 | 3300036401 | Ga0373937_0231091 | Ga0373937_0231091_714_1124 | 128 |
| 343 | 3300037853 | Ga0436364_0766720 | Ga0436364_0766720_202_594 | 128 |
| 344 | 3300044694 | Ga0466963_0009554 | Ga0466963_0009554_3149_3544 | 128 |
| 345 | 3300044842 | Ga0466957_0618553 | Ga0466957_0618553_168_563 | 128 |
| 346 | 3300045976 | Ga0466967_0001802 | Ga0466967_0001802_11730_12125 | 128 |
| 347 | 3300046459 | Ga0495629_0709464 | Ga0495629_0709464_147_557 | 128 |
| 348 | 3300046472 | Ga0495580_0039886 | Ga0495580_0039886_2764_3174 | 128 |
| 349 | 3300046679 | Ga0495623_0088265 | Ga0495623_0088265_353_760 | 128 |
| 350 | 3300046689 | Ga0495613_0487482 | Ga0495613_0487482_248_658 | 128 |
| 351 | 3300047317 | Ga0495604_0162501 | Ga0495604_0162501_105_575 | 128 |
| 352 | 3300048088 | Ga0495602_0095008 | Ga0495602_0095008_822_1229 | 128 |
| 353 | 3300048904 | Ga0496101_0748323 | Ga0496101_0748323_349_753 | 128 |
| 354 | 3300048907 | Ga0496104_0050627 | Ga0496104_0050627_704_1108 | 128 |
| 355 | 3300048908 | Ga0496105_0210702 | Ga0496105_0210702_329_733 | 128 |
| 356 | 3300048908 | Ga0496105_1246318 | Ga0496105_1246318_122_529 | 128 |
| 357 | 3300048917 | Ga0496114_0092512 | Ga0496114_0092512_1419_1823 | 128 |
| 358 | 3300048918 | Ga0496115_0079697 | Ga0496115_0079697_191_595 | 128 |
| 359 | 3300048918 | Ga0496115_0253521 | Ga0496115_0253521_780_1187 | 128 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7agh-assembly2.cif.gz_A | crystal structure of sf kinase yihv from e. coli in complex with amppnp-mg | 0.7924 | 83 | 113 |
| 1t1j-assembly2.cif.gz_B | crystal structure of genomics apc5043 | 0.7737 | 5 | 114 |
| 4jen-assembly1.cif.gz_A | structure of clostridium botulinum cmp n-glycosidase, bcmb | 0.7569 | 8 | 113 |
| 3imk-assembly1.cif.gz_A | crystal structure of putative molybdenum carrier protein (yp_461806.1) from syntrophus aciditrophicus sb at 1.45 a resolution | 0.7419 | 76 | 120 |
| 6evs-assembly1.cif.gz_A | characterization of 2-deoxyribosyltransferase from psychrotolerant bacterium bacillus psychrosaccharolyticus: a suitable biocatalyst for the industrial synthesis of antiviral and antitumoral nucleosides | 0.7074 | 8 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t1jA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Hypothetical protein PA1492 | 0.7661 | 5 | 114 | 3.40.50.10400 |
| af_Q8IJ83_29_215_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7547 | 76 | 113 | 3.40.50.2000 |
| af_Q9Y7P9_15_204_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7265 | 6 | 113 | 3.40.50.450 |
| af_P9WP89_3_239_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.706 | 76 | 114 | 3.40.50.720 |
| 1t1jA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Hypothetical protein PA1492 | 0.7034 | 5 | 114 | 3.40.50.10400 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P2K7E7-F1-model_v4 | NUDIX hydrolase | 1.003 | 5 | 61 |
GO:0016787
|
| AF-A0A0N1JTD1-F1-model_v4 | NUDIX hydrolase | 0.9975 | 5 | 123 |
|
| AF-A0A7Z8K2V3-F1-model_v4 | DUF4406 domain-containing protein | 0.9882 | 5 | 123 |
|
| AF-A0A6I5N481-F1-model_v4 | deleted | 0.9827 | 4 | 122 |
|
| AF-A0A4Q7NPH9-F1-model_v4 | Phosphoglycerate kinase | 0.981 | 5 | 124 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar