F421669

General Info

Members Datasets Scaffolds Average Seq Length
359 177 359 130

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0128448|Ga0501036_0128448_361_762
Length 133
Sequence LFLHDHARIVLGMQRAMMILIAGPYRSGTDDDPDKLAANLAYLESMAWPIFEAGHIPMIGEWVALPVMRGLGSVVGDPVSLTVLTPTAERLLQHCDAVLRLPGDSTGADNDVRIAHDRGIPVYHSIDELPRVA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
134 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
135 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
174 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
175 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0
Rhizoplane 4.18
Rhizosphere 91.09
Stem 0
Stem Tuber 0
Unclassified 3.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10060954 3300001979 Bacteria 1040
2 JGI24743J22301_10145652 3300001991 Bacteria 529
3 Ga0070658_10180991 3300005327 Bacteria 1773
4 Ga0070683_100007315 3300005329 Bacteria 9321
5 Ga0070683_100072023 3300005329 Bacteria 3225
6 Ga0070683_100117877 3300005329 Bacteria 2507
7 Ga0070683_100164908 3300005329 Bacteria 2102
8 Ga0070670_100017735 3300005331 Bacteria 6108
9 Ga0070670_100283345 3300005331 Bacteria 1447
10 Ga0070670_101196097 3300005331 Unclassified 695
11 Ga0068869_100021264 3300005334 Bacteria 4462
12 Ga0070682_100042676 3300005337 Bacteria 2802
13 Ga0068868_100000062 3300005338 Bacteria 61833
14 Ga0068868_100352536 3300005338 Bacteria 1261
15 Ga0068868_100435314 3300005338 Unclassified 1138
16 Ga0070691_10117749 3300005341 Bacteria 1335
17 Ga0070691_10511927 3300005341 Unclassified 695
18 Ga0070661_100008244 3300005344 Bacteria 7192
19 Ga0070661_100288225 3300005344 Bacteria 1275
20 Ga0070661_101291856 3300005344 Unclassified 612
21 Ga0070692_10373546 3300005345 Bacteria 892
22 Ga0070668_100650734 3300005347 Bacteria 926
23 Ga0070669_101179294 3300005353 Bacteria 661
24 Ga0070675_101077354 3300005354 Bacteria 739
25 Ga0070675_101312349 3300005354 Bacteria 667
26 Ga0070673_100492943 3300005364 Bacteria 1107
27 Ga0070667_100006533 3300005367 Bacteria 9690
28 Ga0070667_100909158 3300005367 Bacteria 819
29 Ga0070713_100003445 3300005436 Bacteria 10442
30 Ga0070713_100244476 3300005436 Bacteria 1635
31 Ga0070710_11091968 3300005437 Bacteria 585
32 Ga0070711_100346530 3300005439 Bacteria 1193
33 Ga0070700_100006465 3300005441 Bacteria 6274
34 Ga0070662_100349391 3300005457 Bacteria 1211
35 Ga0068867_100832911 3300005459 Bacteria 825
36 Ga0070684_100108138 3300005535 Bacteria 2492
37 Ga0070684_100225565 3300005535 Bacteria 1710
38 Ga0070684_101050364 3300005535 Bacteria 765
39 Ga0068853_100000080 3300005539 Bacteria 66513
40 Ga0068853_100572065 3300005539 Bacteria 1072
41 Ga0068853_100572639 3300005539 Bacteria 1071
42 Ga0070665_100062502 3300005548 Bacteria 3734
43 Ga0070665_100484963 3300005548 Bacteria 1247
44 Ga0070665_102097913 3300005548 Bacteria 570
45 Ga0068855_100001109 3300005563 Bacteria 33489
46 Ga0068855_100003174 3300005563 Bacteria 20121
47 Ga0068855_100006929 3300005563 Bacteria 13746
48 Ga0068855_100404921 3300005563 Bacteria 1495
49 Ga0070664_100166361 3300005564 Bacteria 1954
50 Ga0070664_100388291 3300005564 Bacteria 1275
51 Ga0070664_101415766 3300005564 Bacteria 657
52 Ga0070664_101774065 3300005564 Bacteria 585
53 Ga0070664_102307834 3300005564 Unclassified 510
54 Ga0068857_100043730 3300005577 Bacteria 3972
55 Ga0068857_100044151 3300005577 Bacteria 3953
56 Ga0068857_100520495 3300005577 Bacteria 1118
57 Ga0068854_100018561 3300005578 Bacteria 4672
58 Ga0068854_100617688 3300005578 Bacteria 927
59 Ga0068856_100007467 3300005614 Bacteria 10672
60 Ga0068856_100081568 3300005614 Bacteria 3209
61 Ga0068856_100404940 3300005614 Bacteria 1384
62 Ga0068856_100691908 3300005614 Bacteria 1040
63 Ga0068856_100949434 3300005614 Bacteria 878
64 Ga0070702_101341282 3300005615 Bacteria 582
65 Ga0068852_100000225 3300005616 Bacteria 38260
66 Ga0068852_100000287 3300005616 Bacteria 33809
67 Ga0068852_100500083 3300005616 Bacteria 1210
68 Ga0068852_100787580 3300005616 Bacteria 964
69 Ga0068859_100226914 3300005617 Bacteria 1956
70 Ga0068859_101632620 3300005617 Unclassified 712
71 Ga0068864_100001181 3300005618 Bacteria 21761
72 Ga0068864_100923244 3300005618 Bacteria 863
73 Ga0068864_101193600 3300005618 Bacteria 759
74 Ga0068861_100104993 3300005719 Bacteria 2255
75 Ga0068861_100262877 3300005719 Bacteria 1478
76 Ga0068861_100636757 3300005719 Bacteria 983
77 Ga0068851_10053520 3300005834 Bacteria 2055
78 Ga0068870_10077056 3300005840 Bacteria 1833
79 Ga0068863_100000893 3300005841 Bacteria 30063
80 Ga0068858_100075818 3300005842 Bacteria 3124
81 Ga0068860_100014739 3300005843 Bacteria 7644
82 Ga0068862_100353506 3300005844 Bacteria 1364
83 Ga0081538_10102803 3300005981 Bacteria 1432
84 Ga0081540_1080513 3300005983 Bacteria 1468
85 Ga0081539_10010411 3300005985 Bacteria 7558
86 Ga0070717_10019092 3300006028 Bacteria 5369
87 Ga0070717_11626394 3300006028 Unclassified 585
88 Ga0070715_10315641 3300006163 Bacteria 842
89 Ga0070716_100242826 3300006173 Unclassified 1222
90 Ga0070712_100319744 3300006175 Unclassified 1262
91 Ga0097621_100013602 3300006237 Bacteria 6071
92 Ga0097621_100688220 3300006237 Bacteria 941
