F420964

General Info

Members Datasets Scaffolds Average Seq Length
357 166 714 264

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0091133|Ga0495636_0091133_84_932
Length 282
Sequence MRIPMYQVDAFASRLFTGNPAAVCPLDRWLDDATMQAIAGENNLSETAFYVPAGKDRFGLRWFTPTIEVDLCGHATLGTAHVVFEIRREVTGDTVTFESRSGELRVKREGGLLTLDFPSRPATQDAIDARLVDALGAAPSKILGAQDYLCIYETEEQVRALAPNMEKLAQVDRFAVIVTAPGKDCDFVSRFFAPSKGVPEDPVTGRAHCTLTPYWAERLGKTKLHARQLSKRGGELWCELRGDRVKIAGRALQYLEGSIEIGTNYPDAATAGASKFEAVGRC

Samples

Sample ID Description Type Environment
1 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
166 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 0.28
Rhizosphere 97.48
Stem 0
Stem Tuber 0
Unclassified 13.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495636_0091133 3300047318 Unclassified 1323
2 rootH2_10006294 3300003320 Bacteria 34676
3 JGI25405J52794_10001609 3300003911 Bacteria 3748
4 Ga0070658_10033581 3300005327 Bacteria 4128
5 Ga0070683_100005975 3300005329 Bacteria 10192
6 Ga0070683_100006794 3300005329 Bacteria 9615
7 Ga0070683_100059043 3300005329 Unclassified 3563
8 Ga0070683_100094077 3300005329 Bacteria 2816
9 Ga0070683_100347211 3300005329 Bacteria 1413
10 Ga0070690_100250123 3300005330 Unclassified 1253
11 Ga0068869_100036772 3300005334 Bacteria 3477
12 Ga0068869_100231437 3300005334 Bacteria 1468
13 Ga0070666_10003952 3300005335 Bacteria 9001
14 Ga0070666_10161449 3300005335 Unclassified 1566
15 Ga0068868_100114776 3300005338 Unclassified 2192
16 Ga0070660_100012009 3300005339 Bacteria 6180
17 Ga0070687_100215974 3300005343 Bacteria 1171
18 Ga0070692_10081701 3300005345 Unclassified 1742
19 Ga0070668_100347135 3300005347 Bacteria 1255
20 Ga0070671_100046078 3300005355 Bacteria 3626
21 Ga0070671_100311568 3300005355 Bacteria 1341
22 Ga0070667_100135938 3300005367 Bacteria 2149
23 Ga0070709_10097839 3300005434 Bacteria 1949
24 Ga0070714_100112672 3300005435 Bacteria 2411
25 Ga0070713_100085808 3300005436 Bacteria 2697
26 Ga0070713_100280296 3300005436 Bacteria 1529
27 Ga0070710_10298972 3300005437 Bacteria 1050
28 Ga0070711_100123147 3300005439 Bacteria 1921
29 Ga0070708_100178934 3300005445 Bacteria 1982
30 Ga0070662_100034742 3300005457 Bacteria 3556
31 Ga0070681_10006647 3300005458 Bacteria 11256
32 Ga0070681_10013956 3300005458 Bacteria 7992
33 Ga0070681_10041660 3300005458 Bacteria 4603
34 Ga0068867_100078600 3300005459 Unclassified 2481
35 Ga0070698_100100878 3300005471 Bacteria 2859
36 Ga0070699_100220927 3300005518 Bacteria 1688
37 Ga0070679_100000392 3300005530 Bacteria 37226
38 Ga0070684_100002507 3300005535 Bacteria 13526
39 Ga0070684_100097820 3300005535 Bacteria 2618
40 Ga0070684_100188192 3300005535 Bacteria 1878
41 Ga0070684_100276394 3300005535 Bacteria 1538
42 Ga0068853_100182679 3300005539 Unclassified 1902
43 Ga0068853_100211174 3300005539 Bacteria 1769
44 Ga0068853_100255037 3300005539 Bacteria 1611
45 Ga0070686_100005614 3300005544 Bacteria 6949
46 Ga0070665_100028252 3300005548 Bacteria 5649
47 Ga0070665_100124117 3300005548 Unclassified 2584
48 Ga0070665_100196274 3300005548 Bacteria 2019
49 Ga0070665_100204355 3300005548 Bacteria 1976
50 Ga0070665_100338938 3300005548 Bacteria 1508
51 Ga0068855_100001959 3300005563 Bacteria 25565
52 Ga0068855_100005327 3300005563 Bacteria 15712
53 Ga0068855_100275500 3300005563 Unclassified 1870
54 Ga0068855_100282915 3300005563 Unclassified 1841
55 Ga0070664_100139363 3300005564 Bacteria 2135
56 Ga0068857_100000961 3300005577 Bacteria 22031
