F421094

General Info

Members Datasets Scaffolds Average Seq Length
358 226 356 115

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100774146|Ga0070663_1007741462
Length 129
Sequence MRYIMLIRHDEPAMAKLTAADWQQIAADYGAFTAAISKADFAYRSGSRLEPSQKTRTVRVRDGQREVLDGPYADTKEQLAGYFMIDVADLDEAIAWARRCPSSRYGSIEIRPLAPTYPRPDSRLRDQEP

Samples

Sample ID Description Type Environment
1 2643221629 Devosia sp. Root105 Isolate Unclassified
2 2643221662 Devosia sp. Root413D1 Isolate Unclassified
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
162 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0.56
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.75
Nodule 0
Rhizoplane 1.68
Rhizosphere 91.06
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10151159 3300001979 Bacteria 577
2 rootH2_10211286 3300003320 Bacteria 1067
3 rootH1_10018043 3300003323 Bacteria 1043
4 Ga0070658_10017966 3300005327 Bacteria 5657
5 Ga0070658_10208534 3300005327 Bacteria 1650
6 Ga0070658_10290985 3300005327 Bacteria 1392
7 Ga0070658_10424810 3300005327 Bacteria 1143
8 Ga0070676_10231174 3300005328 Bacteria 1226
9 Ga0070683_100032265 3300005329 Bacteria 4770
10 Ga0070670_100701418 3300005331 Bacteria 910
11 Ga0070666_10912017 3300005335 Bacteria 650
12 Ga0070682_101970735 3300005337 Bacteria 513
13 Ga0068868_100649619 3300005338 Bacteria 939
14 Ga0068868_100827765 3300005338 Bacteria 837
15 Ga0070660_100007312 3300005339 Bacteria 7696
16 Ga0070660_100220435 3300005339 Bacteria 1542
17 Ga0070660_100842228 3300005339 Bacteria 772
18 Ga0070689_100105192 3300005340 Bacteria 2238
19 Ga0070687_100099056 3300005343 Unclassified 1628
20 Ga0070661_100001171 3300005344 Bacteria 18507
21 Ga0070661_100040411 3300005344 Bacteria 3403
22 Ga0070661_100279960 3300005344 Bacteria 1294
23 Ga0070668_100064159 3300005347 Bacteria 2847
24 Ga0070671_100251921 3300005355 Bacteria 1500
25 Ga0070674_100025319 3300005356 Bacteria 3861
26 Ga0070674_100416053 3300005356 Bacteria 1102
27 Ga0070673_100160146 3300005364 Unclassified 1913
28 Ga0070673_100393585 3300005364 Bacteria 1238
29 Ga0070659_100021258 3300005366 Bacteria 4938
30 Ga0070659_100122715 3300005366 Bacteria 2106
31 Ga0070659_100492390 3300005366 Bacteria 1044
32 Ga0070667_100065267 3300005367 Unclassified 3091
33 Ga0070667_100818263 3300005367 Bacteria 865
34 Ga0070710_11304449 3300005437 Bacteria 540
35 Ga0070663_100774146 3300005455 Bacteria 821
36 Ga0070663_102053167 3300005455 Bacteria 515
37 Ga0070678_100104509 3300005456 Bacteria 2203
38 Ga0070678_100412593 3300005456 Bacteria 1175
39 Ga0070678_100816102 3300005456 Bacteria 848
40 Ga0070698_101056461 3300005471 Bacteria 760
41 Ga0068853_100008693 3300005539 Bacteria 8167
42 Ga0068853_100109069 3300005539 Bacteria 2457
43 Ga0068853_100575906 3300005539 Bacteria 1068
44 Ga0068853_102451258 3300005539 Bacteria 505
45 Ga0070672_100066668 3300005543 Bacteria 2851
46 Ga0070686_100165811 3300005544 Bacteria 1559
47 Ga0070695_100795203 3300005545 Bacteria 757
48 Ga0070665_100053022 3300005548 Bacteria 4067
49 Ga0070665_100066211 3300005548 Bacteria 3624
50 Ga0070665_100070252 3300005548 Bacteria 3508
51 Ga0070665_100084500 3300005548 Bacteria 3179
52 Ga0070665_100620368 3300005548 Bacteria 1094
53 Ga0070665_100905486 3300005548 Bacteria 895
54 Ga0068855_100179104 3300005563 Bacteria 2397
55 Ga0068855_102199069 3300005563 Bacteria 554
56 Ga0070664_100081951 3300005564 Bacteria 2781
57 Ga0070664_100317474 3300005564 Bacteria 1411
58 Ga0070664_101769756 3300005564 Bacteria 586
59 Ga0068857_100013088 3300005577 Bacteria 7229
60 Ga0068857_101136988 3300005577 Bacteria 755
61 Ga0068854_100014944 3300005578 Bacteria 5127
62 Ga0068854_100624682 3300005578 Bacteria 922
63 Ga0068856_100087925 3300005614 Bacteria 3090
64 Ga0068856_100313468 3300005614 Bacteria 1586
65 Ga0070702_100179676 3300005615 Bacteria 1383
66 Ga0068852_100063912 3300005616 Bacteria 3206
67 Ga0068852_101618736 3300005616 Bacteria 670
68 Ga0068859_100141835 3300005617 Bacteria 2476
69 Ga0068864_100123330 3300005618 Bacteria 2319
70 Ga0068864_100361575 3300005618 Bacteria 1372
71 Ga0068851_10125008 3300005834 Bacteria 1386
72 Ga0068851_10356654 3300005834 Bacteria 852
73 Ga0068870_10201225 3300005840 Bacteria 1208
74 Ga0068870_10260907 3300005840 Bacteria 1078
75 Ga0068862_100247379 3300005844 Bacteria 1624
76 Ga0075365_10502905 3300006038 Bacteria 856
77 Ga0075364_10041553 3300006051 Bacteria 2986
78 Ga0075366_10056175 3300006195 Bacteria 2338
79 Ga0075370_10032862 3300006353 Bacteria 2903
80 Ga0075370_10229775 3300006353 Bacteria 1098
81 Ga0075370_10843945 3300006353 Bacteria 559
82 Ga0068871_101691911 3300006358 Bacteria 600
83 Ga0075428_101255586 3300006844 Bacteria 780
84 Ga0068865_100677761 3300006881 Bacteria 879
85 Ga0075436_100014014 3300006914 Bacteria 5486
86 Ga0097620_100141826 3300006931 Bacteria 2476
87 Ga0105240_10088273 3300009093 Bacteria 3795
88 Ga0105240_12406675 3300009093 Bacteria 545
89 Ga0111539_10829780 3300009094 Bacteria 1076
90 Ga0114129_10941585 3300009147 Bacteria 1092
91 Ga0105243_10487656 3300009148 Bacteria 1165