93 Ga0068871_100051957 3300006358 Bacteria 3318
94 Ga0068871_100342098 3300006358 Bacteria 1321
95 Ga0068871_100570455 3300006358 Bacteria 1026
96 Ga0068871_100728513 3300006358 Bacteria 910
97 Ga0068865_101044914 3300006881 Bacteria 717
98 Ga0097620_100226920 3300006931 Bacteria 1956
99 Ga0097620_101632248 3300006931 Unclassified 712
100 Ga0105240_10001229 3300009093 Bacteria 44532
101 Ga0105240_10001982 3300009093 Bacteria 33815
102 Ga0105240_10002781 3300009093 Bacteria 27658
103 Ga0105240_10007773 3300009093 Bacteria 15499
104 Ga0105240_10016664 3300009093 Bacteria 9940
105 Ga0105240_10069833 3300009093 Unclassified 4347
106 Ga0105240_10197774 3300009093 Bacteria 2358
107 Ga0105240_10550564 3300009093 Bacteria 1276
108 Ga0105240_11458163 3300009093 Bacteria 718
109 Ga0105240_11816793 3300009093 Unclassified 635
110 Ga0105245_10086315 3300009098 Bacteria 2878
111 Ga0105245_10174628 3300009098 Bacteria 2048
112 Ga0105247_10009850 3300009101 Bacteria 5792
113 Ga0105247_10572273 3300009101 Unclassified 834
114 Ga0105243_10027954 3300009148 Bacteria 4326
115 Ga0105241_10000287 3300009174 Bacteria 37524
116 Ga0105241_10010264 3300009174 Bacteria 6877
117 Ga0105241_10011189 3300009174 Bacteria 6580
118 Ga0105241_10035349 3300009174 Bacteria 3758
119 Ga0105241_10360455 3300009174 Bacteria 1265
120 Ga0105241_10931743 3300009174 Unclassified 809
121 Ga0105241_10976518 3300009174 Unclassified 791
122 Ga0105241_11532345 3300009174 Unclassified 643
123 Ga0105241_12254881 3300009174 Bacteria 541
124 Ga0105242_10420857 3300009176 Bacteria 1252
125 Ga0105248_10000596 3300009177 Bacteria 41138
126 Ga0105248_10005645 3300009177 Bacteria 13741
127 Ga0105237_10022943 3300009545 Bacteria 6400
128 Ga0105237_10084996 3300009545 Bacteria 3154
129 Ga0105237_10117568 3300009545 Unclassified 2652
130 Ga0105237_10243257 3300009545 Bacteria 1801
131 Ga0105237_10657035 3300009545 Bacteria 1055
132 Ga0105237_10698773 3300009545 Bacteria 1021
133 Ga0105238_10000307 3300009551 Bacteria 53404
134 Ga0105238_10000716 3300009551 Bacteria 34688
135 Ga0105238_10008623 3300009551 Bacteria 10200
136 Ga0105238_10260994 3300009551 Bacteria 1712
137 Ga0105238_10696328 3300009551 Bacteria 1028
138 Ga0105249_10538989 3300009553 Bacteria 1216
139 Ga0105249_11443920 3300009553 Unclassified 760
140 Ga0105249_12551555 3300009553 Bacteria 583
141 Ga0105239_10002150 3300010375 Bacteria 25365
142 Ga0105239_10007632 3300010375 Bacteria 12397
143 Ga0105239_10008040 3300010375 Bacteria 12036
144 Ga0105239_10218110 3300010375 Bacteria 2139
145 Ga0105239_10263687 3300010375 Bacteria 1936
146 Ga0105239_10646711 3300010375 Bacteria 1208
147 Ga0105239_10845503 3300010375 Bacteria 1049
148 Ga0105239_11839458 3300010375 Unclassified 702
149 Ga0105239_13499235 3300010375 Bacteria 510
150 Ga0105246_10006027 3300011119 Bacteria 7399
151 Ga0105246_10301064 3300011119 Bacteria 1295
152 Ga0157373_10130551 3300013100 Bacteria 1767
153 Ga0157373_10132806 3300013100 Bacteria 1750
154 Ga0157371_10878970 3300013102 Bacteria 679
155 Ga0157370_10001105 3300013104 Bacteria 33807
156 Ga0157370_10759565 3300013104 Bacteria 883
157 Ga0157369_10001102 3300013105 Bacteria 33815
158 Ga0157369_10002503 3300013105 Bacteria 21992
159 Ga0157369_10010466 3300013105 Bacteria 10566
160 Ga0157369_10016092 3300013105 Bacteria 8416
161 Ga0157369_10048883 3300013105 Bacteria 4588
162 Ga0157369_10191645 3300013105 Bacteria 2148
163 Ga0157369_10305795 3300013105 Bacteria 1654
164 Ga0157369_10318766 3300013105 Bacteria 1616
165 Ga0157369_10805778 3300013105 Bacteria 965
166 Ga0157369_11224283 3300013105 Bacteria 766
167 Ga0157369_12348851 3300013105 Bacteria 540
168 Ga0157374_10013755 3300013296 Bacteria 7069
169 Ga0157374_10020337 3300013296 Bacteria 5889
170 Ga0157374_10036265 3300013296 Bacteria 4515
171 Ga0157374_10097628 3300013296 Bacteria 2811
172 Ga0157374_10118775 3300013296 Bacteria 2550
173 Ga0157374_10191172 3300013296 Bacteria 2002
174 Ga0157374_10685156 3300013296 Unclassified 1037
175 Ga0157374_10994361 3300013296 Unclassified 858
176 Ga0157378_10020019 3300013297 Bacteria 5883
177 Ga0157378_10171682 3300013297 Bacteria 2034
178 Ga0157378_10416198 3300013297 Bacteria 1327
179 Ga0157378_10487323 3300013297 Bacteria 1229
180 Ga0163162_10129884 3300013306 Bacteria 2628
181 Ga0163162_10380173 3300013306 Bacteria 1545
182 Ga0157372_10000816 3300013307 Bacteria 33749
183 Ga0157372_10002569 3300013307 Bacteria 19681
184 Ga0157372_10059260 3300013307 Bacteria 4282
185 Ga0157372_10206495 3300013307 Unclassified 2276
186 Ga0157372_10553923 3300013307 Bacteria 1340
187 Ga0157372_10981538 3300013307 Unclassified 979
188 Ga0157372_11092003 3300013307 Bacteria 923
189 Ga0157372_11351632 3300013307 Bacteria 822
190 Ga0157372_12074801 3300013307 Unclassified 653
191 Ga0157372_12615014 3300013307 Bacteria 579
192 Ga0157375_10007806 3300013308 Bacteria 9362
193 Ga0157375_10009362 3300013308 Bacteria 8598
194 Ga0157375_10760255 3300013308 Bacteria 1120
195 Ga0157375_11371606 3300013308 Bacteria 832
196 Ga0163163_10025387 3300014325 Bacteria 5649
197 Ga0182008_10742432 3300014497 Unclassified 564
198 Ga0157379_10034197 3300014968 Bacteria 4530
