F420947

General Info

Members Datasets Scaffolds Average Seq Length
357 264 714 283

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0084633|Ga0495651_0084633_1248_2216
Length 322
Sequence MLRNLECIEYLNAIKEAPHEFIATLKAFAQRDQLALHKKIFRSISMSQVQSSSQTSAFADVKARQHVAWETGNYAVVGTTLQIVGENLCEALDLRAGTSVLDVAAGNGNATLAAARRWCDVTSTDYVSSLLEAGKARARAEGLTAVRFREADAEALPYADASFDAVISTFGVMFTPNQERAASELARVCKPGGKIGLANWTPESFIGQVFKTIGKYLPPPPGLKSPALWGTRARLDELFHGSAKPVAAKSREFTFRYRSPAHWIEVFRTYYGPVNKAFAAMDAERQAAFQLDLMTLLANGNRSGDETLVLPSEYLEVVMERL

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
126 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
127 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
128 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
129 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
130 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
131 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
257 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
258 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
259 2643221664 Massilia sp. Root418 Isolate Unclassified
260 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
261 2738541280 Massilia sp. GV090 Isolate Unclassified
262 2857558681 Duganella sp. R-74565 Isolate Unclassified
263 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
264 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0.28
Isolates 2.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.52
Nodule 0
Rhizoplane 4.2
Rhizosphere 89.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0084633 3300046462 Bacteria 2389
2 JGI25407J50210_10010491 3300003373 Bacteria 2358
3 JGI25407J50210_10013415 3300003373 Bacteria 2106
4 JGI25407J50210_10039196 3300003373 Bacteria 1215
5 Ga0055530_10014734 3300003791 Bacteria 2587
6 Ga0055531_10000022 3300003794 Bacteria 166362
7 Ga0070676_10045701 3300005328 Bacteria 2551
8 Ga0070690_100007436 3300005330 Bacteria 6276
9 Ga0068869_100015580 3300005334 Bacteria 5105
10 Ga0070666_10005964 3300005335 Bacteria 7481
11 Ga0070682_100106965 3300005337 Bacteria 1857
12 Ga0068868_100079552 3300005338 Bacteria 2626
13 Ga0070689_100008253 3300005340 Bacteria 7328
14 Ga0070668_100083718 3300005347 Bacteria 2504
15 Ga0070671_100155369 3300005355 Bacteria 1933
16 Ga0070673_100052694 3300005364 Bacteria 3194
17 Ga0070688_100019902 3300005365 Bacteria 3894
18 Ga0070659_100065261 3300005366 Bacteria 2883
19 Ga0070659_100296127 3300005366 Bacteria 1348
20 Ga0070667_100213227 3300005367 Bacteria 1717
21 Ga0070713_100000426 3300005436 Bacteria 26948
22 Ga0070663_100383023 3300005455 Bacteria 1146
23 Ga0070678_100210589 3300005456 Bacteria 1610
24 Ga0070681_10045027 3300005458 Bacteria 4417
25 Ga0068867_100014599 3300005459 Bacteria 5566
26 Ga0068867_100020127 3300005459 Bacteria 4754
27 Ga0070685_10016095 3300005466 Bacteria 3979
28 Ga0070698_100002746 3300005471 Bacteria 19357
29 Ga0070679_100065696 3300005530 Bacteria 3616
30 Ga0070672_100059733 3300005543 Bacteria 3000
31 Ga0070686_100316512 3300005544 Bacteria 1162
32 Ga0070696_100056834 3300005546 Bacteria 2730
33 Ga0070693_100139466 3300005547 Bacteria 1524
34 Ga0070665_100207104 3300005548 Bacteria 1962
35 Ga0070704_100295721 3300005549 Bacteria 1347
36 Ga0068855_100128227 3300005563 Bacteria 2899
37 Ga0068855_100374608 3300005563 Bacteria 1564
38 Ga0070664_100093242 3300005564 Bacteria 2609
39 Ga0068857_100020604 3300005577 Bacteria 5803
40 Ga0068857_100264670 3300005577 Bacteria 1579
41 Ga0068854_100068765 3300005578 Bacteria 2583
42 Ga0070702_100019410 3300005615 Bacteria 3545
43 Ga0068859_100340035 3300005617 Bacteria 1595
44 Ga0068866_10112356 3300005718 Bacteria 1522
45 Ga0068870_10049502 3300005840 Bacteria 2217
46 Ga0068858_100180241 3300005842 Bacteria 1994
47 Ga0068858_100503536 3300005842 Bacteria 1170