92 Ga0105243_10667210 3300009148 Viruses 1010
93 Ga0105243_10713365 3300009148 Bacteria 979
94 Ga0105243_12044955 3300009148 Bacteria 608
95 Ga0105241_10045372 3300009174 Bacteria 3334
96 Ga0105241_10341797 3300009174 Bacteria 1297
97 Ga0105241_11189900 3300009174 Unclassified 721
98 Ga0105242_10068781 3300009176 Bacteria 2931
99 Ga0105248_10640171 3300009177 Unclassified 1200
100 Ga0105237_10001389 3300009545 Bacteria 31975
101 Ga0105237_10835048 3300009545 Bacteria 928
102 Ga0105237_11115583 3300009545 Bacteria 796
103 Ga0105238_10081739 3300009551 Bacteria 3220
104 Ga0105238_10097291 3300009551 Bacteria 2929
105 Ga0105249_10338917 3300009553 Unclassified 1520
106 Ga0105239_10001103 3300010375 Bacteria 37309
107 Ga0105239_10019837 3300010375 Bacteria 7419
108 Ga0105239_10334373 3300010375 Bacteria 1709
109 Ga0105239_10397895 3300010375 Bacteria 1559
110 Ga0105239_11032274 3300010375 Bacteria 946
111 Ga0105239_11734454 3300010375 Bacteria 723
112 Ga0105246_10350667 3300011119 Bacteria 1209
113 Ga0157373_10061977 3300013100 Bacteria 2649
114 Ga0157371_10198470 3300013102 Bacteria 1438
115 Ga0157370_10089151 3300013104 Bacteria 2897
116 Ga0157370_10160833 3300013104 Bacteria 2089
117 Ga0157370_10443559 3300013104 Bacteria 1193
118 Ga0157369_10340458 3300013105 Bacteria 1558
119 Ga0157374_10231979 3300013296 Bacteria 1813
120 Ga0157374_10671896 3300013296 Bacteria 1048
121 Ga0157374_11423591 3300013296 Bacteria 716
122 Ga0157374_12723979 3300013296 Bacteria 522
123 Ga0157378_11403373 3300013297 Bacteria 741
124 Ga0163162_10153583 3300013306 Bacteria 2421
125 Ga0163162_11466322 3300013306 Bacteria 777
126 Ga0163162_11843934 3300013306 Bacteria 692
127 Ga0157372_10098319 3300013307 Bacteria 3339
128 Ga0157372_10675615 3300013307 Bacteria 1202
129 Ga0157372_12818488 3300013307 Unclassified 557
130 Ga0157375_10167561 3300013308 Bacteria 2342
131 Ga0157375_11301338 3300013308 Bacteria 855
132 Ga0157375_11445627 3300013308 Bacteria 811
133 Ga0163163_10177877 3300014325 Bacteria 2174
134 Ga0163163_10257619 3300014325 Bacteria 1795
135 Ga0182008_10042439 3300014497 Bacteria 2266
136 Ga0157379_12658184 3300014968 Bacteria 502
137 Ga0157376_10379839 3300014969 Bacteria 1361
138 Ga0157376_10461053 3300014969 Bacteria 1242
139 Ga0157376_11268169 3300014969 Bacteria 766
140 Ga0206353_12038968 3300020082 Bacteria 713
141 Ga0209051_1052662 3300025303 Bacteria 1343
142 Ga0207656_10587386 3300025321 Unclassified 568
143 Ga0207682_10411735 3300025893 Viruses 639
144 Ga0207680_10369864 3300025903 Bacteria 1009
145 Ga0207680_11256553 3300025903 Bacteria 527
146 Ga0207647_10043997 3300025904 Bacteria 2792
147 Ga0207645_10013644 3300025907 Bacteria 5467
148 Ga0207643_10073505 3300025908 Bacteria 1971
149 Ga0207643_10232113 3300025908 Bacteria 1132
150 Ga0207705_10011790 3300025909 Bacteria 6318
151 Ga0207705_10170225 3300025909 Bacteria 1640
152 Ga0207705_10201429 3300025909 Bacteria 1508
153 Ga0207705_10308102 3300025909 Unclassified 1215
154 Ga0207684_10096875 3300025910 Bacteria 2518
155 Ga0207654_10183103 3300025911 Bacteria 1368
156 Ga0207695_10253171 3300025913 Bacteria 1660
157 Ga0207671_10001115 3300025914 Bacteria 32386
158 Ga0207671_11182298 3300025914 Bacteria 599
159 Ga0207662_10074672 3300025918 Bacteria 2058
160 Ga0207657_10024039 3300025919 Bacteria 5657
161 Ga0207657_10237067 3300025919 Bacteria 1457
162 Ga0207657_10660155 3300025919 Bacteria 814
163 Ga0207649_10040864 3300025920 Bacteria 2822
164 Ga0207681_11362212 3300025923 Bacteria 596
165 Ga0207694_10049295 3300025924 Bacteria 3260
166 Ga0207694_10107809 3300025924 Bacteria 2213
167 Ga0207694_10958463 3300025924 Bacteria 724
168 Ga0207650_10198145 3300025925 Bacteria 1607
169 Ga0207659_10152540 3300025926 Bacteria 1805
170 Ga0207659_11392567 3300025926 Unclassified 601
171 Ga0207687_10206956 3300025927 Unclassified 1537
172 Ga0207644_10120513 3300025931 Bacteria 1997
173 Ga0207690_10024015 3300025932 Bacteria 3813
174 Ga0207690_10172367 3300025932 Bacteria 1622
175 Ga0207706_10997002 3300025933 Bacteria 704
176 Ga0207686_10237951 3300025934 Bacteria 1323
177 Ga0207686_10594395 3300025934 Bacteria 870
178 Ga0207709_11451165 3300025935 Bacteria 569
179 Ga0207670_10777528 3300025936 Bacteria 797
180 Ga0207669_10215333 3300025937 Bacteria 1405
181 Ga0207669_10758119 3300025937 Bacteria 802
182 Ga0207704_10124505 3300025938 Unclassified 1771
183 Ga0207691_10178157 3300025940 Bacteria 1858
184 Ga0207689_10349150 3300025942 Bacteria 1230
185 Ga0207689_10774124 3300025942 Bacteria 810
186 Ga0207661_10067405 3300025944 Bacteria 2911
187 Ga0207661_11176811 3300025944 Bacteria 706
188 Ga0207679_10990793 3300025945 Bacteria 770
189 Ga0207667_10002226 3300025949 Bacteria 24349
190 Ga0207667_10496652 3300025949 Bacteria 1238
191 Ga0207651_10151634 3300025960 Bacteria 1805
192 Ga0207651_10935239 3300025960 Unclassified 773
193 Ga0207668_10225473 3300025972 Bacteria 1508
194 Ga0207640_10174263 3300025981 Bacteria 1606
195 Ga0207658_10082423 3300025986 Bacteria 2470
196 Ga0207658_11938060 3300025986 Bacteria 537