199 Ga0157376_10044639 3300014969 Bacteria 3644
200 Ga0157376_10118502 3300014969 Bacteria 2343
201 Ga0157376_10123411 3300014969 Bacteria 2299
202 Ga0157376_11506499 3300014969 Unclassified 706
203 Ga0157376_12145065 3300014969 Bacteria 597
204 Ga0163161_10281082 3300017792 Bacteria 1306
205 Ga0163161_11133065 3300017792 Bacteria 674
206 Ga0209437_100017 3300025233 Bacteria 694471
207 Ga0207656_10021534 3300025321 Unclassified 2577
208 Ga0207656_10038506 3300025321 Bacteria 2018
209 Ga0207656_10608897 3300025321 Unclassified 558
210 Ga0207692_10186424 3300025898 Bacteria 1212
211 Ga0207710_10001093 3300025900 Bacteria 13933
212 Ga0207685_10440735 3300025905 Bacteria 675
213 Ga0207699_10104377 3300025906 Bacteria 1805
214 Ga0207645_11217981 3300025907 Bacteria 505
215 Ga0207643_10767263 3300025908 Bacteria 624
216 Ga0207654_10000206 3300025911 Bacteria 36317
217 Ga0207654_10000995 3300025911 Bacteria 15524
218 Ga0207654_10005401 3300025911 Bacteria 6461
219 Ga0207695_10000030 3300025913 Bacteria 533735
220 Ga0207695_10000170 3300025913 Bacteria 192469
221 Ga0207695_10000752 3300025913 Bacteria 62273
222 Ga0207695_10001801 3300025913 Bacteria 33823
223 Ga0207695_10021524 3300025913 Bacteria 7354
224 Ga0207695_10052469 3300025913 Bacteria 4272
225 Ga0207695_10057971 3300025913 Bacteria 4022
226 Ga0207695_10210697 3300025913 Bacteria 1854
227 Ga0207695_10228917 3300025913 Bacteria 1764
228 Ga0207695_10322295 3300025913 Unclassified 1435
229 Ga0207671_10000376 3300025914 Bacteria 63349
230 Ga0207671_10000898 3300025914 Bacteria 37631
231 Ga0207671_10128165 3300025914 Bacteria 1946
232 Ga0207671_11028295 3300025914 Unclassified 649
233 Ga0207663_10206457 3300025916 Bacteria 1421
234 Ga0207649_10248039 3300025920 Unclassified 1281
235 Ga0207649_10918788 3300025920 Bacteria 687
236 Ga0207649_11158972 3300025920 Unclassified 610
237 Ga0207694_10000167 3300025924 Bacteria 67706
238 Ga0207694_10000497 3300025924 Bacteria 35591
239 Ga0207694_10000697 3300025924 Bacteria 30202
240 Ga0207694_10083130 3300025924 Unclassified 2517
241 Ga0207650_10012281 3300025925 Bacteria 5912
242 Ga0207659_10546340 3300025926 Bacteria 984
243 Ga0207687_10003787 3300025927 Bacteria 10163
244 Ga0207687_10012717 3300025927 Bacteria 5500
245 Ga0207687_10863203 3300025927 Bacteria 773
246 Ga0207700_10006810 3300025928 Bacteria 6945
247 Ga0207700_10194239 3300025928 Bacteria 1707
248 Ga0207706_10483667 3300025933 Bacteria 1069
249 Ga0207709_10026091 3300025935 Bacteria 3353
250 Ga0207711_10001551 3300025941 Bacteria 21254
251 Ga0207711_10025902 3300025941 Bacteria 4919
252 Ga0207689_10001915 3300025942 Bacteria 19684
253 Ga0207689_10150698 3300025942 Bacteria 1917
254 Ga0207661_10003807 3300025944 Bacteria 10520
255 Ga0207661_10058133 3300025944 Bacteria 3112
256 Ga0207661_10194028 3300025944 Bacteria 1782
257 Ga0207661_10335762 3300025944 Bacteria 1361
258 Ga0207661_11861970 3300025944 Unclassified 547
259 Ga0207679_10128473 3300025945 Bacteria 2029
260 Ga0207667_10008017 3300025949 Bacteria 12599
261 Ga0207667_10050651 3300025949 Bacteria 4380
262 Ga0207668_10143915 3300025972 Bacteria 1837
263 Ga0207640_10073567 3300025981 Bacteria 2310
264 Ga0207658_10001070 3300025986 Bacteria 22181
265 Ga0207677_10000052 3300026023 Bacteria 99952
266 Ga0207677_10374386 3300026023 Unclassified 1200
267 Ga0207677_11452607 3300026023 Bacteria 633
268 Ga0207703_10052519 3300026035 Bacteria 3310
269 Ga0207639_10000107 3300026041 Bacteria 67097
270 Ga0207639_10673374 3300026041 Bacteria 958
271 Ga0207702_10003582 3300026078 Bacteria 14117
272 Ga0207702_10077520 3300026078 Bacteria 2875
273 Ga0207702_10291293 3300026078 Bacteria 1547
274 Ga0207702_10759269 3300026078 Bacteria 957
275 Ga0207702_11095958 3300026078 Unclassified 790
276 Ga0207641_10000694 3300026088 Bacteria 36241
277 Ga0207648_11538695 3300026089 Bacteria 625
278 Ga0207676_10028307 3300026095 Bacteria 4184
279 Ga0207676_10158924 3300026095 Unclassified 1956
280 Ga0207674_10000701 3300026116 Bacteria 43653
281 Ga0207674_10002663 3300026116 Bacteria 22291
282 Ga0207674_10765125 3300026116 Bacteria 932
283 Ga0207675_100644122 3300026118 Bacteria 1065
284 Ga0207698_10000239 3300026142 Bacteria 34266
285 Ga0207698_10143991 3300026142 Bacteria 2058
286 Ga0207698_11161059 3300026142 Bacteria 786
287 Ga0268266_10017115 3300028379 Bacteria 6191
288 Ga0268266_11251694 3300028379 Bacteria 717
289 Ga0268265_10709938 3300028380 Bacteria 972
290 Ga0268264_10000953 3300028381 Bacteria 29838
291 Ga0265338_10470001 3300028800 Bacteria 888
292 Ga0265765_1053476 3300030879 Bacteria 559
293 Ga0265316_10372466 3300031344 Bacteria 1031
294 Ga0265316_10376881 3300031344 Bacteria 1024
295 Ga0265313_10217201 3300031595 Bacteria 790
296 Ga0307410_10461926 3300031852 Bacteria 1038
297 Ga0307406_10633289 3300031901 Bacteria 886
298 Ga0307409_102250781 3300031995 Bacteria 574
299 Ga0307411_10193907 3300032005 Bacteria 1554
300 Ga0307415_100260301 3300032126 Bacteria 1415
301 Ga0373937_0231091 3300036401 Unclassified 1742
302 Ga0395905_0235810 3300037471 Bacteria 1710
303 Ga0436364_0766720 3300037853 Unclassified 604
304 Ga0436364_1554103 3300037853 Unclassified 817
