F420796

General Info

Members Datasets Scaffolds Average Seq Length
357 201 714 407

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100094593|Ga0075428_1000945932
Length 451
Sequence MCARMKQSGERFFRRFAAHPRTKRTPRPAGRGYSLPPRRGWEWNTSFNMNGPKTDRLFIATTSFTVLFSVVGLALYGLPFYYDYMVGEFGWSRTQVTSGNALSKLVVGPLFGFFAGWIVDRFGPRRLMLAGIIMAGVALIGLGSMSALWMFYVFYLLNALGYVCGGPLPNQILLSQWFDRSRGKAMGFAYLGIGVGGAVVPLLSYWLSQMFGWRTALQVLGIVIIVLSLPLVLLVKEKSTVSLRQKDSRPLERAGDVFRNPAFYLLAFGSMCSIGAVGGANQHLKLFLSLDQHYAADEAAQIISFVLMFSIAGRLLMGWLADRIPKKHVMLLIYILVGSSIPLLFFASRHETMFLFAAVFGIGLGGEYLIIPLIAGELFGLRVLGRIMGVILTADGVAEAVFPMLIGYLRDQSGAYRTGFFLLIALALAGALAIAFLPRKEPALIKEPAVV

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
136 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.2
Nodule 0
Rhizoplane 2.24
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100094593 3300006844 Bacteria 3258
2 Ga0065715_10008782 3300005293 Bacteria 3705
3 Ga0070676_10135879 3300005328 Bacteria 1560
4 Ga0070683_100009342 3300005329 Bacteria 8380
5 Ga0070690_100017707 3300005330 Bacteria 4291
6 Ga0070670_100020647 3300005331 Bacteria 5666
7 Ga0068869_100076183 3300005334 Bacteria 2493
8 Ga0070666_10120213 3300005335 Bacteria 1821
9 Ga0070682_100023032 3300005337 Bacteria 3696
10 Ga0068868_100185301 3300005338 Bacteria 1729
11 Ga0070689_100029645 3300005340 Bacteria 4144
12 Ga0070689_100091179 3300005340 Bacteria 2402
13 Ga0070687_100019338 3300005343 Bacteria 3166
14 Ga0070669_100010717 3300005353 Bacteria 6505
15 Ga0070669_100026877 3300005353 Bacteria 4141
16 Ga0070669_100065657 3300005353 Bacteria 2673
17 Ga0070675_100096406 3300005354 Bacteria 2485
18 Ga0070675_100117900 3300005354 Bacteria 2253
19 Ga0070674_100115953 3300005356 Bacteria 1975
20 Ga0070673_100065100 3300005364 Bacteria 2906
21 Ga0070688_100029556 3300005365 Bacteria 3282
22 Ga0070688_100033980 3300005365 Bacteria 3085
23 Ga0070688_100057576 3300005365 Bacteria 2444
24 Ga0070709_10059947 3300005434 Bacteria 2418
25 Ga0070709_10111539 3300005434 Unclassified 1839
26 Ga0070714_100046740 3300005435 Bacteria 3673
27 Ga0070713_100011313 3300005436 Bacteria 6495
28 Ga0070713_100106840 3300005436 Bacteria 2434
29 Ga0070701_10006289 3300005438 Bacteria 4986
30 Ga0070701_10012556 3300005438 Bacteria 3825
31 Ga0070705_100001588 3300005440 Bacteria 11898
32 Ga0070705_100020804 3300005440 Bacteria 3480
33 Ga0070705_100170381 3300005440 Bacteria 1465
34 Ga0070700_100027253 3300005441 Bacteria 3386
35 Ga0070694_100011307 3300005444 Bacteria 5527
36 Ga0070694_100016338 3300005444 Bacteria 4671
37 Ga0070708_100067824 3300005445 Bacteria 3205
38 Ga0070663_100044202 3300005455 Bacteria 3139
39 Ga0070678_100049847 3300005456 Bacteria 3024
40 Ga0070681_10032389 3300005458 Bacteria 5246
41 Ga0068867_100009183 3300005459 Bacteria 6980
42 Ga0068867_100018269 3300005459 Bacteria 4982
43 Ga0068867_100043458 3300005459 Bacteria 3290
44 Ga0068867_100261322 3300005459 Bacteria 1411
45 Ga0070685_10009493 3300005466 Bacteria 5030
46 Ga0070685_10019560 3300005466 Bacteria 3655
47 Ga0070706_100027578 3300005467 Bacteria 5226
48 Ga0070706_100069225 3300005467 Bacteria 3264
49 Ga0070707_100080592 3300005468 Bacteria 3142
50 Ga0070707_100155960 3300005468 Bacteria 2224
51 Ga0070698_100005450 3300005471 Bacteria 13899
52 Ga0070698_100016752 3300005471 Bacteria 7730
53 Ga0070698_100071402 3300005471 Bacteria 3482
54 Ga0070698_100222066 3300005471 Bacteria 1823
55 Ga0070699_100013952 3300005518 Bacteria 6911
56 Ga0070699_100021039 3300005518 Bacteria 5624
57 Ga0070697_100015145 3300005536 Bacteria 6055
58 Ga0070697_100101052 3300005536 Bacteria 2396
59 Ga0070672_100101053 3300005543 Bacteria 2339
60 Ga0070686_100000585 3300005544 Bacteria 21569
61 Ga0070695_100158651 3300005545 Bacteria 1586
62 Ga0070696_100009045 3300005546 Bacteria 6669