197 Ga0207677_10148377 3300026023 Bacteria 1805
198 Ga0207677_10165387 3300026023 Bacteria 1724
199 Ga0207677_10784870 3300026023 Bacteria 852
200 Ga0207703_12338236 3300026035 Bacteria 510
201 Ga0207639_10003202 3300026041 Bacteria 11005
202 Ga0207639_10029002 3300026041 Bacteria 4047
203 Ga0207639_10051195 3300026041 Bacteria 3140
204 Ga0207639_10473186 3300026041 Bacteria 1141
205 Ga0207639_11250570 3300026041 Bacteria 697
206 Ga0207678_10550929 3300026067 Bacteria 1008
207 Ga0207678_10590946 3300026067 Bacteria 973
208 Ga0207678_11329805 3300026067 Bacteria 636
209 Ga0207708_10142985 3300026075 Bacteria 1878
210 Ga0207702_10062982 3300026078 Bacteria 3170
211 Ga0207702_10149868 3300026078 Bacteria 2120
212 Ga0207648_10098465 3300026089 Bacteria 2560
213 Ga0207676_10275661 3300026095 Bacteria 1525
214 Ga0207676_12315059 3300026095 Bacteria 535
215 Ga0207674_10008220 3300026116 Bacteria 12093
216 Ga0207674_11851154 3300026116 Bacteria 570
217 Ga0207675_100499333 3300026118 Bacteria 1211
218 Ga0207683_10050643 3300026121 Bacteria 3638
219 Ga0207683_10212613 3300026121 Bacteria 1760
220 Ga0207683_10746825 3300026121 Unclassified 908
221 Ga0207698_10029608 3300026142 Bacteria 3924
222 Ga0207698_11268927 3300026142 Bacteria 751
223 Ga0207698_12310507 3300026142 Bacteria 550
224 Ga0268266_10000974 3300028379 Bacteria 36355
225 Ga0268266_10036928 3300028379 Bacteria 4163
226 Ga0268266_10101877 3300028379 Bacteria 2532
227 Ga0268266_10204386 3300028379 Bacteria 1809
228 Ga0268266_10256421 3300028379 Bacteria 1619
229 Ga0268266_11422046 3300028379 Bacteria 669
230 Ga0268266_11890722 3300028379 Bacteria 571
231 Ga0268265_10017076 3300028380 Bacteria 5001
232 Ga0268264_11790136 3300028381 Unclassified 624
233 Ga0265318_10053093 3300028577 Bacteria 1520
234 Ga0307515_10363919 3300028794 Bacteria 1086
235 Ga0265332_10036940 3300031238 Bacteria 2120
236 Ga0265320_10066773 3300031240 Bacteria 1704
237 Ga0265327_10031459 3300031251 Bacteria 2981
238 Ga0307408_100876292 3300031548 Bacteria 820
239 Ga0265314_10069448 3300031711 Bacteria 2364
240 Ga0307410_11297384 3300031852 Bacteria 637
241 Ga0307412_10830132 3300031911 Bacteria 805
242 Ga0307416_103030709 3300032002 Bacteria 562
243 Ga0307415_100114117 3300032126 Bacteria 2011
244 Ga0307415_101168832 3300032126 Bacteria 724
245 Ga0373926_0067641 3300035083 Bacteria 1309
246 Ga0373928_0040337 3300035084 Bacteria 1070
247 Ga0373932_0011133 3300035112 Bacteria 2191
248 Ga0373954_0236421 3300035118 Bacteria 899
249 Ga0373957_0478082 3300035120 Bacteria 541
250 Ga0373961_0199642 3300035241 Bacteria 705
251 Ga0373924_0450194 3300035410 Bacteria 577
252 Ga0373931_0083726 3300035691 Bacteria 1765
253 Ga0373937_0961661 3300036401 Bacteria 803
254 Ga0373937_1007430 3300036401 Bacteria 782
255 Ga0373937_1775550 3300036401 Bacteria 563
256 Ga0373925_0174497 3300037068 Bacteria 1698
257 Ga0395900_1723682 3300037418 Bacteria 537
258 Ga0395905_1003987 3300037471 Bacteria 738
259 Ga0439466_0207747 3300041411 Bacteria 595
260 Ga0439465_0026621 3300041413 Bacteria 1830
261 Ga0439465_0091764 3300041413 Bacteria 1040
262 Ga0439465_0093977 3300041413 Bacteria 1029
263 Ga0451802_1130695 3300041460 Bacteria 515
264 Ga0451843_1271755 3300041509 Bacteria 671
265 Ga0451853_1738569 3300041512 Bacteria 649
266 Ga0439441_058737 3300042001 Bacteria 806
267 Ga0439445_0054253 3300042004 Bacteria 1087
268 Ga0439432_136372 3300042006 Bacteria 723
269 Ga0439452_088347 3300042010 Bacteria 671
270 Ga0439434_0076229 3300042435 Bacteria 1060
271 Ga0439460_0159433 3300042461 Bacteria 756
272 Ga0466965_0730518 3300044683 Bacteria 570
273 Ga0466963_0030800 3300044694 Bacteria 3464
274 Ga0466963_0170352 3300044694 Bacteria 1518
275 Ga0466957_0283843 3300044842 Bacteria 1109
276 Ga0451576_0961039 3300045051 Bacteria 896
277 Ga0466967_0580894 3300045976 Bacteria 1105
278 Ga0495592_0081552 3300046454 Bacteria 2338
279 Ga0495664_0138468 3300046477 Bacteria 1475
280 Ga0495618_0495113 3300046514 Bacteria 737
281 Ga0495628_0029416 3300046516 Bacteria 4454
282 Ga0495630_0781234 3300046517 Bacteria 729
283 Ga0495658_0228977 3300046683 Bacteria 1165
284 Ga0495658_0867553 3300046683 Bacteria 577
285 Ga0495613_0897169 3300046689 Bacteria 574
286 Ga0495684_0740347 3300047471 Unclassified 648
287 Ga0495686_0108391 3300047472 Bacteria 1668
288 Ga0495602_0271974 3300048088 Bacteria 1252
289 Ga0496104_0325565 3300048907 Bacteria 1450
290 Ga0496106_0619885 3300048909 Bacteria 866
291 Ga0496107_0870230 3300048910 Bacteria 658
292 Ga0496108_0603721 3300048911 Bacteria 956
293 Ga0496114_0321185 3300048917 Bacteria 1368
294 Ga0496117_0224174 3300048920 Bacteria 1044
295 Ga0496118_0352202 3300048921 Bacteria 784
296 Ga0501032_0755124 3300049569 Bacteria 615
297 Ga0501033_0152014 3300049570 Bacteria 1670
298 Ga0501033_0915507 3300049570 Bacteria 589
299 Ga0501034_0019924 3300049571 Bacteria 6850
300 Ga0501034_0213694 3300049571 Bacteria 1883
301 Ga0501034_0253622 3300049571 Bacteria 1703
302 Ga0501034_0282541 3300049571 Bacteria 1599
303 Ga0501034_0286397 3300049571 Bacteria 1586