48 Ga0068860_100223999 3300005843 Bacteria 1826
49 Ga0081455_10012428 3300005937 Bacteria 8495
50 Ga0081538_10003552 3300005981 Bacteria 14664
51 Ga0081538_10003841 3300005981 Bacteria 14036
52 Ga0081538_10003931 3300005981 Bacteria 13855
53 Ga0081538_10017267 3300005981 Bacteria 5486
54 Ga0081538_10036934 3300005981 Bacteria 3178
55 Ga0070716_100190742 3300006173 Bacteria 1354
56 Ga0070712_100085679 3300006175 Bacteria 2294
57 Ga0070712_100622879 3300006175 Bacteria 915
58 Ga0068871_100035682 3300006358 Bacteria 3953
59 Ga0075428_100152088 3300006844 Bacteria 2514
60 Ga0075431_100086587 3300006847 Bacteria 3233
61 Ga0097620_100340033 3300006931 Bacteria 1595
62 Ga0105245_10030150 3300009098 Bacteria 4795
63 Ga0105245_10032753 3300009098 Bacteria 4602
64 Ga0105245_10082531 3300009098 Bacteria 2940
65 Ga0105247_10036113 3300009101 Bacteria 3013
66 Ga0105243_10002577 3300009148 Bacteria 15138
67 Ga0105243_10145907 3300009148 Bacteria 2024
68 Ga0105243_10217015 3300009148 Bacteria 1688
69 Ga0105241_10054190 3300009174 Bacteria 3069
70 Ga0105241_10303583 3300009174 Bacteria 1371
71 Ga0105242_10032912 3300009176 Bacteria 4148
72 Ga0105242_10045417 3300009176 Bacteria 3560
73 Ga0105248_10113744 3300009177 Bacteria 3052
74 Ga0105237_10128676 3300009545 Bacteria 2527
75 Ga0105249_10485161 3300009553 Bacteria 1279
76 Ga0105239_10250119 3300010375 Bacteria 1991
77 Ga0157326_1010431 3300012513 Bacteria 1036
78 Ga0157371_10447304 3300013102 Bacteria 950
79 Ga0157369_10526999 3300013105 Bacteria 1222
80 Ga0157378_10494326 3300013297 Bacteria 1221
81 Ga0163162_10015027 3300013306 Bacteria 7562
82 Ga0157372_10285263 3300013307 Bacteria 1920
83 Ga0157372_10548692 3300013307 Bacteria 1347
84 Ga0157375_10107127 3300013308 Bacteria 2888
85 Ga0157375_10493289 3300013308 Bacteria 1389
86 Ga0157379_10096374 3300014968 Bacteria 2655
87 Ga0213875_10005494 3300021388 Bacteria 6795
88 Ga0224712_10187747 3300022467 Bacteria 934
89 Ga0209759_1000618 3300025256 Bacteria 33996
90 Ga0209565_1003690 3300025263 Bacteria 4860
91 Ga0209050_1005737 3300025298 Bacteria 7659
92 Ga0209051_1018439 3300025303 Bacteria 3088
93 Ga0209257_1000061 3300025304 Bacteria 367698
94 Ga0209257_1007281 3300025304 Bacteria 6750
95 Ga0207642_10005464 3300025899 Bacteria 4152
96 Ga0207680_10009006 3300025903 Bacteria 4928
97 Ga0207680_10209942 3300025903 Bacteria 1331
98 Ga0207645_10061041 3300025907 Bacteria 2408
99 Ga0207643_10028430 3300025908 Bacteria 3105
100 Ga0207643_10032049 3300025908 Bacteria 2933
101 Ga0207707_10041790 3300025912 Bacteria 4004
102 Ga0207671_10031312 3300025914 Bacteria 3963
103 Ga0207693_10224763 3300025915 Bacteria 1475
104 Ga0207652_10147790 3300025921 Bacteria 2104
105 Ga0207659_10241641 3300025926 Bacteria 1461
106 Ga0207659_10375291 3300025926 Bacteria 1185
107 Ga0207687_10009208 3300025927 Bacteria 6461
108 Ga0207687_10015853 3300025927 Bacteria 4945
109 Ga0207700_10000035 3300025928 Bacteria 119648
110 Ga0207644_10097906 3300025931 Bacteria 2198
111 Ga0207690_10018529 3300025932 Bacteria 4270
112 Ga0207690_10555296 3300025932 Bacteria 934
113 Ga0207706_10001160 3300025933 Bacteria 26707
114 Ga0207686_10001451 3300025934 Bacteria 13438
115 Ga0207709_10002221 3300025935 Bacteria 12382
116 Ga0207669_10126311 3300025937 Bacteria 1748
117 Ga0207704_10007503 3300025938 Bacteria 5157
118 Ga0207691_10005484 3300025940 Bacteria 12249
119 Ga0207711_10156855 3300025941 Bacteria 2058
120 Ga0207689_10080862 3300025942 Bacteria 2671
121 Ga0207667_10279961 3300025949 Bacteria 1704
122 Ga0207667_10334610 3300025949 Bacteria 1546
123 Ga0207651_10163754 3300025960 Bacteria 1746
124 Ga0207658_10009235 3300025986 Bacteria 6686
125 Ga0207658_10065376 3300025986 Bacteria 2731
126 Ga0207677_10020063 3300026023 Bacteria 4050
127 Ga0207703_10363344 3300026035 Bacteria 1335