63 Ga0070696_100076544 3300005546 Bacteria 2363
64 Ga0070665_100038560 3300005548 Bacteria 4803
65 Ga0070704_100011973 3300005549 Bacteria 5343
66 Ga0070704_100034856 3300005549 Bacteria 3417
67 Ga0068855_100000432 3300005563 Bacteria 51912
68 Ga0070664_100000726 3300005564 Bacteria 25332
69 Ga0070664_100216034 3300005564 Bacteria 1714
70 Ga0068857_100000096 3300005577 Bacteria 51376
71 Ga0068854_100008909 3300005578 Bacteria 6462
72 Ga0068854_100014011 3300005578 Bacteria 5276
73 Ga0068854_100024664 3300005578 Bacteria 4120
74 Ga0068854_100084099 3300005578 Bacteria 2354
75 Ga0068856_100000179 3300005614 Bacteria 66149
76 Ga0070702_100021586 3300005615 Bacteria 3390
77 Ga0068859_100010599 3300005617 Bacteria 9278
78 Ga0068859_100067710 3300005617 Bacteria 3605
79 Ga0068859_100218261 3300005617 Bacteria 1994
80 Ga0068864_100000129 3300005618 Bacteria 73206
81 Ga0068864_100011905 3300005618 Bacteria 7183
82 Ga0068864_100073432 3300005618 Bacteria 2982
83 Ga0068866_10036529 3300005718 Bacteria 2408
84 Ga0068861_100002273 3300005719 Bacteria 12478
85 Ga0068861_100006006 3300005719 Bacteria 8254
86 Ga0068861_100068506 3300005719 Bacteria 2742
87 Ga0068861_100080405 3300005719 Bacteria 2550
88 Ga0068863_100027468 3300005841 Bacteria 5428
89 Ga0068863_100221253 3300005841 Bacteria 1824
90 Ga0068858_100049926 3300005842 Bacteria 3873
91 Ga0068858_100078606 3300005842 Bacteria 3065
92 Ga0068860_100027327 3300005843 Bacteria 5497
93 Ga0068860_100083493 3300005843 Bacteria 3038
94 Ga0068860_100322304 3300005843 Bacteria 1517
95 Ga0068862_100028697 3300005844 Bacteria 4686
96 Ga0068862_100039579 3300005844 Bacteria 4004
97 Ga0068862_100135736 3300005844 Bacteria 2180
98 Ga0081455_10008381 3300005937 Bacteria 10752
99 Ga0081455_10072397 3300005937 Bacteria 2853
100 Ga0081455_10087975 3300005937 Bacteria 2526
101 Ga0081539_10000386 3300005985 Bacteria 95318
102 Ga0081539_10088654 3300005985 Bacteria 1604
103 Ga0070717_10066500 3300006028 Bacteria 2998
104 Ga0070717_10182084 3300006028 Bacteria 1832
105 Ga0075368_10001781 3300006042 Bacteria 6930
106 Ga0075364_10006908 3300006051 Bacteria 6700
107 Ga0070716_100001179 3300006173 Bacteria 11500
108 Ga0075367_10007616 3300006178 Bacteria 5559
109 Ga0075367_10077138 3300006178 Bacteria 2011
110 Ga0097621_100002114 3300006237 Bacteria 13601
111 Ga0068871_100027217 3300006358 Unclassified 4469
112 Ga0075428_100046542 3300006844 Bacteria 4765
113 Ga0075428_100142991 3300006844 Bacteria 2601
114 Ga0075431_100070636 3300006847 Bacteria 3603
115 Ga0075431_100292759 3300006847 Bacteria 1646
116 Ga0075431_100406187 3300006847 Bacteria 1363
117 Ga0075433_10046593 3300006852 Bacteria 3771
118 Ga0075433_10096737 3300006852 Bacteria 2613
119 Ga0075434_100000167 3300006871 Bacteria 41887
120 Ga0075434_100067708 3300006871 Bacteria 3556
121 Ga0075434_100198363 3300006871 Unclassified 2027
122 Ga0068865_100195607 3300006881 Bacteria 1567
123 Ga0068865_100233254 3300006881 Unclassified 1445
124 Ga0075436_100011324 3300006914 Bacteria 6120
125 Ga0075436_100019691 3300006914 Bacteria 4626
126 Ga0075436_100109262 3300006914 Bacteria 1929
127 Ga0097620_100010599 3300006931 Bacteria 9278
128 Ga0097620_100067711 3300006931 Bacteria 3605
129 Ga0097620_100218261 3300006931 Bacteria 1994
130 Ga0075435_100002314 3300007076 Bacteria 12600
131 Ga0075435_100004630 3300007076 Bacteria 9472
132 Ga0075435_100007340 3300007076 Bacteria 7849
133 Ga0075435_100064947 3300007076 Bacteria 2966
134 Ga0099794_10007460 3300007265 Unclassified 4496
135 Ga0099794_10040883 3300007265 Unclassified 2206
136 Ga0111539_10000854 3300009094 Bacteria 39754
137 Ga0111539_10008244 3300009094 Bacteria 13264
138 Ga0111539_10032682 3300009094 Bacteria 6318
139 Ga0105247_10052334 3300009101 Bacteria 2517
140 Ga0105247_10096636 3300009101 Bacteria 1883