304 Ga0501034_0473338 3300049571 Bacteria 1168
305 Ga0501034_0567326 3300049571 Bacteria 1043
306 Ga0501034_0763280 3300049571 Bacteria 862
307 Ga0501034_0882938 3300049571 Bacteria 783
308 Ga0501036_0082623 3300049572 Bacteria 2715
309 Ga0501036_1729049 3300049572 Bacteria 504
310 Ga0501038_0003431 3300049574 Bacteria 14779
311 Ga0501040_0001519 3300049576 Bacteria 14730
312 Ga0501040_0191551 3300049576 Bacteria 1451
313 Ga0501041_0070713 3300049577 Bacteria 2142
314 Ga0501042_0048480 3300049578 Bacteria 3029
315 Ga0501046_0102607 3300049580 Bacteria 2193
316 Ga0501048_1407734 3300049582 Bacteria 501
317 Ga0501068_0059372 3300049584 Bacteria 2322
318 Ga0501071_0026029 3300049587 Bacteria 4103
319 Ga0501072_0100064 3300049588 Bacteria 2304
320 Ga0501073_0079714 3300049589 Bacteria 2279
321 Ga0501074_0127400 3300049590 Bacteria 1822
322 Ga0501074_0190061 3300049590 Bacteria 1464
323 Ga0501074_0480465 3300049590 Bacteria 881
324 Ga0501075_0000003 3300049591 Bacteria 173182
325 Ga0501076_0000010 3300049592 Bacteria 116774
326 Ga0501077_0741842 3300049593 Bacteria 631
327 Ga0501079_0001991 3300049741 Bacteria 14633
328 Ga0501080_0007410 3300049742 Bacteria 9901
329 Ga0501081_0003752 3300049743 Bacteria 9728
330 Ga0501081_0811905 3300049743 Bacteria 704
331 Ga0501083_0380259 3300049744 Bacteria 918
332 Ga0501035_0101518 3300049822 Bacteria 2524
333 Ga0501035_0370849 3300049822 Bacteria 1195
334 Ga0501044_0356329 3300049823 Bacteria 1382
335 Ga0501044_0533170 3300049823 Bacteria 1073
336 nmdc:mga03683_257706_c1 3300050489 Bacteria 811
337 nmdc:mga03n38_5289_c1 3300050490 Bacteria 4379
338 nmdc:mga00v17_457519_c1 3300050491 Bacteria 828
339 nmdc:mga0yw44_401805_c1 3300050492 Bacteria 926
340 nmdc:mga06z11_34440_c1 3300050494 Bacteria 2486
341 nmdc:mga0rr50_534363_c1 3300050513 Unclassified 998
342 nmdc:mga0rr50_839560_c1 3300050513 Bacteria 784
343 nmdc:mga08x19_1602_c1 3300050514 Bacteria 14032
344 Ga0495601_0472732 3300053077 Bacteria 810
345 Ga0500562_038177 3300053108 Bacteria 1276
346 Ga0500559_0278552 3300053136 Bacteria 787
347 Ga0500568_0232219 3300053139 Bacteria 673
348 Ga0500616_0054500 3300053153 Bacteria 2094
349 Ga0500616_0321540 3300053153 Bacteria 637
350 Ga0501084_0011624 3300054114 Bacteria 7287
351 Ga0501084_1434609 3300054114 Bacteria 578
352 Ga0587062_018321 3300059639 Bacteria 967
353 Ga0501082_0010736 3300060353 Bacteria 7883
354 Ga0501082_0416702 3300060353 Bacteria 1173
355 Ga0501082_1684937 3300060353 Bacteria 553
356 Ga0530510_0000008 3300061734 Bacteria 165671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_12044955 Ga0105243_120449552 99
2 3300041509 Ga0451843_1271755 Ga0451843_1271755_19_321 100
3 3300042461 Ga0439460_0159433 Ga0439460_0159433_435_746 102
4 3300006353 Ga0075370_10229775 Ga0075370_102297752 103
5 3300031852 Ga0307410_11297384 Ga0307410_112973842 103
6 3300041460 Ga0451802_1130695 Ga0451802_1130695_35_376 103
7 3300049571 Ga0501034_0213694 Ga0501034_0213694_1400_1741 103
8 3300049571 Ga0501034_0286397 Ga0501034_0286397_696_1037 103
9 3300049571 Ga0501034_0567326 Ga0501034_0567326_567_908 103
10 3300049582 Ga0501048_1407734 Ga0501048_1407734_28_369 103
11 3300050489 nmdc:mga03683_257706_c1 nmdc:mga03683_257706_c1_243_584 103
12 3300050490 nmdc:mga03n38_5289_c1 nmdc:mga03n38_5289_c1_3522_3863 103
13 3300032002 Ga0307416_103030709 Ga0307416_1030307092 104
14 3300049570 Ga0501033_0915507 Ga0501033_0915507_257_571 104
15 3300049571 Ga0501034_0882938 Ga0501034_0882938_13_327 104
16 3300025303 Ga0209051_1052662 Ga0209051_10526621 105
17 3300053139 Ga0500568_0232219 Ga0500568_0232219_185_526 106
18 3300005339 Ga0070660_100842228 Ga0070660_1008422282 107
19 3300005548 Ga0070665_100620368 Ga0070665_1006203682 107
20 3300006844 Ga0075428_101255586 Ga0075428_1012555862 107
21 3300009174 Ga0105241_10341797 Ga0105241_103417971 107
22 3300009545 Ga0105237_10001389 Ga0105237_1000138926 107
23 3300010375 Ga0105239_10001103 Ga0105239_1000110332 107
24 3300013296 Ga0157374_11423591 Ga0157374_114235912 107
25 3300014325 Ga0163163_10257619 Ga0163163_102576192 107
26 3300025914 Ga0207671_10001115 Ga0207671_1000111543 107
27 3300025919 Ga0207657_10660155 Ga0207657_106601551 107
28 3300025924 Ga0207694_10958463 Ga0207694_109584632 107
29 3300028379 Ga0268266_10000974 Ga0268266_1000097417 107
30 3300025986 Ga0207658_11938060 Ga0207658_119380601 108
31 3300047472 Ga0495686_0108391 Ga0495686_0108391_820_1161 108
32 3300009148 Ga0105243_10667210 Ga0105243_106672102 109
33 3300009176 Ga0105242_10068781 Ga0105242_100687812 109
34 3300009177 Ga0105248_10640171 Ga0105248_106401712 109
35 3300009553 Ga0105249_10338917 Ga0105249_103389171 109
36 3300013306 Ga0163162_10153583 Ga0163162_101535833 109
37 3300014969 Ga0157376_10379839 Ga0157376_103798392 109
38 3300025934 Ga0207686_10237951 Ga0207686_102379511 109
39 3300044694 Ga0466963_0170352 Ga0466963_0170352_380_712 109
40 3300045051 Ga0451576_0961039 Ga0451576_0961039_335_667 109
41 3300005471 Ga0070698_101056461 Ga0070698_1010564612 110
42 3300005545 Ga0070695_100795203 Ga0070695_1007952031 110