57 Ga0068857_100006636 3300005577 Bacteria 9941
58 Ga0068857_100033463 3300005577 Bacteria 4546
59 Ga0068854_100054125 3300005578 Bacteria 2885
60 Ga0068856_100006642 3300005614 Bacteria 11333
61 Ga0068856_100027237 3300005614 Bacteria 5576
62 Ga0068856_100035630 3300005614 Bacteria 4878
63 Ga0068856_100055583 3300005614 Bacteria 3906
64 Ga0068856_100064240 3300005614 Bacteria 3627
65 Ga0068852_100002343 3300005616 Bacteria 13036
66 Ga0068859_100012964 3300005617 Bacteria 8375
67 Ga0068859_100077503 3300005617 Bacteria 3364
68 Ga0068859_100148001 3300005617 Bacteria 2423
69 Ga0068864_100216069 3300005618 Bacteria 1767
70 Ga0068863_100231081 3300005841 Unclassified 1784
71 Ga0068863_100501623 3300005841 Bacteria 1195
72 Ga0068858_100007094 3300005842 Bacteria 10879
73 Ga0068858_100054716 3300005842 Unclassified 3690
74 Ga0068858_100903134 3300005842 Unclassified 864
75 Ga0068860_100006641 3300005843 Bacteria 11619
76 Ga0068860_100019620 3300005843 Bacteria 6556
77 Ga0068860_100196974 3300005843 Bacteria 1951
78 Ga0081539_10017749 3300005985 Bacteria 4977
79 Ga0075362_10157155 3300006177 Bacteria 1093
80 Ga0097621_100014479 3300006237 Bacteria 5902
81 Ga0097621_100032530 3300006237 Bacteria 4147
82 Ga0097621_100040867 3300006237 Bacteria 3730
83 Ga0097621_100066527 3300006237 Bacteria 2968
84 Ga0097621_100096061 3300006237 Bacteria 2487
85 Ga0097621_100328674 3300006237 Bacteria 1355
86 Ga0097621_100691259 3300006237 Bacteria 939
87 Ga0097621_100885303 3300006237 Unclassified 831
88 Ga0068871_100048464 3300006358 Bacteria 3430
89 Ga0068871_100048954 3300006358 Bacteria 3414
90 Ga0068871_100082457 3300006358 Unclassified 2666
91 Ga0068871_100126022 3300006358 Unclassified 2167
92 Ga0075433_10065264 3300006852 Bacteria 3193
93 Ga0075434_100277434 3300006871 Bacteria 1695
94 Ga0068865_100444709 3300006881 Unclassified 1070
95 Ga0097620_100012964 3300006931 Bacteria 8375
96 Ga0097620_100077502 3300006931 Bacteria 3364
97 Ga0097620_100148005 3300006931 Bacteria 2423
98 Ga0105240_10000512 3300009093 Bacteria 71437
99 Ga0105240_10001367 3300009093 Bacteria 41914
100 Ga0105240_10012177 3300009093 Bacteria 11906
101 Ga0105240_10013345 3300009093 Bacteria 11291
102 Ga0105240_10150359 3300009093 Unclassified 2774
103 Ga0105240_10335415 3300009093 Bacteria 1719
104 Ga0105240_10354279 3300009093 Unclassified 1664
105 Ga0105240_10579317 3300009093 Bacteria 1238
106 Ga0105245_10005286 3300009098 Bacteria 11342
107 Ga0105245_10010710 3300009098 Bacteria 7977
108 Ga0105245_10019823 3300009098 Bacteria 5895
109 Ga0105245_10106787 3300009098 Bacteria 2598
110 Ga0105245_10253866 3300009098 Bacteria 1709
111 Ga0105245_10261801 3300009098 Bacteria 1683
112 Ga0105245_10661597 3300009098 Bacteria 1075
113 Ga0105247_10043453 3300009101 Bacteria 2753
114 Ga0105247_10161156 3300009101 Bacteria 1485
115 Ga0105243_10024917 3300009148 Bacteria 4567
116 Ga0105243_10304574 3300009148 Unclassified 1445
117 Ga0105241_10006716 3300009174 Bacteria 8464
118 Ga0105241_10008163 3300009174 Bacteria 7710
119 Ga0105241_10298419 3300009174 Bacteria 1382
120 Ga0105241_10478570 3300009174 Bacteria 1106
121 Ga0105241_10795151 3300009174 Bacteria 871
122 Ga0105242_10004023 3300009176 Bacteria 11425
123 Ga0105242_10006354 3300009176 Bacteria 9096
124 Ga0105242_10036332 3300009176 Bacteria 3951
125 Ga0105242_10051616 3300009176 Unclassified 3352
126 Ga0105242_10153411 3300009176 Bacteria 2010
127 Ga0105242_10165974 3300009176 Bacteria 1937