141 Ga0114129_10007320 3300009147 Bacteria 15708
142 Ga0114129_10039756 3300009147 Bacteria 6634
143 Ga0114129_10047173 3300009147 Bacteria 6055
144 Ga0114129_10056389 3300009147 Bacteria 5503
145 Ga0114129_10057835 3300009147 Bacteria 5425
146 Ga0114129_10070276 3300009147 Bacteria 4881
147 Ga0114129_10070469 3300009147 Bacteria 4875
148 Ga0114129_10125207 3300009147 Bacteria 3534
149 Ga0114129_10132912 3300009147 Unclassified 3416
150 Ga0114129_10161953 3300009147 Bacteria 3055
151 Ga0105243_10002826 3300009148 Bacteria 14404
152 Ga0105243_10018170 3300009148 Bacteria 5323
153 Ga0105241_10032759 3300009174 Bacteria 3899
154 Ga0105242_10041741 3300009176 Bacteria 3701
155 Ga0105242_10249574 3300009176 Bacteria 1598
156 Ga0105248_10009529 3300009177 Bacteria 10688
157 Ga0105248_10009922 3300009177 Bacteria 10484
158 Ga0105249_10128077 3300009553 Bacteria 2420
159 Ga0105239_10331345 3300010375 Bacteria 1717
160 Ga0157374_10000454 3300013296 Bacteria 37339
161 Ga0157378_10000009 3300013297 Bacteria 161557
162 Ga0157378_10029015 3300013297 Bacteria 4884
163 Ga0157372_10001184 3300013307 Bacteria 28212
164 Ga0163163_10028337 3300014325 Bacteria 5376
165 Ga0163163_10339837 3300014325 Bacteria 1556
166 Ga0157380_10016102 3300014326 Bacteria 5508
167 Ga0157380_10052416 3300014326 Bacteria 3231
168 Ga0157380_10083725 3300014326 Bacteria 2614
169 Ga0157380_10135730 3300014326 Bacteria 2105
170 Ga0157377_10065036 3300014745 Bacteria 2094
171 Ga0157379_10012877 3300014968 Bacteria 7316
172 Ga0163161_10220217 3300017792 Bacteria 1469
173 Ga0207642_10024564 3300025899 Bacteria 2424
174 Ga0207710_10038005 3300025900 Bacteria 2128
175 Ga0207688_10048874 3300025901 Bacteria 2363
176 Ga0207645_10006152 3300025907 Bacteria 8622
177 Ga0207645_10055779 3300025907 Bacteria 2523
178 Ga0207643_10090250 3300025908 Bacteria 1786
179 Ga0207684_10056855 3300025910 Bacteria 3319
180 Ga0207654_10015692 3300025911 Bacteria 3935
181 Ga0207662_10020217 3300025918 Bacteria 3798
182 Ga0207649_10062302 3300025920 Bacteria 2351
183 Ga0207652_10081139 3300025921 Bacteria 2837
184 Ga0207646_10037518 3300025922 Bacteria 4368
185 Ga0207646_10038764 3300025922 Bacteria 4290
186 Ga0207650_10007026 3300025925 Bacteria 7676
187 Ga0207659_10007988 3300025926 Bacteria 6541
188 Ga0207659_10107157 3300025926 Bacteria 2117
189 Ga0207700_10009779 3300025928 Bacteria 6014
190 Ga0207700_10224577 3300025928 Bacteria 1594
191 Ga0207664_10063734 3300025929 Bacteria 2947
192 Ga0207686_10035514 3300025934 Bacteria 2993
193 Ga0207686_10077035 3300025934 Bacteria 2164
194 Ga0207709_10036273 3300025935 Bacteria 2921
195 Ga0207709_10037870 3300025935 Bacteria 2868
196 Ga0207669_10056398 3300025937 Bacteria 2386
197 Ga0207704_10008904 3300025938 Bacteria 4821
198 Ga0207704_10127537 3300025938 Bacteria 1755
199 Ga0207704_10137813 3300025938 Unclassified 1702
200 Ga0207665_10000723 3300025939 Bacteria 22403
201 Ga0207665_10029325 3300025939 Unclassified 3637
202 Ga0207665_10034106 3300025939 Bacteria 3377
203 Ga0207691_10006717 3300025940 Bacteria 11092
204 Ga0207691_10044372 3300025940 Bacteria 4093
205 Ga0207711_10028823 3300025941 Bacteria 4676
206 Ga0207711_10167714 3300025941 Bacteria 1991
207 Ga0207689_10025412 3300025942 Bacteria 4964
208 Ga0207661_10059158 3300025944 Bacteria 3087
209 Ga0207679_10001856 3300025945 Bacteria 13125
210 Ga0207667_10027253 3300025949 Bacteria 6224
211 Ga0207640_10016614 3300025981 Bacteria 4286
212 Ga0207640_10018145 3300025981 Bacteria 4129
213 Ga0207640_10044789 3300025981 Bacteria 2837
214 Ga0207640_10150788 3300025981 Bacteria 1708
215 Ga0207677_10015251 3300026023 Bacteria 4513
216 Ga0207703_10013731 3300026035 Bacteria 6313
217 Ga0207703_10033683 3300026035 Bacteria 4063
218 Ga0207703_10056977 3300026035 Bacteria 3185
219 Ga0207678_10027336 3300026067 Bacteria 4975