43 3300005840 Ga0068870_10201225 Ga0068870_102012252 110
44 3300005844 Ga0068862_100247379 Ga0068862_1002473793 110
45 3300028380 Ga0268265_10017076 Ga0268265_100170763 110
46 3300042004 Ga0439445_0054253 Ga0439445_0054253_552_884 110
47 3300049571 Ga0501034_0253622 Ga0501034_0253622_673_1005 110
48 3300050491 nmdc:mga00v17_457519_c1 nmdc:mga00v17_457519_c1_257_589 110
49 3300050492 nmdc:mga0yw44_401805_c1 nmdc:mga0yw44_401805_c1_143_475 110
50 3300050494 nmdc:mga06z11_34440_c1 nmdc:mga06z11_34440_c1_1021_1353 110
51 3300003320 rootH2_10211286 rootH2_102112862 111
52 3300005331 Ga0070670_100701418 Ga0070670_1007014182 111
53 3300005539 Ga0068853_102451258 Ga0068853_1024512581 111
54 3300005548 Ga0070665_100066211 Ga0070665_1000662112 111
55 3300009094 Ga0111539_10829780 Ga0111539_108297802 111
56 3300009147 Ga0114129_10941585 Ga0114129_109415852 111
57 3300009545 Ga0105237_10835048 Ga0105237_108350482 111
58 3300028379 Ga0268266_10256421 Ga0268266_102564212 111
59 3300044694 Ga0466963_0030800 Ga0466963_0030800_335_688 111
60 3300049569 Ga0501032_0755124 Ga0501032_0755124_136_480 111
61 3300049570 Ga0501033_0152014 Ga0501033_0152014_395_733 111
62 3300049572 Ga0501036_0082623 Ga0501036_0082623_330_674 111
63 3300049574 Ga0501038_0003431 Ga0501038_0003431_1133_1477 111
64 3300049576 Ga0501040_0001519 Ga0501040_0001519_13284_13628 111
65 3300049577 Ga0501041_0070713 Ga0501041_0070713_1764_2108 111
66 3300049578 Ga0501042_0048480 Ga0501042_0048480_1876_2220 111
67 3300049580 Ga0501046_0102607 Ga0501046_0102607_1589_1933 111
68 3300049584 Ga0501068_0059372 Ga0501068_0059372_268_612 111
69 3300049587 Ga0501071_0026029 Ga0501071_0026029_1674_2018 111
70 3300049588 Ga0501072_0100064 Ga0501072_0100064_181_525 111
71 3300049590 Ga0501074_0190061 Ga0501074_0190061_89_433 111
72 3300049591 Ga0501075_0000003 Ga0501075_0000003_8010_8354 111
73 3300049592 Ga0501076_0000010 Ga0501076_0000010_114022_114366 111
74 3300049593 Ga0501077_0741842 Ga0501077_0741842_64_408 111
75 3300049741 Ga0501079_0001991 Ga0501079_0001991_1933_2277 111
76 3300049742 Ga0501080_0007410 Ga0501080_0007410_8712_9056 111
77 3300049743 Ga0501081_0003752 Ga0501081_0003752_1851_2195 111
78 3300049744 Ga0501083_0380259 Ga0501083_0380259_490_834 111
79 3300049822 Ga0501035_0101518 Ga0501035_0101518_973_1311 111
80 3300049822 Ga0501035_0370849 Ga0501035_0370849_703_1047 111
81 3300049823 Ga0501044_0533170 Ga0501044_0533170_554_892 111
82 3300053153 Ga0500616_0054500 Ga0500616_0054500_96_431 111
83 3300053153 Ga0500616_0321540 Ga0500616_0321540_145_483 111
84 3300054114 Ga0501084_0011624 Ga0501084_0011624_1448_1792 111
85 3300060353 Ga0501082_0010736 Ga0501082_0010736_6417_6761 111
86 3300060353 Ga0501082_0416702 Ga0501082_0416702_791_1135 111
87 3300061734 Ga0530510_0000008 Ga0530510_0000008_20028_20372 111
88 3300005338 Ga0068868_100649619 Ga0068868_1006496192 112
89 3300005340 Ga0070689_100105192 Ga0070689_1001051921 112
90 3300005343 Ga0070687_100099056 Ga0070687_1000990563 112
91 3300005347 Ga0070668_100064159 Ga0070668_1000641592 112
92 3300005356 Ga0070674_100416053 Ga0070674_1004160532 112
93 3300005364 Ga0070673_100160146 Ga0070673_1001601462 112
94 3300005367 Ga0070667_100065267 Ga0070667_1000652673 112
95 3300005437 Ga0070710_11304449 Ga0070710_113044491 112
96 3300005456 Ga0070678_100104509 Ga0070678_1001045092 112
97 3300005544 Ga0070686_100165811 Ga0070686_1001658112 112
98 3300005548 Ga0070665_100905486 Ga0070665_1009054862 112
99 3300005564 Ga0070664_100081951 Ga0070664_1000819512 112
100 3300005564 Ga0070664_101769756 Ga0070664_1017697562 112
101 3300005578 Ga0068854_100624682 Ga0068854_1006246822 112
102 3300005615 Ga0070702_100179676 Ga0070702_1001796762 112
103 3300005617 Ga0068859_100141835 Ga0068859_1001418353 112
104 3300005618 Ga0068864_100361575 Ga0068864_1003615752 112
105 3300006881 Ga0068865_100677761 Ga0068865_1006777612 112
106 3300006931 Ga0097620_100141826 Ga0097620_1001418262 112
107 3300009174 Ga0105241_11189900 Ga0105241_111899002 112
108 3300013296 Ga0157374_10231979 Ga0157374_102319792 112
109 3300013308 Ga0157375_10167561 Ga0157375_101675612 112
110 3300013308 Ga0157375_11445627 Ga0157375_114456272 112
111 3300014968 Ga0157379_12658184 Ga0157379_126581842 112
112 3300025893 Ga0207682_10411735 Ga0207682_104117352 112
113 3300025903 Ga0207680_10369864 Ga0207680_103698642 112
114 3300025908 Ga0207643_10073505 Ga0207643_100735052 112
115 3300025918 Ga0207662_10074672 Ga0207662_100746724 112
116 3300025923 Ga0207681_11362212 Ga0207681_113622121 112
117 3300025925 Ga0207650_10198145 Ga0207650_101981452 112
118 3300025926 Ga0207659_11392567 Ga0207659_113925671 112
119 3300025927 Ga0207687_10206956 Ga0207687_102069563 112
120 3300025933 Ga0207706_10997002 Ga0207706_109970021 112
121 3300025934 Ga0207686_10594395 Ga0207686_105943952 112
122 3300025935 Ga0207709_11451165 Ga0207709_114511652 112
123 3300025937 Ga0207669_10758119 Ga0207669_107581192 112
124 3300025938 Ga0207704_10124505 Ga0207704_101245051 112
125 3300025942 Ga0207689_10349150 Ga0207689_103491502 112