128 Ga0105242_10249018 3300009176 Bacteria 1600
129 Ga0105242_10544923 3300009176 Bacteria 1111
130 Ga0105248_10003201 3300009177 Bacteria 18151
131 Ga0105248_10010300 3300009177 Bacteria 10292
132 Ga0105248_10013736 3300009177 Bacteria 8914
133 Ga0105248_10058413 3300009177 Bacteria 4333
134 Ga0105248_10143295 3300009177 Bacteria 2696
135 Ga0105248_10182876 3300009177 Bacteria 2362
136 Ga0105248_10350388 3300009177 Bacteria 1662
137 Ga0105248_10450016 3300009177 Bacteria 1451
138 Ga0105237_10001201 3300009545 Bacteria 34695
139 Ga0105237_10003388 3300009545 Bacteria 18955
140 Ga0105237_10005324 3300009545 Bacteria 14552
141 Ga0105237_10010280 3300009545 Bacteria 9969
142 Ga0105237_10080881 3300009545 Unclassified 3239
143 Ga0105237_10097662 3300009545 Bacteria 2928
144 Ga0105237_10148849 3300009545 Unclassified 2337
145 Ga0105237_10394607 3300009545 Bacteria 1388
146 Ga0105237_10468364 3300009545 Bacteria 1266
147 Ga0105238_10001768 3300009551 Bacteria 21678
148 Ga0105238_10005581 3300009551 Bacteria 12428
149 Ga0105238_10020629 3300009551 Bacteria 6712
150 Ga0105238_10021132 3300009551 Bacteria 6633
151 Ga0105238_10151156 3300009551 Bacteria 2297
152 Ga0105238_10249327 3300009551 Bacteria 1753
153 Ga0105249_10136991 3300009553 Bacteria 2344
154 Ga0105239_10002461 3300010375 Bacteria 23591
155 Ga0105239_10005016 3300010375 Bacteria 15631
156 Ga0105239_10009611 3300010375 Bacteria 10879
157 Ga0105239_10011066 3300010375 Bacteria 10072
158 Ga0105239_10033666 3300010375 Bacteria 5626
159 Ga0105246_10027555 3300011119 Bacteria 3725
160 Ga0105246_10046572 3300011119 Bacteria 2958
161 Ga0105246_10156757 3300011119 Unclassified 1730
162 Ga0157370_10006847 3300013104 Bacteria 12480
163 Ga0157370_10024270 3300013104 Bacteria 6007
164 Ga0157370_10048965 3300013104 Bacteria 4047
165 Ga0157370_10051982 3300013104 Bacteria 3912
166 Ga0157369_10006871 3300013105 Bacteria 13128
167 Ga0157369_10009805 3300013105 Bacteria 10956
168 Ga0157369_10062266 3300013105 Bacteria 4021
169 Ga0157374_10005006 3300013296 Bacteria 11121
170 Ga0157374_10015819 3300013296 Bacteria 6628
171 Ga0157374_10054603 3300013296 Unclassified 3727
172 Ga0157374_10074243 3300013296 Bacteria 3211
173 Ga0157374_10092711 3300013296 Bacteria 2882
174 Ga0157374_10368208 3300013296 Bacteria 1430
175 Ga0157378_10007154 3300013297 Bacteria 9749
176 Ga0157378_10022267 3300013297 Bacteria 5578
177 Ga0163162_10008655 3300013306 Bacteria 9908
178 Ga0163162_10098523 3300013306 Bacteria 3013
179 Ga0163162_10365810 3300013306 Bacteria 1575
180 Ga0157372_10001185 3300013307 Bacteria 28195
181 Ga0157372_10088966 3300013307 Unclassified 3507
182 Ga0157372_10211804 3300013307 Unclassified 2246
183 Ga0157375_10044226 3300013308 Bacteria 4325
184 Ga0157375_10107880 3300013308 Bacteria 2878
185 Ga0157375_10127166 3300013308 Bacteria 2665
186 Ga0157375_10387491 3300013308 Bacteria 1564
187 Ga0163163_10027267 3300014325 Bacteria 5470
188 Ga0163163_10040198 3300014325 Bacteria 4566
189 Ga0163163_10042991 3300014325 Bacteria 4428
190 Ga0163163_10080395 3300014325 Bacteria 3259
191 Ga0163163_10119959 3300014325 Bacteria 2663
192 Ga0163163_10423487 3300014325 Bacteria 1390
193 Ga0157376_10063191 3300014969 Bacteria 3118
194 Ga0157376_10176999 3300014969 Unclassified 1947
195 Ga0209675_1000556 3300025291 Bacteria 27016
196 Ga0207680_10012327 3300025903 Bacteria 4350
197 Ga0207699_10116034 3300025906 Bacteria 1724
198 Ga0207654_10013793 3300025911 Unclassified 4162
199 Ga0207707_10000927 3300025912 Bacteria 28437