305 Ga0436363_1632680 3300039450 Bacteria 636
306 Ga0451791_1458144 3300041451 Bacteria 910
307 Ga0451839_0031201 3300041496 Bacteria 619
308 Ga0451843_1324787 3300041509 Bacteria 597
309 Ga0466972_0029807 3300044658 Bacteria 2687
310 Ga0466965_0325113 3300044683 Bacteria 838
311 Ga0466963_0009554 3300044694 Bacteria 5843
312 Ga0453684_0556677 3300044712 Bacteria 1262
313 Ga0466957_0618553 3300044842 Unclassified 759
314 Ga0466967_0001802 3300045976 Bacteria 12845
315 Ga0466967_0254202 3300045976 Bacteria 1679
316 Ga0495629_0709464 3300046459 Unclassified 668
317 Ga0495580_0039886 3300046472 Bacteria 3359
318 Ga0495623_0088265 3300046679 Bacteria 1909
319 Ga0495613_0487482 3300046689 Bacteria 831
320 Ga0495604_0162501 3300047317 Unclassified 1577
321 Ga0495602_0095008 3300048088 Bacteria 2462
322 Ga0496101_0344524 3300048904 Bacteria 1171
323 Ga0496101_0748323 3300048904 Bacteria 771
324 Ga0496104_0050627 3300048907 Bacteria 3919
325 Ga0496105_0210702 3300048908 Bacteria 1584
326 Ga0496105_1246318 3300048908 Unclassified 545
327 Ga0496106_1559026 3300048909 Bacteria 507
328 Ga0496109_1381077 3300048912 Bacteria 640
329 Ga0496109_1620124 3300048912 Bacteria 581
330 Ga0496113_0910021 3300048916 Bacteria 695
331 Ga0496114_0045140 3300048917 Bacteria 3660
332 Ga0496114_0092512 3300048917 Bacteria 2569
333 Ga0496114_0118231 3300048917 Bacteria 2277
334 Ga0496115_0079697 3300048918 Bacteria 2666
335 Ga0496115_0253521 3300048918 Bacteria 1448
336 Ga0496117_0002003 3300048920 Bacteria 26991
337 Ga0496117_0559271 3300048920 Bacteria 543
338 Ga0496122_0008386 3300048925 Bacteria 11165
339 Ga0496123_0001019 3300048926 Bacteria 42794
340 Ga0496123_0004024 3300048926 Bacteria 15865
341 Ga0496124_0000959 3300048927 Bacteria 46033
342 Ga0501036_0128448 3300049572 Bacteria 2140
343 Ga0501039_0655403 3300049575 Bacteria 822
344 Ga0501041_0205219 3300049577 Bacteria 1236
345 Ga0501042_0292359 3300049578 Bacteria 1177
346 Ga0501048_0261056 3300049582 Bacteria 1231
347 Ga0501068_0514967 3300049584 Bacteria 777
348 Ga0501071_0821878 3300049587 Bacteria 717
349 Ga0501076_0227369 3300049592 Bacteria 1525
350 Ga0501079_0615443 3300049741 Bacteria 855
351 Ga0501241_032305 3300049758 Bacteria 992
352 Ga0501035_1496021 3300049822 Bacteria 515
353 nmdc:mga03n38_133485_c1 3300050490 Bacteria 1233
354 nmdc:mga00v17_61426_c1 3300050491 Bacteria 2310
355 Ga0500583_0074674 3300053092 Bacteria 1627
356 Ga0500652_198526 3300053131 Bacteria 815
357 Ga0500627_0292658 3300053158 Bacteria 712
358 Ga0501084_0041202 3300054114 Bacteria 3863
359 Ga0501082_0652300 3300060353 Bacteria 921

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049578 Ga0501042_0292359 Ga0501042_0292359_174_527 117
2 3300049587 Ga0501071_0821878 Ga0501071_0821878_244_597 117
3 3300049592 Ga0501076_0227369 Ga0501076_0227369_1085_1438 117
4 3300009553 Ga0105249_12551555 Ga0105249_125515552 121
5 3300025913 Ga0207695_10000170 Ga0207695_1000017024 121
6 3300031901 Ga0307406_10633289 Ga0307406_106332892 121
7 3300031995 Ga0307409_102250781 Ga0307409_1022507811 121
8 3300032005 Ga0307411_10193907 Ga0307411_101939072 121
9 3300005331 Ga0070670_101196097 Ga0070670_1011960971 122
10 3300005364 Ga0070673_100492943 Ga0070673_1004929432 122
11 3300005436 Ga0070713_100244476 Ga0070713_1002444762 122
12 3300005437 Ga0070710_11091968 Ga0070710_110919681 122
13 3300005457 Ga0070662_100349391 Ga0070662_1003493911 122
14 3300005564 Ga0070664_100388291 Ga0070664_1003882913 122
15 3300005618 Ga0068864_100923244 Ga0068864_1009232441 122
16 3300006237 Ga0097621_100688220 Ga0097621_1006882201 122
17 3300006358 Ga0068871_100342098 Ga0068871_1003420982 122
18 3300009093 Ga0105240_11816793 Ga0105240_118167931 122
19 3300009176 Ga0105242_10420857 Ga0105242_104208571 122
20 3300009551 Ga0105238_10696328 Ga0105238_106963282 122
21 3300013105 Ga0157369_10318766 Ga0157369_103187662 122
22 3300013297 Ga0157378_10416198 Ga0157378_104161981 122
23 3300013306 Ga0163162_10380173 Ga0163162_103801732 122
24 3300013307 Ga0157372_10206495 Ga0157372_102064951 122
25 3300013307 Ga0157372_10553923 Ga0157372_105539232 122
26 3300013308 Ga0157375_11371606 Ga0157375_113716062 122
27 3300025898 Ga0207692_10186424 Ga0207692_101864242 122
28 3300025928 Ga0207700_10194239 Ga0207700_101942392 122
29 3300025933 Ga0207706_10483667 Ga0207706_104836672 122
30 3300025944 Ga0207661_10335762 Ga0207661_103357622 122
31 3300025945 Ga0207679_10128473 Ga0207679_101284732 122
32 3300026095 Ga0207676_10158924 Ga0207676_101589242 122
33 3300026142 Ga0207698_11161059 Ga0207698_111610591 122
34 3300041496 Ga0451839_0031201 Ga0451839_0031201_183_578 122
35 3300006173 Ga0070716_100242826 Ga0070716_1002428262 123
36 3300009101 Ga0105247_10572273 Ga0105247_105722731 123
37 3300037471 Ga0395905_0235810 Ga0395905_0235810_911_1285 123
38 3300049572 Ga0501036_0128448 Ga0501036_0128448_361_762 123
39 3300049575 Ga0501039_0655403 Ga0501039_0655403_213_614 123
40 3300049577 Ga0501041_0205219 Ga0501041_0205219_143_544 123
41 3300049582 Ga0501048_0261056 Ga0501048_0261056_429_830 123
42 3300049741 Ga0501079_0615443 Ga0501079_0615443_27_428 123