128 Ga0207678_10082555 3300026067 Bacteria 2749
129 Ga0207648_10051178 3300026089 Bacteria 3610
130 Ga0207648_10067762 3300026089 Bacteria 3111
131 Ga0207648_10091370 3300026089 Bacteria 2661
132 Ga0207674_10006749 3300026116 Bacteria 13475
133 Ga0207674_10185998 3300026116 Bacteria 2028
134 Ga0207675_100095631 3300026118 Bacteria 2795
135 Ga0207683_10006010 3300026121 Bacteria 10393
136 Ga0268264_10027790 3300028381 Bacteria 4624
137 Ga0268264_10042125 3300028381 Bacteria 3779
138 Ga0307408_100000432 3300031548 Bacteria 37289
139 Ga0307408_100003886 3300031548 Bacteria 10170
140 Ga0307408_100026707 3300031548 Bacteria 3969
141 Ga0307410_10024348 3300031852 Bacteria 3781
142 Ga0307406_10162420 3300031901 Bacteria 1607
143 Ga0307412_10063691 3300031911 Bacteria 2489
144 Ga0307412_10345673 3300031911 Bacteria 1192
145 Ga0307415_100338979 3300032126 Bacteria 1261
146 Ga0373926_0043076 3300035083 Bacteria 1615
147 Ga0373944_0013954 3300035089 Bacteria 2237
148 Ga0373954_0069405 3300035118 Bacteria 1673
149 Ga0373956_0016756 3300035119 Bacteria 3080
150 Ga0373957_0032089 3300035120 Bacteria 1933
151 Ga0373943_0009093 3300035170 Bacteria 4452
152 Ga0373935_0028332 3300035692 Bacteria 3462
153 Ga0373927_0119419 3300035695 Bacteria 1720
154 Ga0373933_0033375 3300035724 Bacteria 2994
155 Ga0373947_0030482 3300035725 Bacteria 3169
156 Ga0373947_0199049 3300035725 Bacteria 1310
157 Ga0373937_0016590 3300036401 Bacteria 6543
158 Ga0373937_0032278 3300036401 Bacteria 4749
159 Ga0373937_0358937 3300036401 Bacteria 1381
160 Ga0373925_0058009 3300037068 Bacteria 2902
161 Ga0373925_0074878 3300037068 Bacteria 2565
162 Ga0436364_0448573 3300037853 Bacteria 11673
163 Ga0436365_1113314 3300039437 Bacteria 2097
164 Ga0439448_0043490 3300042005 Bacteria 1458
165 Ga0439450_003451 3300042008 Bacteria 2612
166 Ga0439451_029743 3300042009 Bacteria 1099
167 Ga0439456_047444 3300042013 Bacteria 937
168 Ga0439463_003571 3300042016 Bacteria 3928
169 Ga0439440_0057377 3300042993 Bacteria 986
170 Ga0495617_000346 3300046452 Bacteria 25591
171 Ga0495592_0159053 3300046454 Bacteria 1556
172 Ga0495603_0050108 3300046455 Bacteria 2484
173 Ga0495590_0033230 3300046457 Bacteria 1803
174 Ga0495629_0074200 3300046459 Bacteria 2375
175 Ga0495638_0000861 3300046460 Bacteria 31550
176 Ga0495638_0035182 3300046460 Bacteria 3194
177 Ga0495651_0097951 3300046462 Bacteria 2189
178 Ga0495653_0000169 3300046463 Bacteria 54020
179 Ga0495653_0018654 3300046463 Bacteria 5633
180 Ga0495580_0006994 3300046472 Bacteria 9093
181 Ga0495580_0008476 3300046472 Bacteria 8177
182 Ga0495580_0020267 3300046472 Bacteria 4925
183 Ga0495580_0316978 3300046472 Bacteria 1060
184 Ga0495582_0042388 3300046473 Bacteria 2507
185 Ga0495582_0042971 3300046473 Bacteria 2488
186 Ga0495605_0000121 3300046474 Bacteria 102560
187 Ga0495605_0006901 3300046474 Bacteria 6485
188 Ga0495664_0009675 3300046477 Bacteria 5398
189 Ga0495584_0000161 3300046491 Bacteria 47105
190 Ga0495584_0046248 3300046491 Bacteria 2195
191 Ga0495585_0008903 3300046492 Bacteria 6053
192 Ga0495585_0010578 3300046492 Bacteria 5486
193 Ga0495607_0005067 3300046501 Bacteria 9542
194 Ga0495583_0000106 3300046506 Bacteria 140932
195 Ga0495583_0000150 3300046506 Bacteria 117772
196 Ga0495583_0048103 3300046506 Bacteria 1958
197 Ga0495606_0000080 3300046507 Bacteria 161866
198 Ga0495606_0035949 3300046507 Bacteria 3380
199 Ga0495610_0089345 3300046512 Bacteria 1399
200 Ga0495616_0005148 3300046513 Bacteria 8115
201 Ga0495616_0032693 3300046513 Bacteria 2715
202 Ga0495620_0016760 3300046515 Bacteria 3668
203 Ga0495628_0004009 3300046516 Bacteria 13118
204 Ga0495630_0053971 3300046517 Bacteria 3010
205 Ga0495644_0000652 3300046523 Bacteria 14531
206 Ga0495644_0001201 3300046523 Bacteria 10607