200 Ga0207707_10007268 3300025912 Bacteria 9641
201 Ga0207707_10029116 3300025912 Bacteria 4826
202 Ga0207707_10054262 3300025912 Unclassified 3489
203 Ga0207707_10145125 3300025912 Bacteria 2074
204 Ga0207695_10001950 3300025913 Bacteria 32024
205 Ga0207695_10002643 3300025913 Bacteria 26197
206 Ga0207695_10004859 3300025913 Bacteria 18141
207 Ga0207695_10010871 3300025913 Bacteria 11084
208 Ga0207695_10095582 3300025913 Bacteria 2975
209 Ga0207695_10150347 3300025913 Bacteria 2268
210 Ga0207695_10179383 3300025913 Unclassified 2039
211 Ga0207695_10288856 3300025913 Bacteria 1532
212 Ga0207695_10366685 3300025913 Bacteria 1327
213 Ga0207671_10010348 3300025914 Bacteria 7705
214 Ga0207671_10033983 3300025914 Unclassified 3792
215 Ga0207671_10118076 3300025914 Unclassified 2025
216 Ga0207660_10060738 3300025917 Bacteria 2719
217 Ga0207657_10005219 3300025919 Bacteria 13608
218 Ga0207657_10082450 3300025919 Unclassified 2699
219 Ga0207657_10230025 3300025919 Bacteria 1483
220 Ga0207652_10004691 3300025921 Bacteria 11082
221 Ga0207652_10088643 3300025921 Bacteria 2715
222 Ga0207694_10000677 3300025924 Bacteria 30600
223 Ga0207694_10006194 3300025924 Bacteria 9134
224 Ga0207694_10047832 3300025924 Bacteria 3308
225 Ga0207694_10063818 3300025924 Bacteria 2869
226 Ga0207694_10069589 3300025924 Bacteria 2749
227 Ga0207694_10078067 3300025924 Unclassified 2595
228 Ga0207687_10001871 3300025927 Bacteria 14483
229 Ga0207687_10011340 3300025927 Bacteria 5825
230 Ga0207687_10016525 3300025927 Bacteria 4847
231 Ga0207687_10716214 3300025927 Bacteria 850
232 Ga0207644_10069046 3300025931 Bacteria 2580
233 Ga0207686_10016161 3300025934 Bacteria 4184
234 Ga0207686_10021391 3300025934 Bacteria 3712
235 Ga0207686_10028197 3300025934 Unclassified 3298
236 Ga0207686_10096898 3300025934 Bacteria 1961
237 Ga0207704_10335446 3300025938 Unclassified 1172
238 Ga0207711_10002956 3300025941 Bacteria 14864
239 Ga0207711_10032806 3300025941 Unclassified 4393
240 Ga0207711_10147360 3300025941 Bacteria 2121
241 Ga0207711_10189060 3300025941 Bacteria 1876
242 Ga0207711_10430303 3300025941 Bacteria 1228
243 Ga0207689_10290240 3300025942 Bacteria 1355
244 Ga0207661_10003035 3300025944 Bacteria 11608
245 Ga0207661_10212949 3300025944 Unclassified 1704
246 Ga0207661_10369011 3300025944 Bacteria 1297
247 Ga0207667_10000305 3300025949 Bacteria 67996
248 Ga0207667_10002132 3300025949 Bacteria 24797
249 Ga0207667_10013823 3300025949 Bacteria 9222
250 Ga0207667_10025134 3300025949 Bacteria 6526
251 Ga0207667_10155728 3300025949 Bacteria 2351
252 Ga0207667_10209543 3300025949 Bacteria 1998
253 Ga0207640_10047384 3300025981 Bacteria 2772
254 Ga0207703_10004080 3300026035 Bacteria 12047
255 Ga0207703_10005838 3300026035 Bacteria 9861
256 Ga0207703_10284723 3300026035 Bacteria 1502
257 Ga0207703_10826950 3300026035 Unclassified 885
258 Ga0207639_10184549 3300026041 Bacteria 1777
259 Ga0207702_10005639 3300026078 Bacteria 10915
260 Ga0207702_10022767 3300026078 Bacteria 5198
261 Ga0207702_10043303 3300026078 Unclassified 3779
262 Ga0207702_10541405 3300026078 Unclassified 1138
263 Ga0207641_10052450 3300026088 Bacteria 3454
264 Ga0207641_10296307 3300026088 Bacteria 1526
265 Ga0207641_10510369 3300026088 Bacteria 1168
266 Ga0207648_10121199 3300026089 Unclassified 2300
267 Ga0207648_10154621 3300026089 Bacteria 2024
268 Ga0207676_10030805 3300026095 Bacteria 4030
269 Ga0207674_10002038 3300026116 Bacteria 25646
270 Ga0207674_10002448 3300026116 Bacteria 23445