220 Ga0207678_10144824 3300026067 Bacteria 2028
221 Ga0207708_10020382 3300026075 Bacteria 5001
222 Ga0207708_10030654 3300026075 Bacteria 4079
223 Ga0207708_10059740 3300026075 Bacteria 2910
224 Ga0207708_10090126 3300026075 Bacteria 2364
225 Ga0207708_10156527 3300026075 Bacteria 1797
226 Ga0207702_10013885 3300026078 Bacteria 6690
227 Ga0207641_10029698 3300026088 Bacteria 4522
228 Ga0207641_10155979 3300026088 Bacteria 2071
229 Ga0207641_10213158 3300026088 Bacteria 1787
230 Ga0207648_10026097 3300026089 Bacteria 5195
231 Ga0207648_10038748 3300026089 Bacteria 4193
232 Ga0207648_10068274 3300026089 Bacteria 3097
233 Ga0207648_10092387 3300026089 Bacteria 2646
234 Ga0207676_10015306 3300026095 Bacteria 5531
235 Ga0207674_10003692 3300026116 Bacteria 18684
236 Ga0207675_100001725 3300026118 Bacteria 21904
237 Ga0207675_100008054 3300026118 Bacteria 9930
238 Ga0207675_100028494 3300026118 Bacteria 5199
239 Ga0207675_100042486 3300026118 Bacteria 4245
240 Ga0207675_100058789 3300026118 Bacteria 3588
241 Ga0207675_100290966 3300026118 Bacteria 1589
242 Ga0207683_10011871 3300026121 Bacteria 7433
243 Ga0207698_10095649 3300026142 Bacteria 2446
244 Ga0209588_1018726 3300027671 Bacteria 2156
245 Ga0207428_10000139 3300027907 Bacteria 98277
246 Ga0207428_10004926 3300027907 Bacteria 12581
247 Ga0207428_10007918 3300027907 Bacteria 9658
248 Ga0207428_10049401 3300027907 Bacteria 3371
249 Ga0268265_10038075 3300028380 Bacteria 3535
250 Ga0268265_10103406 3300028380 Bacteria 2306
251 Ga0268265_10107027 3300028380 Bacteria 2273
252 Ga0268265_10226155 3300028380 Bacteria 1641
253 Ga0268264_10050247 3300028381 Bacteria 3471
254 Ga0268264_10084950 3300028381 Bacteria 2715
255 Ga0268264_10131259 3300028381 Bacteria 2221
256 Ga0307408_100094151 3300031548 Bacteria 2268
257 Ga0307407_10030082 3300031903 Bacteria 2926
258 Ga0373930_0000550 3300034816 Bacteria 5158
259 Ga0373948_0001876 3300034817 Bacteria 3006
260 Ga0373959_0002123 3300034820 Bacteria 3161
261 Ga0373928_0003932 3300035084 Bacteria 2834
262 Ga0373951_0000652 3300035091 Bacteria 9529
263 Ga0373952_0001770 3300035092 Bacteria 3928
264 Ga0373932_0013022 3300035112 Bacteria 2060
265 Ga0373939_0003893 3300035114 Bacteria 3511
266 Ga0373941_0000996 3300035115 Bacteria 5894
267 Ga0373960_0002023 3300035121 Bacteria 4556
268 Ga0373955_0124078 3300035172 Unclassified 1503
269 Ga0373961_0001166 3300035241 Bacteria 8205
270 Ga0373962_0003719 3300035242 Bacteria 3670
271 Ga0373931_0021615 3300035691 Bacteria 3228
272 Ga0373933_0011359 3300035724 Bacteria 4905
273 Ga0373933_0080592 3300035724 Bacteria 1996
274 Ga0373937_0001633 3300036401 Bacteria 18839
275 Ga0373937_0037842 3300036401 Bacteria 4397
276 Ga0373925_0038540 3300037068 Unclassified 3534
277 Ga0373925_0047397 3300037068 Bacteria 3199
278 Ga0395900_0207964 3300037418 Bacteria 1977
279 Ga0450920_009513 3300042122 Bacteria 1789
280 Ga0439464_0020914 3300042439 Bacteria 1794
281 Ga0451577_0083010 3300042876 Bacteria 2859
282 Ga0451576_0005675 3300045051 Bacteria 15576
283 Ga0451576_0167642 3300045051 Bacteria 2292
284 Ga0495638_0019962 3300046460 Bacteria 4430
285 Ga0495645_0003070 3300046543 Bacteria 11312
286 Ga0495635_0020353 3300046663 Bacteria 4623
287 Ga0495600_0032992 3300046809 Bacteria 3361
288 Ga0495636_0012583 3300047318 Bacteria 3351
289 Ga0495674_0026578 3300047319 Bacteria 5296
290 Ga0495684_0013740 3300047471 Bacteria 6233
291 Ga0496104_0011031 3300048907 Bacteria 8084
292 Ga0496106_0259650 3300048909 Bacteria 1390
293 Ga0496108_0019936 3300048911 Bacteria 5508
294 Ga0496109_0000438 3300048912 Bacteria 36175
295 Ga0496109_0116005 3300048912 Bacteria 2492
296 Ga0496112_0127104 3300048915 Bacteria 2519
297 Ga0496113_0038093 3300048916 Bacteria 3533
298 Ga0496114_0097920 3300048917 Bacteria 2500