126 3300025944 Ga0207661_10067405 Ga0207661_100674052 112
127 3300025945 Ga0207679_10990793 Ga0207679_109907932 112
128 3300025960 Ga0207651_10935239 Ga0207651_109352392 112
129 3300025972 Ga0207668_10225473 Ga0207668_102254733 112
130 3300025986 Ga0207658_10082423 Ga0207658_100824232 112
131 3300026023 Ga0207677_10165387 Ga0207677_101653872 112
132 3300026075 Ga0207708_10142985 Ga0207708_101429852 112
133 3300026095 Ga0207676_12315059 Ga0207676_123150592 112
134 3300026121 Ga0207683_10050643 Ga0207683_100506431 112
135 3300026121 Ga0207683_10746825 Ga0207683_107468252 112
136 3300026142 Ga0207698_12310507 Ga0207698_123105072 112
137 3300028379 Ga0268266_11422046 Ga0268266_114220462 112
138 3300028379 Ga0268266_11890722 Ga0268266_118907221 112
139 3300028381 Ga0268264_11790136 Ga0268264_117901361 112
140 3300035083 Ga0373926_0067641 Ga0373926_0067641_584_931 112
141 3300035118 Ga0373954_0236421 Ga0373954_0236421_170_517 112
142 3300035410 Ga0373924_0450194 Ga0373924_0450194_167_514 112
143 3300037068 Ga0373925_0174497 Ga0373925_0174497_930_1277 112
144 3300044683 Ga0466965_0730518 Ga0466965_0730518_181_528 112
145 3300044842 Ga0466957_0283843 Ga0466957_0283843_321_677 112
146 3300046454 Ga0495592_0081552 Ga0495592_0081552_946_1293 112
147 3300046477 Ga0495664_0138468 Ga0495664_0138468_722_1069 112
148 3300046514 Ga0495618_0495113 Ga0495618_0495113_89_436 112
149 3300046516 Ga0495628_0029416 Ga0495628_0029416_2799_3146 112
150 3300046683 Ga0495658_0228977 Ga0495658_0228977_250_597 112
151 3300048088 Ga0495602_0271974 Ga0495602_0271974_256_603 112
152 3300060353 Ga0501082_1684937 Ga0501082_1684937_120_464 112
153 3300003323 rootH1_10018043 rootH1_100180432 113
154 3300005577 Ga0068857_101136988 Ga0068857_1011369882 113
155 3300006038 Ga0075365_10502905 Ga0075365_105029052 113
156 3300006051 Ga0075364_10041553 Ga0075364_100415535 113
157 3300006195 Ga0075366_10056175 Ga0075366_100561754 113
158 3300006353 Ga0075370_10032862 Ga0075370_100328625 113
159 3300028577 Ga0265318_10053093 Ga0265318_100530933 113
160 3300031238 Ga0265332_10036940 Ga0265332_100369402 113
161 3300031240 Ga0265320_10066773 Ga0265320_100667732 113
162 3300031711 Ga0265314_10069448 Ga0265314_100694484 113
163 3300031911 Ga0307412_10830132 Ga0307412_108301321 113
164 3300032126 Ga0307415_101168832 Ga0307415_1011688322 113
165 3300035120 Ga0373957_0478082 Ga0373957_0478082_103_477 113
166 3300049589 Ga0501073_0079714 Ga0501073_0079714_154_495 113
167 3300049590 Ga0501074_0480465 Ga0501074_0480465_210_551 113
168 3300053077 Ga0495601_0472732 Ga0495601_0472732_186_560 113
169 iso_pu_bacteria 2643221629 2644167165 113
170 iso_pu_bacteria 2643221662 2644349681 113
171 3300006914 Ga0075436_100014014 Ga0075436_1000140146 114
172 3300036401 Ga0373937_1007430 Ga0373937_1007430_156_533 114
173 3300046683 Ga0495658_0867553 Ga0495658_0867553_38_415 114
174 3300047471 Ga0495684_0740347 Ga0495684_0740347_11_388 114
175 3300048907 Ga0496104_0325565 Ga0496104_0325565_982_1359 114
176 3300048917 Ga0496114_0321185 Ga0496114_0321185_770_1147 114
177 3300049576 Ga0501040_0191551 Ga0501040_0191551_221_598 114
178 3300049590 Ga0501074_0127400 Ga0501074_0127400_858_1235 114
179 3300049743 Ga0501081_0811905 Ga0501081_0811905_79_456 114
180 3300050513 nmdc:mga0rr50_534363_c1 nmdc:mga0rr50_534363_c1_19_396 114
181 3300050513 nmdc:mga0rr50_839560_c1 nmdc:mga0rr50_839560_c1_331_708 114
182 3300050514 nmdc:mga08x19_1602_c1 nmdc:mga08x19_1602_c1_5060_5437 114
183 3300005327 Ga0070658_10424810 Ga0070658_104248103 115
184 3300020082 Ga0206353_12038968 Ga0206353_120389682 115
185 3300025909 Ga0207705_10308102 Ga0207705_103081022 115
186 3300025949 Ga0207667_10496652 Ga0207667_104966523 115
187 3300026067 Ga0207678_10590946 Ga0207678_105909463 115
188 3300026118 Ga0207675_100499333 Ga0207675_1004993331 115
189 3300031251 Ga0265327_10031459 Ga0265327_100314593 115
190 3300031548 Ga0307408_100876292 Ga0307408_1008762922 115
191 3300036401 Ga0373937_0961661 Ga0373937_0961661_167_517 115
192 3300042001 Ga0439441_058737 Ga0439441_058737_318_668 115
193 3300046689 Ga0495613_0897169 Ga0495613_0897169_115_465 115
194 3300005338 Ga0068868_100827765 Ga0068868_1008277652 116
195 3300005367 Ga0070667_100818263 Ga0070667_1008182632 116
196 3300005539 Ga0068853_100575906 Ga0068853_1005759062 116
197 3300005548 Ga0070665_100053022 Ga0070665_1000530224 116
198 3300005563 Ga0068855_102199069 Ga0068855_1021990691 116
199 3300005618 Ga0068864_100123330 Ga0068864_1001233302 116
200 3300013104 Ga0157370_10443559 Ga0157370_104435591 116
201 3300025942 Ga0207689_10774124 Ga0207689_107741242 116
202 3300025944 Ga0207661_11176811 Ga0207661_111768112 116
203 3300026023 Ga0207677_10784870 Ga0207677_107848702 116
204 3300026041 Ga0207639_10473186 Ga0207639_104731862 116
205 3300026041 Ga0207639_11250570 Ga0207639_112505702 116
206 3300026095 Ga0207676_10275661 Ga0207676_102756612 116
207 3300026116 Ga0207674_11851154 Ga0207674_118511542 116
208 3300028379 Ga0268266_10036928 Ga0268266_100369284 116
209 3300048910 Ga0496107_0870230 Ga0496107_0870230_125_475 116