271 Ga0207674_10007894 3300026116 Bacteria 12362
272 Ga0207674_10023318 3300026116 Bacteria 6632
273 Ga0207698_10008338 3300026142 Bacteria 6546
274 Ga0207698_10045405 3300026142 Bacteria 3310
275 Ga0207698_10838563 3300026142 Unclassified 924
276 Ga0268266_10001034 3300028379 Bacteria 34999
277 Ga0268264_10009620 3300028381 Bacteria 8008
278 Ga0265338_10141879 3300028800 Bacteria 1881
279 Ga0265340_10072025 3300031247 Bacteria 1637
280 Ga0265316_10020114 3300031344 Bacteria 5690
281 Ga0307408_100420453 3300031548 Bacteria 1152
282 Ga0265313_10003485 3300031595 Bacteria 12692
283 Ga0265314_10000666 3300031711 Bacteria 42060
284 Ga0265314_10006785 3300031711 Bacteria 10038
285 Ga0307413_10168680 3300031824 Bacteria 1547
286 Ga0307414_10422720 3300032004 Unclassified 1162
287 Ga0307510_10012200 3300033180 Bacteria 10190
288 Ga0373934_0001719 3300035086 Bacteria 8043
289 Ga0373954_0036006 3300035118 Bacteria 2296
290 Ga0373954_0141274 3300035118 Bacteria 1174
291 Ga0373955_0077799 3300035172 Bacteria 1868
292 Ga0373935_0240828 3300035692 Bacteria 1263
293 Ga0373927_0001036 3300035695 Bacteria 21144
294 Ga0373933_0098821 3300035724 Bacteria 1809
295 Ga0373947_0259881 3300035725 Bacteria 1150
296 Ga0373937_0002225 3300036401 Bacteria 16199
297 Ga0373937_0016600 3300036401 Bacteria 6541
298 Ga0373937_0078276 3300036401 Bacteria 3055
299 Ga0316584_0145292 3300036712 Bacteria 1767
300 Ga0436364_0282794 3300037853 Bacteria 1154
301 Ga0436364_0920790 3300037853 Bacteria 10087
302 Ga0436365_0068158 3300039437 Bacteria 1026
303 Ga0436360_0923964 3300039438 Bacteria 2955
304 Ga0436360_1077989 3300039438 Bacteria 5717
305 Ga0436362_1237319 3300039453 Bacteria 1363
306 Ga0451577_0504909 3300042876 Bacteria 1098
307 Ga0466963_0035841 3300044694 Bacteria 3233
308 Ga0466957_0461960 3300044842 Bacteria 876
309 Ga0466958_0249275 3300045836 Bacteria 1136
310 Ga0466967_0185624 3300045976 Bacteria 1964
311 Ga0495580_0024410 3300046472 Bacteria 4426
312 Ga0495580_0041433 3300046472 Bacteria 3284
313 Ga0495580_0055593 3300046472 Bacteria 2789
314 Ga0495580_0079830 3300046472 Bacteria 2282
315 Ga0495580_0371218 3300046472 Bacteria 967
316 Ga0495582_0195878 3300046473 Bacteria 1153
317 Ga0495608_0258330 3300046511 Bacteria 1085
318 Ga0495643_0000111 3300046522 Bacteria 135372
319 Ga0495652_0132486 3300046529 Bacteria 1971
320 Ga0495586_0001899 3300046535 Bacteria 11372
321 Ga0495587_0003617 3300046536 Bacteria 10287
322 Ga0495587_0016171 3300046536 Bacteria 4644
323 Ga0495645_0070317 3300046543 Bacteria 2526
324 Ga0495633_0186528 3300046558 Bacteria 954
325 Ga0495634_0053074 3300046642 Bacteria 2716
326 Ga0495599_0005133 3300046678 Bacteria 7801
327 Ga0495613_0003155 3300046689 Bacteria 12347
328 Ga0495613_0061293 3300046689 Bacteria 2755
329 Ga0495674_0106538 3300047319 Bacteria 2381
330 Ga0495676_0184859 3300047321 Bacteria 1458
331 Ga0495680_0358320 3300047322 Bacteria 1014
332 Ga0495684_0068972 3300047471 Bacteria 2688
333 Ga0495684_0137152 3300047471 Bacteria 1836
334 Ga0495602_0350147 3300048088 Bacteria 1066
335 Ga0496112_0165183 3300048915 Unclassified 2180
336 Ga0501038_0529930 3300049574 Bacteria 898
337 Ga0501039_0140124 3300049575 Bacteria 1900
338 Ga0501040_0053181 3300049576 Bacteria 2773
339 Ga0501041_0112546 3300049577 Bacteria 1689
340 Ga0501047_0010922 3300049581 Bacteria 8589
341 Ga0501048_0368680 3300049582 Bacteria 1025
342 Ga0501071_0070125 3300049587 Bacteria 2553
343 Ga0501073_0115035 3300049589 Unclassified 1865