299 Ga0501032_0019194 3300049569 Bacteria 4784
300 Ga0501033_0039725 3300049570 Bacteria 3515
301 Ga0501034_0012651 3300049571 Bacteria 8706
302 Ga0501046_0039131 3300049580 Bacteria 3800
303 Ga0501047_0000394 3300049581 Bacteria 49012
304 Ga0501047_0291956 3300049581 Bacteria 1474
305 Ga0501076_0003590 3300049592 Bacteria 10899
306 Ga0501079_0139266 3300049741 Bacteria 1890
307 Ga0501035_0000868 3300049822 Bacteria 32164
308 Ga0501044_0002614 3300049823 Bacteria 20462
309 Ga0501044_0026680 3300049823 Bacteria 6114
310 Ga0501045_0041105 3300049824 Bacteria 3364
311 Ga0501045_0058797 3300049824 Bacteria 2815
312 nmdc:mga00v17_3419_c1 3300050491 Bacteria 8205
313 nmdc:mga00v17_94647_c1 3300050491 Bacteria 1880
314 nmdc:mga0k408_255_c1 3300050493 Bacteria 29002
315 nmdc:mga06z11_35365_c1 3300050494 Bacteria 2458
316 nmdc:mga04h51_8172_c1 3300050495 Bacteria 2792
317 nmdc:mga05p37_139164_c1 3300050507 Bacteria 2975
318 nmdc:mga05p37_193320_c1 3300050507 Bacteria 2469
319 nmdc:mga05p37_245027_c1 3300050507 Bacteria 2152
320 nmdc:mga05p37_367982_c1 3300050507 Bacteria 1688
321 nmdc:mga05p37_45276_c1 3300050507 Bacteria 5413
322 nmdc:mga05p37_47949_c1 3300050507 Bacteria 5253
323 nmdc:mga05p37_58459_c1 3300050507 Bacteria 4749
324 nmdc:mga05p37_64412_c1 3300050507 Bacteria 4511
325 nmdc:mga05p37_68592_c1 3300050507 Bacteria 4361
326 nmdc:mga05p37_96993_c1 3300050507 Bacteria 3632
327 nmdc:mga09592_58655_c1 3300050508 Bacteria 3255
328 nmdc:mga06r32_204528_c1 3300050510 Bacteria 1962
329 nmdc:mga06r32_248741_c1 3300050510 Unclassified 1765
330 nmdc:mga08y16_146123_c1 3300050511 Bacteria 2458
331 nmdc:mga08y16_2005_c1 3300050511 Bacteria 20820
332 nmdc:mga08y16_58328_c1 3300050511 Bacteria 4034
333 nmdc:mga08y16_98259_c1 3300050511 Bacteria 3049
334 nmdc:mga0n895_15483_c1 3300050512 Bacteria 6954
335 nmdc:mga0n895_37965_c1 3300050512 Bacteria 4664
336 nmdc:mga0n895_66967_c1 3300050512 Bacteria 3556
337 nmdc:mga0rr50_127487_c1 3300050513 Bacteria 2034
338 nmdc:mga0rr50_18789_c1 3300050513 Bacteria 4651
339 nmdc:mga0rr50_973_c1 3300050513 Bacteria 15562
340 nmdc:mga0rr50_9872_c1 3300050513 Bacteria 6033
341 nmdc:mga08x19_31198_c1 3300050514 Bacteria 3351
342 nmdc:mga08x19_33761_c1 3300050514 Bacteria 3230
343 nmdc:mga0a205_175401_c1 3300050515 Bacteria 2039
344 nmdc:mga0a205_35944_c1 3300050515 Bacteria 4758
345 nmdc:mga0a205_58341_c1 3300050515 Bacteria 3728
346 Ga0495601_0010284 3300053077 Bacteria 5565
347 Ga0495601_0109179 3300053077 Bacteria 1791
348 Ga0495619_0001307 3300053085 Bacteria 16364
349 Ga0500641_0004434 3300053096 Bacteria 4965
350 Ga0500555_001095 3300053103 Bacteria 9006
351 Ga0500555_012161 3300053103 Bacteria 2475
352 Ga0500555_036618 3300053103 Unclassified 1376
353 Ga0500616_0000100 3300053153 Bacteria 173477
354 Ga0500645_000393 3300053730 Bacteria 30593
355 Ga0501084_0109922 3300054114 Bacteria 2316
356 Ga0590071_026473 3300059421 Bacteria 1376
357 Ga0501082_0041205 3300060353 Bacteria 3982
358 Ga0075428_100094593
359 Ga0065715_10008782
360 Ga0070676_10135879
361 Ga0070683_100009342
362 Ga0070690_100017707
363 Ga0070670_100020647
364 Ga0068869_100076183
365 Ga0070666_10120213
366 Ga0070682_100023032
367 Ga0068868_100185301
368 Ga0070689_100029645
369 Ga0070689_100091179
370 Ga0070687_100019338
371 Ga0070669_100010717
372 Ga0070669_100026877
373 Ga0070669_100065657
374 Ga0070675_100096406
375 Ga0070675_100117900
376 Ga0070674_100115953
377 Ga0070673_100065100
378 Ga0070688_100029556
379 Ga0070688_100033980
380 Ga0070688_100057576
381 Ga0070709_10059947
382 Ga0070709_10111539
383 Ga0070714_100046740
384 Ga0070713_100011313
385 Ga0070713_100106840
386 Ga0070701_10006289
387 Ga0070701_10012556
388 Ga0070705_100001588
389 Ga0070705_100020804
390 Ga0070705_100170381
391 Ga0070700_100027253
392 Ga0070694_100011307
393 Ga0070694_100016338