207 Ga0495648_0002048 3300046524 Bacteria 19126
208 Ga0495648_0007550 3300046524 Bacteria 8691
209 Ga0495648_0105143 3300046524 Bacteria 1548
210 Ga0495666_0015478 3300046526 Bacteria 3797
211 Ga0495666_0017870 3300046526 Bacteria 3532
212 Ga0495652_0047163 3300046529 Bacteria 3695
213 Ga0495652_0278187 3300046529 Bacteria 1227
214 Ga0495665_0009124 3300046531 Bacteria 5375
215 Ga0495640_0132097 3300046533 Bacteria 1615
216 Ga0495586_0081536 3300046535 Bacteria 1778
217 Ga0495609_0002059 3300046538 Bacteria 12665
218 Ga0495609_0002529 3300046538 Bacteria 11212
219 Ga0495621_0116931 3300046539 Bacteria 1027
220 Ga0495597_0037868 3300046542 Bacteria 2164
221 Ga0495633_0005963 3300046558 Bacteria 7321
222 Ga0495656_0004663 3300046615 Bacteria 4709
223 Ga0495611_0001753 3300046648 Bacteria 10498
224 Ga0495611_0004267 3300046648 Bacteria 6216
225 Ga0495625_0023696 3300046660 Bacteria 4684
226 Ga0495635_0035351 3300046663 Bacteria 3463
227 Ga0495635_0262529 3300046663 Bacteria 1163
228 Ga0495659_0000024 3300046664 Bacteria 71415
229 Ga0495659_0007290 3300046664 Bacteria 3505
230 Ga0495661_0074065 3300046665 Bacteria 1982
231 Ga0495657_0097259 3300046675 Bacteria 1880
232 Ga0495599_0015755 3300046678 Bacteria 4692
233 Ga0495599_0044524 3300046678 Bacteria 2783
234 Ga0495646_0045958 3300046680 Bacteria 2664
235 Ga0495647_0000877 3300046681 Bacteria 8999
236 Ga0495658_0075653 3300046683 Bacteria 1965
237 Ga0495669_0094419 3300046684 Bacteria 1384
238 Ga0495613_0038267 3300046689 Bacteria 3555
239 Ga0495624_0005099 3300046690 Bacteria 9495
240 Ga0495624_0016640 3300046690 Bacteria 4949
241 Ga0495670_0000532 3300046691 Bacteria 18091
242 Ga0495670_0002547 3300046691 Bacteria 9008
243 Ga0495671_0000118 3300046692 Bacteria 71570
244 Ga0495671_0022816 3300046692 Bacteria 3274
245 Ga0495671_0031619 3300046692 Bacteria 2706
246 Ga0495649_0049675 3300046694 Bacteria 2278
247 Ga0495589_0053690 3300046794 Bacteria 1988
248 Ga0495600_0014940 3300046809 Bacteria 4901
249 Ga0495581_0012926 3300047315 Bacteria 4838
250 Ga0495604_0000459 3300047317 Bacteria 36163
251 Ga0495604_0017890 3300047317 Bacteria 5670
252 Ga0495636_0000553 3300047318 Bacteria 13713
253 Ga0495636_0047370 3300047318 Bacteria 1795
254 Ga0495674_0016786 3300047319 Bacteria 6829
255 Ga0495672_0000310 3300047320 Bacteria 65475
256 Ga0495672_0008735 3300047320 Bacteria 7428
257 Ga0495676_0081302 3300047321 Bacteria 2456
258 Ga0495680_0013685 3300047322 Bacteria 7064
259 Ga0495683_0001583 3300047323 Bacteria 14689
260 Ga0495687_000057 3300047443 Bacteria 186224
261 Ga0495687_067316 3300047443 Bacteria 1450
262 Ga0495675_0042675 3300047444 Bacteria 2889
263 Ga0495677_0001383 3300047445 Bacteria 9700
264 Ga0495679_000006 3300047446 Bacteria 449956
265 Ga0495685_000607 3300047447 Bacteria 10999
266 Ga0495673_0010443 3300047469 Bacteria 5047
267 Ga0495686_0152495 3300047472 Bacteria 1356
268 Ga0495593_0006260 3300047673 Bacteria 6986
269 Ga0495602_0067348 3300048088 Bacteria 3081
270 Ga0495602_0097887 3300048088 Bacteria 2415
271 Ga0495602_0446775 3300048088 Bacteria 913
272 Ga0495614_0032224 3300048089 Bacteria 2256
273 Ga0496100_0076205 3300048903 Bacteria 2251
274 Ga0496101_0067517 3300048904 Bacteria 2611
275 Ga0496104_0028556 3300048907 Bacteria 5170
276 Ga0496104_0080110 3300048907 Bacteria 3113
277 Ga0496105_0081560 3300048908 Bacteria 2672
278 Ga0496106_0087932 3300048909 Bacteria 2395
279 Ga0496106_0307718 3300048909 Bacteria 1271
280 Ga0496107_0036298 3300048910 Bacteria 3535
281 Ga0496108_0374418 3300048911 Bacteria 1243
282 Ga0496109_0350207 3300048912 Bacteria 1395
283 Ga0496109_0735378 3300048912 Bacteria 924
284 Ga0496110_0281967 3300048913 Bacteria 1513
285 Ga0496112_0625840 3300048915 Bacteria 1007
286 Ga0496114_0045995 3300048917 Bacteria 3626
287 Ga0496115_0533029 3300048918 Bacteria 940