210 3300049571 Ga0501034_0763280 Ga0501034_0763280_279_629 116
211 3300054114 Ga0501084_1434609 Ga0501084_1434609_62_412 116
212 3300001979 JGI24740J21852_10151159 JGI24740J21852_101511592 117
213 3300005327 Ga0070658_10017966 Ga0070658_100179663 117
214 3300005327 Ga0070658_10208534 Ga0070658_102085342 117
215 3300005327 Ga0070658_10290985 Ga0070658_102909852 117
216 3300005328 Ga0070676_10231174 Ga0070676_102311742 117
217 3300005329 Ga0070683_100032265 Ga0070683_1000322654 117
218 3300005335 Ga0070666_10912017 Ga0070666_109120171 117
219 3300005337 Ga0070682_101970735 Ga0070682_1019707351 117
220 3300005339 Ga0070660_100007312 Ga0070660_10000731210 117
221 3300005339 Ga0070660_100220435 Ga0070660_1002204352 117
222 3300005344 Ga0070661_100001171 Ga0070661_1000011714 117
223 3300005344 Ga0070661_100040411 Ga0070661_1000404115 117
224 3300005344 Ga0070661_100279960 Ga0070661_1002799602 117
225 3300005355 Ga0070671_100251921 Ga0070671_1002519212 117
226 3300005356 Ga0070674_100025319 Ga0070674_1000253193 117
227 3300005364 Ga0070673_100393585 Ga0070673_1003935851 117
228 3300005366 Ga0070659_100021258 Ga0070659_1000212587 117
229 3300005366 Ga0070659_100122715 Ga0070659_1001227153 117
230 3300005366 Ga0070659_100492390 Ga0070659_1004923902 117
231 3300005455 Ga0070663_100774146 Ga0070663_1007741462 117
232 3300005455 Ga0070663_102053167 Ga0070663_1020531671 117
233 3300005456 Ga0070678_100412593 Ga0070678_1004125932 117
234 3300005456 Ga0070678_100816102 Ga0070678_1008161021 117
235 3300005539 Ga0068853_100008693 Ga0068853_10000869313 117
236 3300005539 Ga0068853_100109069 Ga0068853_1001090692 117
237 3300005543 Ga0070672_100066668 Ga0070672_1000666682 117
238 3300005548 Ga0070665_100070252 Ga0070665_1000702522 117
239 3300005548 Ga0070665_100084500 Ga0070665_1000845005 117
240 3300005563 Ga0068855_100179104 Ga0068855_1001791042 117
241 3300005564 Ga0070664_100317474 Ga0070664_1003174742 117
242 3300005577 Ga0068857_100013088 Ga0068857_1000130886 117
243 3300005578 Ga0068854_100014944 Ga0068854_1000149445 117
244 3300005614 Ga0068856_100087925 Ga0068856_1000879254 117
245 3300005614 Ga0068856_100313468 Ga0068856_1003134682 117
246 3300005616 Ga0068852_100063912 Ga0068852_1000639122 117
247 3300005616 Ga0068852_101618736 Ga0068852_1016187362 117
248 3300005834 Ga0068851_10125008 Ga0068851_101250083 117
249 3300005834 Ga0068851_10356654 Ga0068851_103566542 117
250 3300005840 Ga0068870_10260907 Ga0068870_102609072 117
251 3300006353 Ga0075370_10843945 Ga0075370_108439451 117
252 3300006358 Ga0068871_101691911 Ga0068871_1016919111 117
253 3300009093 Ga0105240_10088273 Ga0105240_100882735 117
254 3300009093 Ga0105240_12406675 Ga0105240_124066752 117
255 3300009148 Ga0105243_10487656 Ga0105243_104876562 117
256 3300009148 Ga0105243_10713365 Ga0105243_107133651 117
257 3300009174 Ga0105241_10045372 Ga0105241_100453724 117
258 3300009545 Ga0105237_11115583 Ga0105237_111155832 117
259 3300009551 Ga0105238_10081739 Ga0105238_100817392 117
260 3300009551 Ga0105238_10097291 Ga0105238_100972914 117
261 3300010375 Ga0105239_10019837 Ga0105239_100198378 117
262 3300010375 Ga0105239_10334373 Ga0105239_103343732 117
263 3300010375 Ga0105239_10397895 Ga0105239_103978952 117
264 3300010375 Ga0105239_11032274 Ga0105239_110322742 117
265 3300010375 Ga0105239_11734454 Ga0105239_117344541 117
266 3300011119 Ga0105246_10350667 Ga0105246_103506673 117
267 3300013100 Ga0157373_10061977 Ga0157373_100619772 117
268 3300013102 Ga0157371_10198470 Ga0157371_101984703 117
269 3300013104 Ga0157370_10089151 Ga0157370_100891512 117
270 3300013104 Ga0157370_10160833 Ga0157370_101608332 117
271 3300013105 Ga0157369_10340458 Ga0157369_103404583 117
272 3300013296 Ga0157374_10671896 Ga0157374_106718963 117
273 3300013296 Ga0157374_12723979 Ga0157374_127239791 117
274 3300013297 Ga0157378_11403373 Ga0157378_114033732 117
275 3300013306 Ga0163162_11466322 Ga0163162_114663221 117
276 3300013306 Ga0163162_11843934 Ga0163162_118439342 117
277 3300013307 Ga0157372_10098319 Ga0157372_100983192 117
278 3300013307 Ga0157372_10675615 Ga0157372_106756153 117
279 3300013307 Ga0157372_12818488 Ga0157372_128184881 117
280 3300013308 Ga0157375_11301338 Ga0157375_113013381 117
281 3300014325 Ga0163163_10177877 Ga0163163_101778774 117
282 3300014497 Ga0182008_10042439 Ga0182008_100424393 117
283 3300014969 Ga0157376_10461053 Ga0157376_104610532 117
284 3300014969 Ga0157376_11268169 Ga0157376_112681692 117
285 3300025321 Ga0207656_10587386 Ga0207656_105873861 117
286 3300025903 Ga0207680_11256553 Ga0207680_112565531 117
287 3300025904 Ga0207647_10043997 Ga0207647_100439975 117
288 3300025907 Ga0207645_10013644 Ga0207645_100136446 117
289 3300025908 Ga0207643_10232113 Ga0207643_102321131 117
290 3300025909 Ga0207705_10011790 Ga0207705_100117906 117
291 3300025909 Ga0207705_10170225 Ga0207705_101702252 117
292 3300025909 Ga0207705_10201429 Ga0207705_102014293 117
293 3300025910 Ga0207684_10096875 Ga0207684_100968753 117
294 3300025911 Ga0207654_10183103 Ga0207654_101831032 117
295 3300025913 Ga0207695_10253171 Ga0207695_102531712 117