394 Ga0070708_100067824
395 Ga0070663_100044202
396 Ga0070678_100049847
397 Ga0070681_10032389
398 Ga0068867_100009183
399 Ga0068867_100018269
400 Ga0068867_100043458
401 Ga0068867_100261322
402 Ga0070685_10009493
403 Ga0070685_10019560
404 Ga0070706_100027578
405 Ga0070706_100069225
406 Ga0070707_100080592
407 Ga0070707_100155960
408 Ga0070698_100005450
409 Ga0070698_100016752
410 Ga0070698_100071402
411 Ga0070698_100222066
412 Ga0070699_100013952
413 Ga0070699_100021039
414 Ga0070697_100015145
415 Ga0070697_100101052
416 Ga0070672_100101053
417 Ga0070686_100000585
418 Ga0070695_100158651
419 Ga0070696_100009045
420 Ga0070696_100076544
421 Ga0070665_100038560
422 Ga0070704_100011973
423 Ga0070704_100034856
424 Ga0068855_100000432
425 Ga0070664_100000726
426 Ga0070664_100216034
427 Ga0068857_100000096
428 Ga0068854_100008909
429 Ga0068854_100014011
430 Ga0068854_100024664
431 Ga0068854_100084099
432 Ga0068856_100000179
433 Ga0070702_100021586
434 Ga0068859_100010599
435 Ga0068859_100067710
436 Ga0068859_100218261
437 Ga0068864_100000129
438 Ga0068864_100011905
439 Ga0068864_100073432
440 Ga0068866_10036529
441 Ga0068861_100002273
442 Ga0068861_100006006
443 Ga0068861_100068506
444 Ga0068861_100080405
445 Ga0068863_100027468
446 Ga0068863_100221253
447 Ga0068858_100049926
448 Ga0068858_100078606
449 Ga0068860_100027327
450 Ga0068860_100083493
451 Ga0068860_100322304
452 Ga0068862_100028697
453 Ga0068862_100039579
454 Ga0068862_100135736
455 Ga0081455_10008381
456 Ga0081455_10072397
457 Ga0081455_10087975
458 Ga0081539_10000386
459 Ga0081539_10088654
460 Ga0070717_10066500
461 Ga0070717_10182084
462 Ga0075368_10001781
463 Ga0075364_10006908
464 Ga0070716_100001179
465 Ga0075367_10007616
466 Ga0075367_10077138
467 Ga0097621_100002114
468 Ga0068871_100027217
469 Ga0075428_100046542
470 Ga0075428_100142991
471 Ga0075431_100070636
472 Ga0075431_100292759
473 Ga0075431_100406187
474 Ga0075433_10046593
475 Ga0075433_10096737
476 Ga0075434_100000167
477 Ga0075434_100067708
478 Ga0075434_100198363
479 Ga0068865_100195607
480 Ga0068865_100233254
481 Ga0075436_100011324
482 Ga0075436_100019691
483 Ga0075436_100109262
484 Ga0097620_100010599
485 Ga0097620_100067711
486 Ga0097620_100218261
487 Ga0075435_100002314
488 Ga0075435_100004630
489 Ga0075435_100007340
490 Ga0075435_100064947
491 Ga0099794_10007460
492 Ga0099794_10040883
493 Ga0111539_10000854
494 Ga0111539_10008244
495 Ga0111539_10032682
496 Ga0105247_10052334
497 Ga0105247_10096636
498 Ga0114129_10007320
499 Ga0114129_10039756
500 Ga0114129_10047173
501 Ga0114129_10056389
502 Ga0114129_10057835
503 Ga0114129_10070276
504 Ga0114129_10070469
505 Ga0114129_10125207
506 Ga0114129_10132912
507 Ga0114129_10161953
508 Ga0105243_10002826
509 Ga0105243_10018170
510 Ga0105241_10032759
511 Ga0105242_10041741
512 Ga0105242_10249574
513 Ga0105248_10009529
514 Ga0105248_10009922
515 Ga0105249_10128077
516 Ga0105239_10331345
517 Ga0157374_10000454
518 Ga0157378_10000009
519 Ga0157378_10029015
520 Ga0157372_10001184
521 Ga0163163_10028337
522 Ga0163163_10339837
523 Ga0157380_10016102
524 Ga0157380_10052416
525 Ga0157380_10083725
526 Ga0157380_10135730
527 Ga0157377_10065036
528 Ga0157379_10012877
529 Ga0163161_10220217
530 Ga0207642_10024564
531 Ga0207710_10038005
532 Ga0207688_10048874
533 Ga0207645_10006152
534 Ga0207645_10055779
535 Ga0207643_10090250
536 Ga0207684_10056855
537 Ga0207654_10015692
538 Ga0207662_10020217
539 Ga0207649_10062302
540 Ga0207652_10081139
541 Ga0207646_10037518
542 Ga0207646_10038764
543 Ga0207650_10007026
544 Ga0207659_10007988
545 Ga0207659_10107157
546 Ga0207700_10009779
547 Ga0207700_10224577
548 Ga0207664_10063734
549 Ga0207686_10035514
550 Ga0207686_10077035
551 Ga0207709_10036273
552 Ga0207709_10037870
553 Ga0207669_10056398
554 Ga0207704_10008904