288 Ga0496117_0017642 3300048920 Bacteria 5955
289 Ga0496121_0063709 3300048924 Bacteria 3010
290 Ga0496126_0003077 3300048929 Bacteria 21574
291 Ga0496126_0212253 3300048929 Bacteria 1629
292 Ga0495678_005056 3300049459 Bacteria 7415
293 Ga0495682_0000089 3300049460 Bacteria 80020
294 Ga0495682_0013463 3300049460 Bacteria 3115
295 Ga0501031_0001057 3300049568 Bacteria 16704
296 Ga0501032_0101787 3300049569 Bacteria 1903
297 Ga0501033_0027795 3300049570 Bacteria 4252
298 Ga0501034_0003433 3300049571 Bacteria 18098
299 Ga0501036_0003639 3300049572 Bacteria 12324
300 Ga0501036_0048256 3300049572 Bacteria 3605
301 Ga0501037_0005693 3300049573 Bacteria 9093
302 Ga0501037_0011895 3300049573 Bacteria 6408
303 Ga0501038_0004047 3300049574 Bacteria 13627
304 Ga0501038_0010540 3300049574 Bacteria 8453
305 Ga0501039_0003146 3300049575 Bacteria 12348
306 Ga0501040_0010038 3300049576 Bacteria 6184
307 Ga0501041_0001701 3300049577 Bacteria 12326
308 Ga0501042_0002349 3300049578 Bacteria 11601
309 Ga0501042_0167432 3300049578 Bacteria 1585
310 Ga0501043_0001265 3300049579 Bacteria 22213
311 Ga0501043_0006669 3300049579 Bacteria 9235
312 Ga0501046_0004679 3300049580 Bacteria 12353
313 Ga0501046_0096245 3300049580 Bacteria 2274
314 Ga0501047_0075501 3300049581 Bacteria 3243
315 Ga0501047_0189482 3300049581 Bacteria 1921
316 Ga0501048_0012778 3300049582 Bacteria 6242
317 Ga0501068_0120287 3300049584 Bacteria 1637
318 Ga0501068_0327239 3300049584 Bacteria 983
319 Ga0501071_0000782 3300049587 Bacteria 16937
320 Ga0501072_0003153 3300049588 Bacteria 12407
321 Ga0501073_0002203 3300049589 Bacteria 14576
322 Ga0501074_0002818 3300049590 Bacteria 12166
323 Ga0501074_0037663 3300049590 Bacteria 3505
324 Ga0501075_0000478 3300049591 Bacteria 23920
325 Ga0501076_0000087 3300049592 Bacteria 48819
326 Ga0501077_0003377 3300049593 Bacteria 9601
327 Ga0501077_0091415 3300049593 Bacteria 1928
328 Ga0501079_0000479 3300049741 Bacteria 26367
329 Ga0501080_0013038 3300049742 Bacteria 7632
330 Ga0501081_0010235 3300049743 Bacteria 6122
331 Ga0501035_0034223 3300049822 Bacteria 4618
332 Ga0501035_0049857 3300049822 Bacteria 3752
333 Ga0501035_0105302 3300049822 Bacteria 2473
334 Ga0501044_0004772 3300049823 Bacteria 15163
335 Ga0501045_0017031 3300049824 Bacteria 5161
336 nmdc:mga08y16_593304_c1 3300050511 Bacteria 1117
337 nmdc:mga0rr50_268561_c1 3300050513 Bacteria 1421
338 nmdc:mga0rr50_298358_c1 3300050513 Bacteria 1347
339 Ga0495601_0016392 3300053077 Bacteria 4489
340 Ga0495595_0320821 3300053084 Bacteria 780
341 Ga0495619_0063583 3300053085 Bacteria 2458
342 Ga0495619_0301919 3300053085 Bacteria 1109
343 Ga0495619_0311858 3300053085 Bacteria 1089
344 Ga0500616_0006535 3300053153 Bacteria 7617
345 Ga0500645_001853 3300053730 Bacteria 10129
346 Ga0501084_0002364 3300054114 Bacteria 15175
347 Ga0590074_002468 3300059423 Bacteria 3035
348 Ga0501082_0003543 3300060353 Bacteria 13634
349 Ga0530510_0003151 3300061734 Bacteria 11322
350 2525558337 2524614729 Bacteria 3091755
351 2630650325 2627854209 Bacteria 3093011
352 2644360132 2643221664 Bacteria 7272945
353 2676479368 2675903059 Bacteria 8644972
354 2738741946 2738541280 Bacteria 6630198
355 2857559648 2857558681 Bacteria 6617694
356 2900640167 2900634093 Bacteria 10263517
357 642617137 642555113 Bacteria 8214658
358 Ga0495651_0084633
359 JGI25407J50210_10010491
360 JGI25407J50210_10013415
361 JGI25407J50210_10039196
362 Ga0055530_10014734
363 Ga0055531_10000022
364 Ga0070676_10045701
365 Ga0070690_100007436
366 Ga0068869_100015580
367 Ga0070666_10005964
368 Ga0070682_100106965
369 Ga0068868_100079552
370 Ga0070689_100008253
371 Ga0070668_100083718
372 Ga0070671_100155369
373 Ga0070673_100052694
374 Ga0070688_100019902
375 Ga0070659_100065261
376 Ga0070659_100296127
377 Ga0070667_100213227