43 3300054114 Ga0501084_0041202 Ga0501084_0041202_2122_2523 123
44 3300060353 Ga0501082_0652300 Ga0501082_0652300_44_445 123
45 3300031852 Ga0307410_10461926 Ga0307410_104619262 124
46 3300049758 Ga0501241_032305 Ga0501241_032305_218_604 124
47 3300053131 Ga0500652_198526 Ga0500652_198526_245_631 124
48 3300053158 Ga0500627_0292658 Ga0500627_0292658_312_698 124
49 3300005985 Ga0081539_10010411 Ga0081539_100104114 125
50 3300006028 Ga0070717_10019092 Ga0070717_100190924 125
51 3300009174 Ga0105241_10360455 Ga0105241_103604552 125
52 3300010375 Ga0105239_10646711 Ga0105239_106467112 125
53 3300014969 Ga0157376_10044639 Ga0157376_100446393 125
54 3300048920 Ga0496117_0559271 Ga0496117_0559271_44_427 125
55 3300048925 Ga0496122_0008386 Ga0496122_0008386_31_414 125
56 3300048926 Ga0496123_0004024 Ga0496123_0004024_4725_5108 125
57 3300048927 Ga0496124_0000959 Ga0496124_0000959_20568_20951 125
58 3300049822 Ga0501035_1496021 Ga0501035_1496021_114_497 125
59 3300001991 JGI24743J22301_10145652 JGI24743J22301_101456521 126
60 3300005338 Ga0068868_100352536 Ga0068868_1003525362 126
61 3300005341 Ga0070691_10117749 Ga0070691_101177492 126
62 3300005345 Ga0070692_10373546 Ga0070692_103735462 126
63 3300005354 Ga0070675_101312349 Ga0070675_1013123492 126
64 3300005441 Ga0070700_100006465 Ga0070700_1000064653 126
65 3300005548 Ga0070665_100484963 Ga0070665_1004849632 126
66 3300005563 Ga0068855_100003174 Ga0068855_1000031748 126
67 3300005564 Ga0070664_100166361 Ga0070664_1001663612 126
68 3300005578 Ga0068854_100617688 Ga0068854_1006176882 126
69 3300005616 Ga0068852_100500083 Ga0068852_1005000832 126
70 3300005719 Ga0068861_100262877 Ga0068861_1002628773 126
71 3300005719 Ga0068861_100636757 Ga0068861_1006367572 126
72 3300005840 Ga0068870_10077056 Ga0068870_100770562 126
73 3300005981 Ga0081538_10102803 Ga0081538_101028032 126
74 3300006881 Ga0068865_101044914 Ga0068865_1010449142 126
75 3300009093 Ga0105240_10007773 Ga0105240_100077739 126
76 3300009148 Ga0105243_10027954 Ga0105243_100279542 126
77 3300009174 Ga0105241_12254881 Ga0105241_122548811 126
78 3300010375 Ga0105239_10845503 Ga0105239_108455032 126
79 3300010375 Ga0105239_13499235 Ga0105239_134992352 126
80 3300013105 Ga0157369_10016092 Ga0157369_100160928 126
81 3300013105 Ga0157369_10805778 Ga0157369_108057781 126
82 3300013296 Ga0157374_10036265 Ga0157374_100362657 126
83 3300013307 Ga0157372_11092003 Ga0157372_110920032 126
84 3300017792 Ga0163161_10281082 Ga0163161_102810822 126
85 3300025233 Ga0209437_100017 Ga0209437_100017331 126
86 3300025907 Ga0207645_11217981 Ga0207645_112179811 126
87 3300025908 Ga0207643_10767263 Ga0207643_107672632 126
88 3300025913 Ga0207695_10052469 Ga0207695_100524691 126
89 3300025913 Ga0207695_10057971 Ga0207695_100579715 126
90 3300025913 Ga0207695_10210697 Ga0207695_102106973 126
91 3300025914 Ga0207671_10128165 Ga0207671_101281652 126
92 3300025935 Ga0207709_10026091 Ga0207709_100260912 126
93 3300025942 Ga0207689_10150698 Ga0207689_101506982 126
94 3300025949 Ga0207667_10008017 Ga0207667_1000801712 126
95 3300026023 Ga0207677_11452607 Ga0207677_114526072 126
96 3300026078 Ga0207702_10077520 Ga0207702_100775201 126
97 3300026118 Ga0207675_100644122 Ga0207675_1006441222 126
98 3300030879 Ga0265765_1053476 Ga0265765_10534761 126
99 3300031344 Ga0265316_10372466 Ga0265316_103724662 126
100 3300032126 Ga0307415_100260301 Ga0307415_1002603011 126
101 3300039450 Ga0436363_1632680 Ga0436363_1632680_80_460 126
102 3300041451 Ga0451791_1458144 Ga0451791_1458144_108_497 126
103 3300041509 Ga0451843_1324787 Ga0451843_1324787_41_430 126
104 3300044658 Ga0466972_0029807 Ga0466972_0029807_1368_1751 126
105 3300044712 Ga0453684_0556677 Ga0453684_0556677_527_910 126
106 3300048904 Ga0496101_0344524 Ga0496101_0344524_350_757 126
107 3300048917 Ga0496114_0045140 Ga0496114_0045140_1742_2131 126
108 3300048917 Ga0496114_0118231 Ga0496114_0118231_891_1298 126
109 3300048920 Ga0496117_0002003 Ga0496117_0002003_17679_18095 126
110 3300048926 Ga0496123_0001019 Ga0496123_0001019_13903_14319 126
111 3300049584 Ga0501068_0514967 Ga0501068_0514967_273_653 126
112 3300050490 nmdc:mga03n38_133485_c1 nmdc:mga03n38_133485_c1_189_575 126
113 3300050491 nmdc:mga00v17_61426_c1 nmdc:mga00v17_61426_c1_63_449 126
114 3300053092 Ga0500583_0074674 Ga0500583_0074674_1177_1560 126
115 3300005329 Ga0070683_100007315 Ga0070683_10000731510 127
116 3300005329 Ga0070683_100072023 Ga0070683_1000720235 127
117 3300005331 Ga0070670_100017735 Ga0070670_1000177352 127
118 3300005331 Ga0070670_100283345 Ga0070670_1002833452 127
119 3300005334 Ga0068869_100021264 Ga0068869_1000212642 127
120 3300005338 Ga0068868_100000062 Ga0068868_10000006221 127
121 3300005341 Ga0070691_10511927 Ga0070691_105119271 127
122 3300005344 Ga0070661_100008244 Ga0070661_1000082447 127
123 3300005344 Ga0070661_101291856 Ga0070661_1012918561 127
124 3300005347 Ga0070668_100650734 Ga0070668_1006507341 127
125 3300005353 Ga0070669_101179294 Ga0070669_1011792941 127
126 3300005354 Ga0070675_101077354 Ga0070675_1010773541 127
127 3300005367 Ga0070667_100006533 Ga0070667_1000065334 127
128 3300005367 Ga0070667_100909158 Ga0070667_1009091582 127