344 Ga0501075_0021444 3300049591 Bacteria 4710
345 Ga0501076_0079155 3300049592 Bacteria 2638
346 Ga0501076_0173691 3300049592 Bacteria 1757
347 Ga0501257_068543 3300049686 Bacteria 904
348 Ga0501080_0093698 3300049742 Bacteria 2789
349 Ga0501035_0099777 3300049822 Bacteria 2549
350 Ga0501044_0000736 3300049823 Bacteria 39492
351 Ga0501044_0284803 3300049823 Bacteria 1585
352 nmdc:mga03683_76952_c1 3300050489 Bacteria 1435
353 nmdc:mga0n895_138467_c1 3300050512 Bacteria 2461
354 Ga0495601_0037869 3300053077 Bacteria 3015
355 Ga0501082_0066089 3300060353 Bacteria 3114
356 Ga0530510_0076375 3300061734 Bacteria 2434
357 2919697846 2919692658 Bacteria 5943958
358 Ga0495636_0091133
359 rootH2_10006294
360 JGI25405J52794_10001609
361 Ga0070658_10033581
362 Ga0070683_100005975
363 Ga0070683_100006794
364 Ga0070683_100059043
365 Ga0070683_100094077
366 Ga0070683_100347211
367 Ga0070690_100250123
368 Ga0068869_100036772
369 Ga0068869_100231437
370 Ga0070666_10003952
371 Ga0070666_10161449
372 Ga0068868_100114776
373 Ga0070660_100012009
374 Ga0070687_100215974
375 Ga0070692_10081701
376 Ga0070668_100347135
377 Ga0070671_100046078
378 Ga0070671_100311568
379 Ga0070667_100135938
380 Ga0070709_10097839
381 Ga0070714_100112672
382 Ga0070713_100085808
383 Ga0070713_100280296
384 Ga0070710_10298972
385 Ga0070711_100123147
386 Ga0070708_100178934
387 Ga0070662_100034742
388 Ga0070681_10006647
389 Ga0070681_10013956
390 Ga0070681_10041660
391 Ga0068867_100078600
392 Ga0070698_100100878
393 Ga0070699_100220927
394 Ga0070679_100000392
395 Ga0070684_100002507
396 Ga0070684_100097820
397 Ga0070684_100188192
398 Ga0070684_100276394
399 Ga0068853_100182679
400 Ga0068853_100211174
401 Ga0068853_100255037
402 Ga0070686_100005614
403 Ga0070665_100028252
404 Ga0070665_100124117
405 Ga0070665_100196274
406 Ga0070665_100204355
407 Ga0070665_100338938
408 Ga0068855_100001959
409 Ga0068855_100005327
410 Ga0068855_100275500
411 Ga0068855_100282915
412 Ga0070664_100139363
413 Ga0068857_100000961
414 Ga0068857_100006636
415 Ga0068857_100033463
416 Ga0068854_100054125
417 Ga0068856_100006642
418 Ga0068856_100027237
419 Ga0068856_100035630
420 Ga0068856_100055583
421 Ga0068856_100064240
422 Ga0068852_100002343
423 Ga0068859_100012964
424 Ga0068859_100077503
425 Ga0068859_100148001
426 Ga0068864_100216069
427 Ga0068863_100231081
428 Ga0068863_100501623
429 Ga0068858_100007094
430 Ga0068858_100054716
431 Ga0068858_100903134
432 Ga0068860_100006641
433 Ga0068860_100019620
434 Ga0068860_100196974
435 Ga0081539_10017749
436 Ga0075362_10157155
437 Ga0097621_100014479
438 Ga0097621_100032530
439 Ga0097621_100040867
440 Ga0097621_100066527
441 Ga0097621_100096061
442 Ga0097621_100328674
443 Ga0097621_100691259
444 Ga0097621_100885303
445 Ga0068871_100048464
446 Ga0068871_100048954
447 Ga0068871_100082457
448 Ga0068871_100126022
449 Ga0075433_10065264
450 Ga0075434_100277434
451 Ga0068865_100444709
452 Ga0097620_100012964
453 Ga0097620_100077502
454 Ga0097620_100148005
455 Ga0105240_10000512
456 Ga0105240_10001367
457 Ga0105240_10012177
458 Ga0105240_10013345
459 Ga0105240_10150359
460 Ga0105240_10335415
461 Ga0105240_10354279
462 Ga0105240_10579317
463 Ga0105245_10005286
464 Ga0105245_10010710
465 Ga0105245_10019823
466 Ga0105245_10106787
467 Ga0105245_10253866
468 Ga0105245_10261801
469 Ga0105245_10661597
470 Ga0105247_10043453
471 Ga0105247_10161156
472 Ga0105243_10024917
473 Ga0105243_10304574
474 Ga0105241_10006716
475 Ga0105241_10008163