378 Ga0070713_100000426
379 Ga0070663_100383023
380 Ga0070678_100210589
381 Ga0070681_10045027
382 Ga0068867_100014599
383 Ga0068867_100020127
384 Ga0070685_10016095
385 Ga0070698_100002746
386 Ga0070679_100065696
387 Ga0070672_100059733
388 Ga0070686_100316512
389 Ga0070696_100056834
390 Ga0070693_100139466
391 Ga0070665_100207104
392 Ga0070704_100295721
393 Ga0068855_100128227
394 Ga0068855_100374608
395 Ga0070664_100093242
396 Ga0068857_100020604
397 Ga0068857_100264670
398 Ga0068854_100068765
399 Ga0070702_100019410
400 Ga0068859_100340035
401 Ga0068866_10112356
402 Ga0068870_10049502
403 Ga0068858_100180241
404 Ga0068858_100503536
405 Ga0068860_100223999
406 Ga0081455_10012428
407 Ga0081538_10003552
408 Ga0081538_10003841
409 Ga0081538_10003931
410 Ga0081538_10017267
411 Ga0081538_10036934
412 Ga0070716_100190742
413 Ga0070712_100085679
414 Ga0070712_100622879
415 Ga0068871_100035682
416 Ga0075428_100152088
417 Ga0075431_100086587
418 Ga0097620_100340033
419 Ga0105245_10030150
420 Ga0105245_10032753
421 Ga0105245_10082531
422 Ga0105247_10036113
423 Ga0105243_10002577
424 Ga0105243_10145907
425 Ga0105243_10217015
426 Ga0105241_10054190
427 Ga0105241_10303583
428 Ga0105242_10032912
429 Ga0105242_10045417
430 Ga0105248_10113744
431 Ga0105237_10128676
432 Ga0105249_10485161
433 Ga0105239_10250119
434 Ga0157326_1010431
435 Ga0157371_10447304
436 Ga0157369_10526999
437 Ga0157378_10494326
438 Ga0163162_10015027
439 Ga0157372_10285263
440 Ga0157372_10548692
441 Ga0157375_10107127
442 Ga0157375_10493289
443 Ga0157379_10096374
444 Ga0213875_10005494
445 Ga0224712_10187747
446 Ga0209759_1000618
447 Ga0209565_1003690
448 Ga0209050_1005737
449 Ga0209051_1018439
450 Ga0209257_1000061
451 Ga0209257_1007281
452 Ga0207642_10005464
453 Ga0207680_10009006
454 Ga0207680_10209942
455 Ga0207645_10061041
456 Ga0207643_10028430
457 Ga0207643_10032049
458 Ga0207707_10041790
459 Ga0207671_10031312
460 Ga0207693_10224763
461 Ga0207652_10147790
462 Ga0207659_10241641
463 Ga0207659_10375291
464 Ga0207687_10009208
465 Ga0207687_10015853
466 Ga0207700_10000035
467 Ga0207644_10097906
468 Ga0207690_10018529
469 Ga0207690_10555296
470 Ga0207706_10001160
471 Ga0207686_10001451
472 Ga0207709_10002221
473 Ga0207669_10126311
474 Ga0207704_10007503
475 Ga0207691_10005484
476 Ga0207711_10156855
477 Ga0207689_10080862
478 Ga0207667_10279961
479 Ga0207667_10334610
480 Ga0207651_10163754
481 Ga0207658_10009235
482 Ga0207658_10065376
483 Ga0207677_10020063
484 Ga0207703_10363344
485 Ga0207678_10082555
486 Ga0207648_10051178
487 Ga0207648_10067762
488 Ga0207648_10091370
489 Ga0207674_10006749
490 Ga0207674_10185998
491 Ga0207675_100095631
492 Ga0207683_10006010
493 Ga0268264_10027790
494 Ga0268264_10042125
495 Ga0307408_100000432
496 Ga0307408_100003886
497 Ga0307408_100026707
498 Ga0307410_10024348
499 Ga0307406_10162420
500 Ga0307412_10063691
501 Ga0307412_10345673
502 Ga0307415_100338979
503 Ga0373926_0043076
504 Ga0373944_0013954
505 Ga0373954_0069405
506 Ga0373956_0016756
507 Ga0373957_0032089
508 Ga0373943_0009093
509 Ga0373935_0028332
510 Ga0373927_0119419
511 Ga0373933_0033375
512 Ga0373947_0030482
513 Ga0373947_0199049
514 Ga0373937_0016590
515 Ga0373937_0032278
516 Ga0373937_0358937
517 Ga0373925_0058009
518 Ga0373925_0074878
519 Ga0436364_0448573
520 Ga0436365_1113314
521 Ga0439448_0043490
522 Ga0439450_003451
523 Ga0439451_029743
524 Ga0439456_047444
525 Ga0439463_003571
526 Ga0439440_0057377
527 Ga0495617_000346
528 Ga0495592_0159053
529 Ga0495603_0050108
530 Ga0495590_0033230
531 Ga0495629_0074200
532 Ga0495638_0000861
533 Ga0495638_0035182
534 Ga0495651_0097951
535 Ga0495653_0000169
536 Ga0495653_0018654
537 Ga0495580_0006994
538 Ga0495580_0008476
539 Ga0495580_0020267
540 Ga0495580_0316978
541 Ga0495582_0042388
542 Ga0495582_0042971