296 3300025914 Ga0207671_11182298 Ga0207671_111822982 117
297 3300025919 Ga0207657_10024039 Ga0207657_100240396 117
298 3300025919 Ga0207657_10237067 Ga0207657_102370672 117
299 3300025920 Ga0207649_10040864 Ga0207649_100408643 117
300 3300025924 Ga0207694_10049295 Ga0207694_100492951 117
301 3300025924 Ga0207694_10107809 Ga0207694_101078093 117
302 3300025926 Ga0207659_10152540 Ga0207659_101525401 117
303 3300025931 Ga0207644_10120513 Ga0207644_101205132 117
304 3300025932 Ga0207690_10024015 Ga0207690_100240151 117
305 3300025932 Ga0207690_10172367 Ga0207690_101723672 117
306 3300025936 Ga0207670_10777528 Ga0207670_107775282 117
307 3300025937 Ga0207669_10215333 Ga0207669_102153332 117
308 3300025940 Ga0207691_10178157 Ga0207691_101781572 117
309 3300025949 Ga0207667_10002226 Ga0207667_1000222620 117
310 3300025960 Ga0207651_10151634 Ga0207651_101516342 117
311 3300025981 Ga0207640_10174263 Ga0207640_101742632 117
312 3300026023 Ga0207677_10148377 Ga0207677_101483772 117
313 3300026035 Ga0207703_12338236 Ga0207703_123382361 117
314 3300026041 Ga0207639_10003202 Ga0207639_1000320211 117
315 3300026041 Ga0207639_10029002 Ga0207639_100290024 117
316 3300026041 Ga0207639_10051195 Ga0207639_100511953 117
317 3300026067 Ga0207678_10550929 Ga0207678_105509291 117
318 3300026067 Ga0207678_11329805 Ga0207678_113298051 117
319 3300026078 Ga0207702_10062982 Ga0207702_100629823 117
320 3300026078 Ga0207702_10149868 Ga0207702_101498683 117
321 3300026089 Ga0207648_10098465 Ga0207648_100984654 117
322 3300026116 Ga0207674_10008220 Ga0207674_100082209 117
323 3300026121 Ga0207683_10212613 Ga0207683_102126133 117
324 3300026142 Ga0207698_10029608 Ga0207698_100296086 117
325 3300026142 Ga0207698_11268927 Ga0207698_112689272 117
326 3300028379 Ga0268266_10101877 Ga0268266_101018771 117
327 3300028379 Ga0268266_10204386 Ga0268266_102043862 117
328 3300028794 Ga0307515_10363919 Ga0307515_103639192 117
329 3300032126 Ga0307415_100114117 Ga0307415_1001141171 117
330 3300035084 Ga0373928_0040337 Ga0373928_0040337_211_564 117
331 3300035112 Ga0373932_0011133 Ga0373932_0011133_996_1349 117
332 3300035241 Ga0373961_0199642 Ga0373961_0199642_217_570 117
333 3300035691 Ga0373931_0083726 Ga0373931_0083726_179_532 117
334 3300036401 Ga0373937_1775550 Ga0373937_1775550_37_393 117
335 3300037418 Ga0395900_1723682 Ga0395900_1723682_99_452 117
336 3300037471 Ga0395905_1003987 Ga0395905_1003987_225_581 117
337 3300041411 Ga0439466_0207747 Ga0439466_0207747_112_498 117
338 3300041413 Ga0439465_0026621 Ga0439465_0026621_359_739 117
339 3300041413 Ga0439465_0091764 Ga0439465_0091764_291_677 117
340 3300041413 Ga0439465_0093977 Ga0439465_0093977_342_722 117
341 3300041512 Ga0451853_1738569 Ga0451853_1738569_10_363 117
342 3300042006 Ga0439432_136372 Ga0439432_136372_101_487 117
343 3300042010 Ga0439452_088347 Ga0439452_088347_109_495 117
344 3300042435 Ga0439434_0076229 Ga0439434_0076229_629_1015 117
345 3300045976 Ga0466967_0580894 Ga0466967_0580894_552_905 117
346 3300046517 Ga0495630_0781234 Ga0495630_0781234_119_475 117
347 3300048909 Ga0496106_0619885 Ga0496106_0619885_304_660 117
348 3300048911 Ga0496108_0603721 Ga0496108_0603721_459_812 117
349 3300048920 Ga0496117_0224174 Ga0496117_0224174_423_776 117
350 3300048921 Ga0496118_0352202 Ga0496118_0352202_93_446 117
351 3300049571 Ga0501034_0019924 Ga0501034_0019924_2231_2611 117
352 3300049571 Ga0501034_0282541 Ga0501034_0282541_176_532 117
353 3300049571 Ga0501034_0473338 Ga0501034_0473338_476_832 117
354 3300049572 Ga0501036_1729049 Ga0501036_1729049_30_410 117
355 3300049823 Ga0501044_0356329 Ga0501044_0356329_345_698 117
356 3300053108 Ga0500562_038177 Ga0500562_038177_24_404 117
357 3300053136 Ga0500559_0278552 Ga0500559_0278552_39_392 117
358 3300059639 Ga0587062_018321 Ga0587062_018321_334_714 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

116

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8144 1 109
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7612 1 109
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6912 1 115
1mli-assembly1.cif.gz_A crystal structure of muconolactone isomerase at 3.3 angstroms resolution 0.6659 1 117
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.6638 1 115
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8144 1 109 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7612 1 109 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7404 1 116 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7205 1 116 3.30.70.1060
af_A0A1D6H6B4_4_163_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.6798 48 66 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A3D9IGS9-F1-model_v4 deleted 0.8815 1 115
AF-A0A480AK13-F1-model_v4 YCII-related domain-containing protein 0.879 1 112
AF-A0A521DR30-F1-model_v4 deleted 0.8736 1 117
AF-A0A1E4JWH9-F1-model_v4 YCII-related domain-containing protein 0.8723 1 114
AF-A0A2R8BMB6-F1-model_v4 YCII-related domain-containing protein 0.872 1 110

Feature Viewer

pLDDT pTM Quality
86.11 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map