476 Ga0105241_10298419
477 Ga0105241_10478570
478 Ga0105241_10795151
479 Ga0105242_10004023
480 Ga0105242_10006354
481 Ga0105242_10036332
482 Ga0105242_10051616
483 Ga0105242_10153411
484 Ga0105242_10165974
485 Ga0105242_10249018
486 Ga0105242_10544923
487 Ga0105248_10003201
488 Ga0105248_10010300
489 Ga0105248_10013736
490 Ga0105248_10058413
491 Ga0105248_10143295
492 Ga0105248_10182876
493 Ga0105248_10350388
494 Ga0105248_10450016
495 Ga0105237_10001201
496 Ga0105237_10003388
497 Ga0105237_10005324
498 Ga0105237_10010280
499 Ga0105237_10080881
500 Ga0105237_10097662
501 Ga0105237_10148849
502 Ga0105237_10394607
503 Ga0105237_10468364
504 Ga0105238_10001768
505 Ga0105238_10005581
506 Ga0105238_10020629
507 Ga0105238_10021132
508 Ga0105238_10151156
509 Ga0105238_10249327
510 Ga0105249_10136991
511 Ga0105239_10002461
512 Ga0105239_10005016
513 Ga0105239_10009611
514 Ga0105239_10011066
515 Ga0105239_10033666
516 Ga0105246_10027555
517 Ga0105246_10046572
518 Ga0105246_10156757
519 Ga0157370_10006847
520 Ga0157370_10024270
521 Ga0157370_10048965
522 Ga0157370_10051982
523 Ga0157369_10006871
524 Ga0157369_10009805
525 Ga0157369_10062266
526 Ga0157374_10005006
527 Ga0157374_10015819
528 Ga0157374_10054603
529 Ga0157374_10074243
530 Ga0157374_10092711
531 Ga0157374_10368208
532 Ga0157378_10007154
533 Ga0157378_10022267
534 Ga0163162_10008655
535 Ga0163162_10098523
536 Ga0163162_10365810
537 Ga0157372_10001185
538 Ga0157372_10088966
539 Ga0157372_10211804
540 Ga0157375_10044226
541 Ga0157375_10107880
542 Ga0157375_10127166
543 Ga0157375_10387491
544 Ga0163163_10027267
545 Ga0163163_10040198
546 Ga0163163_10042991
547 Ga0163163_10080395
548 Ga0163163_10119959
549 Ga0163163_10423487
550 Ga0157376_10063191
551 Ga0157376_10176999
552 Ga0209675_1000556
553 Ga0207680_10012327
554 Ga0207699_10116034
555 Ga0207654_10013793
556 Ga0207707_10000927
557 Ga0207707_10007268
558 Ga0207707_10029116
559 Ga0207707_10054262
560 Ga0207707_10145125
561 Ga0207695_10001950
562 Ga0207695_10002643
563 Ga0207695_10004859
564 Ga0207695_10010871
565 Ga0207695_10095582
566 Ga0207695_10150347
567 Ga0207695_10179383
568 Ga0207695_10288856
569 Ga0207695_10366685
570 Ga0207671_10010348
571 Ga0207671_10033983
572 Ga0207671_10118076
573 Ga0207660_10060738
574 Ga0207657_10005219
575 Ga0207657_10082450
576 Ga0207657_10230025
577 Ga0207652_10004691
578 Ga0207652_10088643
579 Ga0207694_10000677
580 Ga0207694_10006194
581 Ga0207694_10047832
582 Ga0207694_10063818
583 Ga0207694_10069589
584 Ga0207694_10078067
585 Ga0207687_10001871
586 Ga0207687_10011340
587 Ga0207687_10016525
588 Ga0207687_10716214
589 Ga0207644_10069046
590 Ga0207686_10016161
591 Ga0207686_10021391
592 Ga0207686_10028197
593 Ga0207686_10096898
594 Ga0207704_10335446
595 Ga0207711_10002956
596 Ga0207711_10032806
597 Ga0207711_10147360
598 Ga0207711_10189060
599 Ga0207711_10430303
600 Ga0207689_10290240
601 Ga0207661_10003035
602 Ga0207661_10212949
603 Ga0207661_10369011
604 Ga0207667_10000305
605 Ga0207667_10002132
606 Ga0207667_10013823
607 Ga0207667_10025134
608 Ga0207667_10155728
609 Ga0207667_10209543
610 Ga0207640_10047384
611 Ga0207703_10004080
612 Ga0207703_10005838
613 Ga0207703_10284723
614 Ga0207703_10826950
615 Ga0207639_10184549
616 Ga0207702_10005639
617 Ga0207702_10022767
618 Ga0207702_10043303
619 Ga0207702_10541405
620 Ga0207641_10052450
621 Ga0207641_10296307
622 Ga0207641_10510369
623 Ga0207648_10121199
624 Ga0207648_10154621
625 Ga0207676_10030805