543 Ga0495605_0000121
544 Ga0495605_0006901
545 Ga0495664_0009675
546 Ga0495584_0000161
547 Ga0495584_0046248
548 Ga0495585_0008903
549 Ga0495585_0010578
550 Ga0495607_0005067
551 Ga0495583_0000106
552 Ga0495583_0000150
553 Ga0495583_0048103
554 Ga0495606_0000080
555 Ga0495606_0035949
556 Ga0495610_0089345
557 Ga0495616_0005148
558 Ga0495616_0032693
559 Ga0495620_0016760
560 Ga0495628_0004009
561 Ga0495630_0053971
562 Ga0495644_0000652
563 Ga0495644_0001201
564 Ga0495648_0002048
565 Ga0495648_0007550
566 Ga0495648_0105143
567 Ga0495666_0015478
568 Ga0495666_0017870
569 Ga0495652_0047163
570 Ga0495652_0278187
571 Ga0495665_0009124
572 Ga0495640_0132097
573 Ga0495586_0081536
574 Ga0495609_0002059
575 Ga0495609_0002529
576 Ga0495621_0116931
577 Ga0495597_0037868
578 Ga0495633_0005963
579 Ga0495656_0004663
580 Ga0495611_0001753
581 Ga0495611_0004267
582 Ga0495625_0023696
583 Ga0495635_0035351
584 Ga0495635_0262529
585 Ga0495659_0000024
586 Ga0495659_0007290
587 Ga0495661_0074065
588 Ga0495657_0097259
589 Ga0495599_0015755
590 Ga0495599_0044524
591 Ga0495646_0045958
592 Ga0495647_0000877
593 Ga0495658_0075653
594 Ga0495669_0094419
595 Ga0495613_0038267
596 Ga0495624_0005099
597 Ga0495624_0016640
598 Ga0495670_0000532
599 Ga0495670_0002547
600 Ga0495671_0000118
601 Ga0495671_0022816
602 Ga0495671_0031619
603 Ga0495649_0049675
604 Ga0495589_0053690
605 Ga0495600_0014940
606 Ga0495581_0012926
607 Ga0495604_0000459
608 Ga0495604_0017890
609 Ga0495636_0000553
610 Ga0495636_0047370
611 Ga0495674_0016786
612 Ga0495672_0000310
613 Ga0495672_0008735
614 Ga0495676_0081302
615 Ga0495680_0013685
616 Ga0495683_0001583
617 Ga0495687_000057
618 Ga0495687_067316
619 Ga0495675_0042675
620 Ga0495677_0001383
621 Ga0495679_000006
622 Ga0495685_000607
623 Ga0495673_0010443
624 Ga0495686_0152495
625 Ga0495593_0006260
626 Ga0495602_0067348
627 Ga0495602_0097887
628 Ga0495602_0446775
629 Ga0495614_0032224
630 Ga0496100_0076205
631 Ga0496101_0067517
632 Ga0496104_0028556
633 Ga0496104_0080110
634 Ga0496105_0081560
635 Ga0496106_0087932
636 Ga0496106_0307718
637 Ga0496107_0036298
638 Ga0496108_0374418
639 Ga0496109_0350207
640 Ga0496109_0735378
641 Ga0496110_0281967
642 Ga0496112_0625840
643 Ga0496114_0045995
644 Ga0496115_0533029
645 Ga0496117_0017642
646 Ga0496121_0063709
647 Ga0496126_0003077
648 Ga0496126_0212253
649 Ga0495678_005056
650 Ga0495682_0000089
651 Ga0495682_0013463
652 Ga0501031_0001057
653 Ga0501032_0101787
654 Ga0501033_0027795
655 Ga0501034_0003433
656 Ga0501036_0003639
657 Ga0501036_0048256
658 Ga0501037_0005693
659 Ga0501037_0011895
660 Ga0501038_0004047
661 Ga0501038_0010540
662 Ga0501039_0003146
663 Ga0501040_0010038
664 Ga0501041_0001701
665 Ga0501042_0002349
666 Ga0501042_0167432
667 Ga0501043_0001265
668 Ga0501043_0006669
669 Ga0501046_0004679
670 Ga0501046_0096245
671 Ga0501047_0075501
672 Ga0501047_0189482
673 Ga0501048_0012778
674 Ga0501068_0120287
675 Ga0501068_0327239
676 Ga0501071_0000782
677 Ga0501072_0003153
678 Ga0501073_0002203
679 Ga0501074_0002818
680 Ga0501074_0037663
681 Ga0501075_0000478
682 Ga0501076_0000087
683 Ga0501077_0003377
684 Ga0501077_0091415
685 Ga0501079_0000479
686 Ga0501080_0013038
687 Ga0501081_0010235
688 Ga0501035_0034223
689 Ga0501035_0049857
690 Ga0501035_0105302
691 Ga0501044_0004772
692 Ga0501045_0017031
693 nmdc:mga08y16_593304_c1
694 nmdc:mga0rr50_268561_c1
695 nmdc:mga0rr50_298358_c1
696 Ga0495601_0016392
697 Ga0495595_0320821
698 Ga0495619_0063583
699 Ga0495619_0301919
700 Ga0495619_0311858
701 Ga0500616_0006535
702 Ga0500645_001853
703 Ga0501084_0002364
704 Ga0590074_002468
705 Ga0501082_0003543
706 Ga0530510_0003151
707 2525558337
708 2630650325
709 2644360132
710 2676479368
711 2738741946
712 2857559648
713 2900640167
714 642617137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