555 Ga0207704_10127537
556 Ga0207704_10137813
557 Ga0207665_10000723
558 Ga0207665_10029325
559 Ga0207665_10034106
560 Ga0207691_10006717
561 Ga0207691_10044372
562 Ga0207711_10028823
563 Ga0207711_10167714
564 Ga0207689_10025412
565 Ga0207661_10059158
566 Ga0207679_10001856
567 Ga0207667_10027253
568 Ga0207640_10016614
569 Ga0207640_10018145
570 Ga0207640_10044789
571 Ga0207640_10150788
572 Ga0207677_10015251
573 Ga0207703_10013731
574 Ga0207703_10033683
575 Ga0207703_10056977
576 Ga0207678_10027336
577 Ga0207678_10144824
578 Ga0207708_10020382
579 Ga0207708_10030654
580 Ga0207708_10059740
581 Ga0207708_10090126
582 Ga0207708_10156527
583 Ga0207702_10013885
584 Ga0207641_10029698
585 Ga0207641_10155979
586 Ga0207641_10213158
587 Ga0207648_10026097
588 Ga0207648_10038748
589 Ga0207648_10068274
590 Ga0207648_10092387
591 Ga0207676_10015306
592 Ga0207674_10003692
593 Ga0207675_100001725
594 Ga0207675_100008054
595 Ga0207675_100028494
596 Ga0207675_100042486
597 Ga0207675_100058789
598 Ga0207675_100290966
599 Ga0207683_10011871
600 Ga0207698_10095649
601 Ga0209588_1018726
602 Ga0207428_10000139
603 Ga0207428_10004926
604 Ga0207428_10007918
605 Ga0207428_10049401
606 Ga0268265_10038075
607 Ga0268265_10103406
608 Ga0268265_10107027
609 Ga0268265_10226155
610 Ga0268264_10050247
611 Ga0268264_10084950
612 Ga0268264_10131259
613 Ga0307408_100094151
614 Ga0307407_10030082
615 Ga0373930_0000550
616 Ga0373948_0001876
617 Ga0373959_0002123
618 Ga0373928_0003932
619 Ga0373951_0000652
620 Ga0373952_0001770
621 Ga0373932_0013022
622 Ga0373939_0003893
623 Ga0373941_0000996
624 Ga0373960_0002023
625 Ga0373955_0124078
626 Ga0373961_0001166
627 Ga0373962_0003719
628 Ga0373931_0021615
629 Ga0373933_0011359
630 Ga0373933_0080592
631 Ga0373937_0001633
632 Ga0373937_0037842
633 Ga0373925_0038540
634 Ga0373925_0047397
635 Ga0395900_0207964
636 Ga0450920_009513
637 Ga0439464_0020914
638 Ga0451577_0083010
639 Ga0451576_0005675
640 Ga0451576_0167642
641 Ga0495638_0019962
642 Ga0495645_0003070
643 Ga0495635_0020353
644 Ga0495600_0032992
645 Ga0495636_0012583
646 Ga0495674_0026578
647 Ga0495684_0013740
648 Ga0496104_0011031
649 Ga0496106_0259650
650 Ga0496108_0019936
651 Ga0496109_0000438
652 Ga0496109_0116005
653 Ga0496112_0127104
654 Ga0496113_0038093
655 Ga0496114_0097920
656 Ga0501032_0019194
657 Ga0501033_0039725
658 Ga0501034_0012651
659 Ga0501046_0039131
660 Ga0501047_0000394
661 Ga0501047_0291956
662 Ga0501076_0003590
663 Ga0501079_0139266
664 Ga0501035_0000868
665 Ga0501044_0002614
666 Ga0501044_0026680
667 Ga0501045_0041105
668 Ga0501045_0058797
669 nmdc:mga00v17_3419_c1
670 nmdc:mga00v17_94647_c1
671 nmdc:mga0k408_255_c1
672 nmdc:mga06z11_35365_c1
673 nmdc:mga04h51_8172_c1
674 nmdc:mga05p37_139164_c1
675 nmdc:mga05p37_193320_c1
676 nmdc:mga05p37_245027_c1
677 nmdc:mga05p37_367982_c1
678 nmdc:mga05p37_45276_c1
679 nmdc:mga05p37_47949_c1
680 nmdc:mga05p37_58459_c1
681 nmdc:mga05p37_64412_c1
682 nmdc:mga05p37_68592_c1
683 nmdc:mga05p37_96993_c1
684 nmdc:mga09592_58655_c1
685 nmdc:mga06r32_204528_c1
686 nmdc:mga06r32_248741_c1
687 nmdc:mga08y16_146123_c1
688 nmdc:mga08y16_2005_c1
689 nmdc:mga08y16_58328_c1
690 nmdc:mga08y16_98259_c1
691 nmdc:mga0n895_15483_c1
692 nmdc:mga0n895_37965_c1
693 nmdc:mga0n895_66967_c1
694 nmdc:mga0rr50_127487_c1
695 nmdc:mga0rr50_18789_c1
696 nmdc:mga0rr50_973_c1
697 nmdc:mga0rr50_9872_c1
698 nmdc:mga08x19_31198_c1
699 nmdc:mga08x19_33761_c1
700 nmdc:mga0a205_175401_c1
701 nmdc:mga0a205_35944_c1
702 nmdc:mga0a205_58341_c1
703 Ga0495601_0010284
704 Ga0495601_0109179
705 Ga0495619_0001307
706 Ga0500641_0004434
707 Ga0500555_001095
708 Ga0500555_012161
709 Ga0500555_036618
710 Ga0500616_0000100
711 Ga0500645_000393
712 Ga0501084_0109922
713 Ga0590071_026473
714 Ga0501082_0041205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