129 3300005459 Ga0068867_100832911 Ga0068867_1008329111 127
130 3300005535 Ga0070684_100108138 Ga0070684_1001081382 127
131 3300005535 Ga0070684_100225565 Ga0070684_1002255652 127
132 3300005535 Ga0070684_101050364 Ga0070684_1010503642 127
133 3300005539 Ga0068853_100000080 Ga0068853_10000008032 127
134 3300005539 Ga0068853_100572065 Ga0068853_1005720652 127
135 3300005548 Ga0070665_102097913 Ga0070665_1020979131 127
136 3300005563 Ga0068855_100006929 Ga0068855_1000069295 127
137 3300005563 Ga0068855_100404921 Ga0068855_1004049212 127
138 3300005577 Ga0068857_100044151 Ga0068857_1000441517 127
139 3300005577 Ga0068857_100520495 Ga0068857_1005204952 127
140 3300005614 Ga0068856_100007467 Ga0068856_1000074672 127
141 3300005614 Ga0068856_100081568 Ga0068856_1000815683 127
142 3300005615 Ga0070702_101341282 Ga0070702_1013412821 127
143 3300005616 Ga0068852_100000225 Ga0068852_10000022531 127
144 3300005617 Ga0068859_100226914 Ga0068859_1002269142 127
145 3300005618 Ga0068864_100001181 Ga0068864_1000011812 127
146 3300005618 Ga0068864_101193600 Ga0068864_1011936001 127
147 3300005719 Ga0068861_100104993 Ga0068861_1001049931 127
148 3300005834 Ga0068851_10053520 Ga0068851_100535203 127
149 3300005841 Ga0068863_100000893 Ga0068863_10000089312 127
150 3300005842 Ga0068858_100075818 Ga0068858_1000758182 127
151 3300005843 Ga0068860_100014739 Ga0068860_1000147392 127
152 3300005844 Ga0068862_100353506 Ga0068862_1003535062 127
153 3300005983 Ga0081540_1080513 Ga0081540_10805132 127
154 3300006028 Ga0070717_11626394 Ga0070717_116263941 127
155 3300006237 Ga0097621_100013602 Ga0097621_1000136022 127
156 3300006358 Ga0068871_100570455 Ga0068871_1005704552 127
157 3300006358 Ga0068871_100728513 Ga0068871_1007285131 127
158 3300006931 Ga0097620_100226920 Ga0097620_1002269203 127
159 3300009093 Ga0105240_10001229 Ga0105240_1000122936 127
160 3300009093 Ga0105240_10016664 Ga0105240_100166643 127
161 3300009093 Ga0105240_10069833 Ga0105240_100698332 127
162 3300009093 Ga0105240_10197774 Ga0105240_101977742 127
163 3300009093 Ga0105240_11458163 Ga0105240_114581632 127
164 3300009098 Ga0105245_10174628 Ga0105245_101746282 127
165 3300009101 Ga0105247_10009850 Ga0105247_100098504 127
166 3300009174 Ga0105241_10000287 Ga0105241_100002875 127
167 3300009174 Ga0105241_10010264 Ga0105241_100102645 127
168 3300009174 Ga0105241_10011189 Ga0105241_100111893 127
169 3300009177 Ga0105248_10005645 Ga0105248_100056454 127
170 3300009545 Ga0105237_10022943 Ga0105237_100229434 127
171 3300009545 Ga0105237_10084996 Ga0105237_100849963 127
172 3300009545 Ga0105237_10243257 Ga0105237_102432572 127
173 3300009545 Ga0105237_10698773 Ga0105237_106987732 127
174 3300009551 Ga0105238_10000716 Ga0105238_1000071630 127
175 3300009551 Ga0105238_10008623 Ga0105238_100086232 127
176 3300009553 Ga0105249_10538989 Ga0105249_105389892 127
177 3300009553 Ga0105249_11443920 Ga0105249_114439202 127
178 3300010375 Ga0105239_10002150 Ga0105239_100021505 127
179 3300010375 Ga0105239_10008040 Ga0105239_100080404 127
180 3300010375 Ga0105239_10263687 Ga0105239_102636872 127
181 3300010375 Ga0105239_11839458 Ga0105239_118394582 127
182 3300011119 Ga0105246_10006027 Ga0105246_100060273 127
183 3300011119 Ga0105246_10301064 Ga0105246_103010642 127
184 3300013100 Ga0157373_10132806 Ga0157373_101328062 127
185 3300013102 Ga0157371_10878970 Ga0157371_108789701 127
186 3300013105 Ga0157369_10002503 Ga0157369_100025035 127
187 3300013105 Ga0157369_10010466 Ga0157369_100104668 127
188 3300013105 Ga0157369_10305795 Ga0157369_103057952 127
189 3300013105 Ga0157369_12348851 Ga0157369_123488511 127
190 3300013296 Ga0157374_10020337 Ga0157374_100203372 127
191 3300013296 Ga0157374_10097628 Ga0157374_100976283 127
192 3300013296 Ga0157374_10191172 Ga0157374_101911722 127
193 3300013297 Ga0157378_10487323 Ga0157378_104873232 127
194 3300013307 Ga0157372_10002569 Ga0157372_100025692 127
195 3300013307 Ga0157372_10981538 Ga0157372_109815382 127
196 3300013307 Ga0157372_11351632 Ga0157372_113516321 127
197 3300013308 Ga0157375_10007806 Ga0157375_100078061 127
198 3300013308 Ga0157375_10760255 Ga0157375_107602551 127
199 3300014325 Ga0163163_10025387 Ga0163163_100253872 127
200 3300014497 Ga0182008_10742432 Ga0182008_107424321 127
201 3300014968 Ga0157379_10034197 Ga0157379_100341974 127
202 3300014969 Ga0157376_10118502 Ga0157376_101185022 127
203 3300017792 Ga0163161_11133065 Ga0163161_111330651 127
204 3300025321 Ga0207656_10038506 Ga0207656_100385063 127
205 3300025900 Ga0207710_10001093 Ga0207710_100010938 127
206 3300025911 Ga0207654_10000206 Ga0207654_1000020629 127
207 3300025911 Ga0207654_10000995 Ga0207654_100009951 127
208 3300025913 Ga0207695_10000752 Ga0207695_100007529 127
209 3300025913 Ga0207695_10021524 Ga0207695_100215246 127
210 3300025913 Ga0207695_10322295 Ga0207695_103222951 127
211 3300025914 Ga0207671_10000376 Ga0207671_1000037622 127
212 3300025914 Ga0207671_10000898 Ga0207671_1000089831 127
213 3300025914 Ga0207671_11028295 Ga0207671_110282951 127
214 3300025924 Ga0207694_10000167 Ga0207694_1000016732 127
215 3300025924 Ga0207694_10000497 Ga0207694_100004972 127
216 3300025925 Ga0207650_10012281 Ga0207650_100122812 127