101

197

0.98

PF13649

Methyltransf_25

Methyltransferase domain

100

193

0.95

PF13847

Methyltransf_31

Methyltransferase domain

94

214

0.94

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

84

209

0.93

PF08242

Methyltransf_12

Methyltransferase domain

101

195

0.88

PF13489

Methyltransf_23

Methyltransferase domain

81

241

0.87

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

34

197

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.9025 29 145
2nxe-assembly2.cif.gz_B t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with s-adenosyl-l-methionine 0.8797 30 142
2zbp-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-l-methionine 0.8771 30 142
5thz-assembly2.cif.gz_A crystal structure of curj carbon methyltransferase 0.8719 41 145
5e72-assembly1.cif.gz_A crystal structure of the archaeal trna m2g/m22g10 methyltransferase (atrm11) in complex with s-adenosyl-l-methionine (sam) from thermococcus kodakarensis 0.8716 29 142
ID Description Score Start End Superfamily
af_P9WLY9_5_208_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9526 14 183 3.40.50.150
af_P9WLY7_8_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.936 1 264 3.40.50.150
af_O74198_45_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9287 27 145 3.40.50.150
af_P25087_39_327_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9259 26 145 3.40.50.150
af_P9WLY7_8_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9226 1 264 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A8B5XBL4-F1-model_v4 Class I SAM-dependent methyltransferase 0.9685 1 264 GO:0008168
GO:0032259
AF-A0A4R2CR44-F1-model_v4 Methyltransferase family protein 0.9667 1 264 GO:0008757
GO:0032259
AF-A0A7W0GKN9-F1-model_v4 Methyltransferase domain-containing protein 0.9572 78 263 GO:0008757
GO:0032259
AF-A0A8B5XBL4-F1-model_v4 Class I SAM-dependent methyltransferase 0.9509 1 264 GO:0008168
GO:0032259
AF-A0A6G9Y7I9-F1-model_v4 Methyltransferase domain-containing protein 0.9497 9 266 GO:0008168
GO:0032259

Map