626 Ga0207674_10002038
627 Ga0207674_10002448
628 Ga0207674_10007894
629 Ga0207674_10023318
630 Ga0207698_10008338
631 Ga0207698_10045405
632 Ga0207698_10838563
633 Ga0268266_10001034
634 Ga0268264_10009620
635 Ga0265338_10141879
636 Ga0265340_10072025
637 Ga0265316_10020114
638 Ga0307408_100420453
639 Ga0265313_10003485
640 Ga0265314_10000666
641 Ga0265314_10006785
642 Ga0307413_10168680
643 Ga0307414_10422720
644 Ga0307510_10012200
645 Ga0373934_0001719
646 Ga0373954_0036006
647 Ga0373954_0141274
648 Ga0373955_0077799
649 Ga0373935_0240828
650 Ga0373927_0001036
651 Ga0373933_0098821
652 Ga0373947_0259881
653 Ga0373937_0002225
654 Ga0373937_0016600
655 Ga0373937_0078276
656 Ga0316584_0145292
657 Ga0436364_0282794
658 Ga0436364_0920790
659 Ga0436365_0068158
660 Ga0436360_0923964
661 Ga0436360_1077989
662 Ga0436362_1237319
663 Ga0451577_0504909
664 Ga0466963_0035841
665 Ga0466957_0461960
666 Ga0466958_0249275
667 Ga0466967_0185624
668 Ga0495580_0024410
669 Ga0495580_0041433
670 Ga0495580_0055593
671 Ga0495580_0079830
672 Ga0495580_0371218
673 Ga0495582_0195878
674 Ga0495608_0258330
675 Ga0495643_0000111
676 Ga0495652_0132486
677 Ga0495586_0001899
678 Ga0495587_0003617
679 Ga0495587_0016171
680 Ga0495645_0070317
681 Ga0495633_0186528
682 Ga0495634_0053074
683 Ga0495599_0005133
684 Ga0495613_0003155
685 Ga0495613_0061293
686 Ga0495674_0106538
687 Ga0495676_0184859
688 Ga0495680_0358320
689 Ga0495684_0068972
690 Ga0495684_0137152
691 Ga0495602_0350147
692 Ga0496112_0165183
693 Ga0501038_0529930
694 Ga0501039_0140124
695 Ga0501040_0053181
696 Ga0501041_0112546
697 Ga0501047_0010922
698 Ga0501048_0368680
699 Ga0501071_0070125
700 Ga0501073_0115035
701 Ga0501075_0021444
702 Ga0501076_0079155
703 Ga0501076_0173691
704 Ga0501257_068543
705 Ga0501080_0093698
706 Ga0501035_0099777
707 Ga0501044_0000736
708 Ga0501044_0284803
709 nmdc:mga03683_76952_c1
710 nmdc:mga0n895_138467_c1
711 Ga0495601_0037869
712 Ga0501082_0066089
713 Ga0530510_0076375
714 2919697846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

8

257

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.949 1 265
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.9455 1 265
4dun-assembly1.cif.gz_A-2 1.76a x-ray crystal structure of a putative phenazine biosynthesis phzc/phzf protein from clostridium difficile (strain 630) 0.9142 3 265
4dun-assembly1.cif.gz_A-2 1.76a x-ray crystal structure of a putative phenazine biosynthesis phzc/phzf protein from clostridium difficile (strain 630) 0.9075 3 265
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8532 3 265
ID Description Score Start End Superfamily
1s7jA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.974 1 119 3.10.310.10
af_A0A2R8Q0H1_3_123_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9601 5 120 3.10.310.10
af_K7LH11_6_125_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9475 5 112 3.10.310.10
af_I1JFB7_3_158_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9411 5 111 3.10.310.10
af_A0A1P8ARL5_195_308_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9237 154 259 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A2G6NG02-F1-model_v4 Thioesterase domain-containing protein 0.9716 1 266 GO:0005737
GO:0009058
GO:0016853
AF-A0A377W477-F1-model_v4 Phenazine biosynthesis protein PhzF (EC 5.1.-.-) 0.9704 3 122 GO:0005737
GO:0009058
GO:0016853
AF-A0A7I6WYV7-F1-model_v4 deleted 0.9682 1 266
AF-A0A822NZA4-F1-model_v4 deleted 0.9671 1 266
AF-A0A519NKB3-F1-model_v4 deleted 0.9663 36 265

Map