217 3300025926 Ga0207659_10546340 Ga0207659_105463402 127
218 3300025927 Ga0207687_10003787 Ga0207687_100037872 127
219 3300025927 Ga0207687_10863203 Ga0207687_108632032 127
220 3300025941 Ga0207711_10025902 Ga0207711_100259024 127
221 3300025942 Ga0207689_10001915 Ga0207689_100019152 127
222 3300025944 Ga0207661_10003807 Ga0207661_100038079 127
223 3300025944 Ga0207661_11861970 Ga0207661_118619702 127
224 3300025949 Ga0207667_10050651 Ga0207667_100506516 127
225 3300025972 Ga0207668_10143915 Ga0207668_101439152 127
226 3300025986 Ga0207658_10001070 Ga0207658_1000107012 127
227 3300026023 Ga0207677_10000052 Ga0207677_1000005268 127
228 3300026035 Ga0207703_10052519 Ga0207703_100525192 127
229 3300026041 Ga0207639_10000107 Ga0207639_1000010729 127
230 3300026041 Ga0207639_10673374 Ga0207639_106733742 127
231 3300026078 Ga0207702_10003582 Ga0207702_100035829 127
232 3300026078 Ga0207702_11095958 Ga0207702_110959581 127
233 3300026088 Ga0207641_10000694 Ga0207641_1000069420 127
234 3300026089 Ga0207648_11538695 Ga0207648_115386951 127
235 3300026095 Ga0207676_10028307 Ga0207676_100283073 127
236 3300026116 Ga0207674_10000701 Ga0207674_1000070143 127
237 3300026116 Ga0207674_10765125 Ga0207674_107651252 127
238 3300028379 Ga0268266_11251694 Ga0268266_112516941 127
239 3300028380 Ga0268265_10709938 Ga0268265_107099382 127
240 3300028381 Ga0268264_10000953 Ga0268264_1000095328 127
241 3300037853 Ga0436364_1554103 Ga0436364_1554103_311_700 127
242 3300044683 Ga0466965_0325113 Ga0466965_0325113_259_642 127
243 3300045976 Ga0466967_0254202 Ga0466967_0254202_150_533 127
244 3300048909 Ga0496106_1559026 Ga0496106_1559026_63_446 127
245 3300048912 Ga0496109_1381077 Ga0496109_1381077_46_429 127
246 3300048912 Ga0496109_1620124 Ga0496109_1620124_153_536 127
247 3300048916 Ga0496113_0910021 Ga0496113_0910021_51_434 127
248 3300001979 JGI24740J21852_10060954 JGI24740J21852_100609541 128
249 3300005327 Ga0070658_10180991 Ga0070658_101809912 128
250 3300005329 Ga0070683_100117877 Ga0070683_1001178773 128
251 3300005329 Ga0070683_100164908 Ga0070683_1001649083 128
252 3300005337 Ga0070682_100042676 Ga0070682_1000426762 128
253 3300005338 Ga0068868_100435314 Ga0068868_1004353142 128
254 3300005344 Ga0070661_100288225 Ga0070661_1002882252 128
255 3300005436 Ga0070713_100003445 Ga0070713_1000034456 128
256 3300005439 Ga0070711_100346530 Ga0070711_1003465302 128
257 3300005539 Ga0068853_100572639 Ga0068853_1005726392 128
258 3300005548 Ga0070665_100062502 Ga0070665_1000625023 128
259 3300005563 Ga0068855_100001109 Ga0068855_1000011094 128
260 3300005564 Ga0070664_101415766 Ga0070664_1014157662 128
261 3300005564 Ga0070664_101774065 Ga0070664_1017740652 128
262 3300005564 Ga0070664_102307834 Ga0070664_1023078341 128
263 3300005577 Ga0068857_100043730 Ga0068857_1000437306 128
264 3300005578 Ga0068854_100018561 Ga0068854_1000185616 128
265 3300005614 Ga0068856_100404940 Ga0068856_1004049401 128
266 3300005614 Ga0068856_100691908 Ga0068856_1006919082 128
267 3300005614 Ga0068856_100949434 Ga0068856_1009494341 128
268 3300005616 Ga0068852_100000287 Ga0068852_10000028728 128
269 3300005616 Ga0068852_100787580 Ga0068852_1007875801 128
270 3300005617 Ga0068859_101632620 Ga0068859_1016326202 128
271 3300006163 Ga0070715_10315641 Ga0070715_103156411 128
272 3300006175 Ga0070712_100319744 Ga0070712_1003197442 128
273 3300006358 Ga0068871_100051957 Ga0068871_1000519573 128
274 3300006931 Ga0097620_101632248 Ga0097620_1016322482 128
275 3300009093 Ga0105240_10001982 Ga0105240_100019824 128
276 3300009093 Ga0105240_10002781 Ga0105240_100027813 128
277 3300009093 Ga0105240_10550564 Ga0105240_105505643 128
278 3300009098 Ga0105245_10086315 Ga0105245_100863152 128
279 3300009174 Ga0105241_10035349 Ga0105241_100353494 128
280 3300009174 Ga0105241_10931743 Ga0105241_109317431 128
281 3300009174 Ga0105241_10976518 Ga0105241_109765182 128
282 3300009174 Ga0105241_11532345 Ga0105241_115323451 128
283 3300009177 Ga0105248_10000596 Ga0105248_1000059613 128
284 3300009545 Ga0105237_10117568 Ga0105237_101175682 128
285 3300009545 Ga0105237_10657035 Ga0105237_106570353 128
286 3300009551 Ga0105238_10000307 Ga0105238_1000030733 128
287 3300009551 Ga0105238_10260994 Ga0105238_102609942 128
288 3300010375 Ga0105239_10007632 Ga0105239_1000763213 128
289 3300010375 Ga0105239_10218110 Ga0105239_102181103 128
290 3300013100 Ga0157373_10130551 Ga0157373_101305513 128
291 3300013104 Ga0157370_10001105 Ga0157370_100011054 128
292 3300013104 Ga0157370_10759565 Ga0157370_107595652 128
293 3300013105 Ga0157369_10001102 Ga0157369_100011024 128
294 3300013105 Ga0157369_10048883 Ga0157369_100488834 128
295 3300013105 Ga0157369_10191645 Ga0157369_101916453 128
296 3300013105 Ga0157369_11224283 Ga0157369_112242831 128
297 3300013296 Ga0157374_10013755 Ga0157374_100137556 128
298 3300013296 Ga0157374_10118775 Ga0157374_101187751 128
299 3300013296 Ga0157374_10685156 Ga0157374_106851562 128
300 3300013296 Ga0157374_10994361 Ga0157374_109943612 128
301 3300013297 Ga0157378_10020019 Ga0157378_100200194 128
302 3300013297 Ga0157378_10171682 Ga0157378_101716821 128
303 3300013306 Ga0163162_10129884 Ga0163162_101298843 128
304 3300013307 Ga0157372_10000816 Ga0157372_100008164 128
305 3300013307 Ga0157372_10059260 Ga0157372_100592602 128
306 3300013307 Ga0157372_12074801 Ga0157372_120748011 128
307 3300013307 Ga0157372_12615014 Ga0157372_126150142 128
308 3300013308 Ga0157375_10009362 Ga0157375_100093625 128
309 3300014969 Ga0157376_10123411 Ga0157376_101234112 128
310 3300014969 Ga0157376_11506499 Ga0157376_115064992 128
311 3300014969 Ga0157376_12145065 Ga0157376_121450652 128
312 3300025321 Ga0207656_10021534 Ga0207656_100215341 128
313 3300025321 Ga0207656_10608897 Ga0207656_106088971 128
314 3300025905 Ga0207685_10440735 Ga0207685_104407351 128
315 3300025906 Ga0207699_10104377 Ga0207699_101043772 128
316 3300025911 Ga0207654_10005401 Ga0207654_100054014 128
317 3300025913 Ga0207695_10000030 Ga0207695_10000030370 128
318 3300025913 Ga0207695_10001801 Ga0207695_1000180127 128
319 3300025913 Ga0207695_10228917 Ga0207695_102289172 128
320 3300025916 Ga0207663_10206457 Ga0207663_102064572 128
321 3300025920 Ga0207649_10248039 Ga0207649_102480392 128
322 3300025920 Ga0207649_10918788 Ga0207649_109187881 128
323 3300025920 Ga0207649_11158972 Ga0207649_111589721 128
324 3300025924 Ga0207694_10000697 Ga0207694_1000069718 128
325 3300025924 Ga0207694_10083130 Ga0207694_100831302 128
326 3300025927 Ga0207687_10012717 Ga0207687_100127175 128
327 3300025928 Ga0207700_10006810 Ga0207700_100068105 128
328 3300025941 Ga0207711_10001551 Ga0207711_100015518 128
329 3300025944 Ga0207661_10058133 Ga0207661_100581333 128
330 3300025944 Ga0207661_10194028 Ga0207661_101940282 128
331 3300025981 Ga0207640_10073567 Ga0207640_100735673 128
332 3300026023 Ga0207677_10374386 Ga0207677_103743861 128
333 3300026078 Ga0207702_10291293 Ga0207702_102912932 128
334 3300026078 Ga0207702_10759269 Ga0207702_107592692 128
335 3300026116 Ga0207674_10002663 Ga0207674_100026636 128
336 3300026142 Ga0207698_10000239 Ga0207698_1000023927 128
337 3300026142 Ga0207698_10143991 Ga0207698_101439912 128
338 3300028379 Ga0268266_10017115 Ga0268266_100171153 128
339 3300028800 Ga0265338_10470001 Ga0265338_104700012 128
340 3300031344 Ga0265316_10376881 Ga0265316_103768811 128
341 3300031595 Ga0265313_10217201 Ga0265313_102172011 128
342 3300036401 Ga0373937_0231091 Ga0373937_0231091_714_1124 128
343 3300037853 Ga0436364_0766720 Ga0436364_0766720_202_594 128
344 3300044694 Ga0466963_0009554 Ga0466963_0009554_3149_3544 128
345 3300044842 Ga0466957_0618553 Ga0466957_0618553_168_563 128
346 3300045976 Ga0466967_0001802 Ga0466967_0001802_11730_12125 128
347 3300046459 Ga0495629_0709464 Ga0495629_0709464_147_557 128
348 3300046472 Ga0495580_0039886 Ga0495580_0039886_2764_3174 128
349 3300046679 Ga0495623_0088265 Ga0495623_0088265_353_760 128
350 3300046689 Ga0495613_0487482 Ga0495613_0487482_248_658 128
351 3300047317 Ga0495604_0162501 Ga0495604_0162501_105_575 128
352 3300048088 Ga0495602_0095008 Ga0495602_0095008_822_1229 128
353 3300048904 Ga0496101_0748323 Ga0496101_0748323_349_753 128
354 3300048907 Ga0496104_0050627 Ga0496104_0050627_704_1108 128
355 3300048908 Ga0496105_0210702 Ga0496105_0210702_329_733 128
356 3300048908 Ga0496105_1246318 Ga0496105_1246318_122_529 128
357 3300048917 Ga0496114_0092512 Ga0496114_0092512_1419_1823 128
358 3300048918 Ga0496115_0079697 Ga0496115_0079697_191_595 128
359 3300048918 Ga0496115_0253521 Ga0496115_0253521_780_1187 128

Structural Annotation

Top 5 Hits

ID Description Score Start End
7agh-assembly2.cif.gz_A crystal structure of sf kinase yihv from e. coli in complex with amppnp-mg 0.7924 83 113
1t1j-assembly2.cif.gz_B crystal structure of genomics apc5043 0.7737 5 114
4jen-assembly1.cif.gz_A structure of clostridium botulinum cmp n-glycosidase, bcmb 0.7569 8 113
3imk-assembly1.cif.gz_A crystal structure of putative molybdenum carrier protein (yp_461806.1) from syntrophus aciditrophicus sb at 1.45 a resolution 0.7419 76 120
6evs-assembly1.cif.gz_A characterization of 2-deoxyribosyltransferase from psychrotolerant bacterium bacillus psychrosaccharolyticus: a suitable biocatalyst for the industrial synthesis of antiviral and antitumoral nucleosides 0.7074 8 113
ID Description Score Start End Superfamily
1t1jA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Hypothetical protein PA1492 0.7661 5 114 3.40.50.10400
af_Q8IJ83_29_215_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7547 76 113 3.40.50.2000
af_Q9Y7P9_15_204_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7265 6 113 3.40.50.450
af_P9WP89_3_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.706 76 114 3.40.50.720
1t1jA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Hypothetical protein PA1492 0.7034 5 114 3.40.50.10400
ID Description Score Start End GO Terms
AF-A0A6P2K7E7-F1-model_v4 NUDIX hydrolase 1.003 5 61 GO:0016787
AF-A0A0N1JTD1-F1-model_v4 NUDIX hydrolase 0.9975 5 123
AF-A0A7Z8K2V3-F1-model_v4 DUF4406 domain-containing protein 0.9882 5 123
AF-A0A6I5N481-F1-model_v4 deleted 0.9827 4 122
AF-A0A4Q7NPH9-F1-model_v4 Phosphoglycerate kinase 0.981 5 124

Feature Viewer

pLDDT pTM Quality
91.65 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map