266

450

0.91

PF07690

MFS_1

Major Facilitator Superfamily

62

325

0.85

PF00083

Sugar_tr

Sugar (and other) transporter

265

440

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g9x-assembly2.cif.gz_B crystal structure of a mfs transporter at 2.54 angstroem resolution 0.884 12 389
6zgs-assembly1.cif.gz_A crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution 0.8764 9 382
6g9x-assembly2.cif.gz_B crystal structure of a mfs transporter at 2.54 angstroem resolution 0.8727 12 389
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8725 12 386
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.8724 13 386
ID Description Score Start End Superfamily
af_Q8TF71_333_507_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9407 253 383 1.20.1250.20
af_Q8T043_601_868_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9383 206 382 1.20.1250.20
af_A0A1D8PQ72_272_455_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9341 208 383 1.20.1250.20
af_A0A0R4IK09_318_470_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9322 250 383 1.20.1250.20
af_F1QY19_223_417_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9296 208 385 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7V9CNT3-F1-model_v4 MFS transporter 0.9933 210 391 GO:0016020
GO:0022857
AF-A0A7V9CNT3-F1-model_v4 MFS transporter 0.9825 210 391 GO:0016020
GO:0022857
AF-A0A2V9BVG3-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9784 209 392 GO:0016020
GO:0022857
AF-A0A1Q7PVL2-F1-model_v4 MFS transporter 0.9365 118 392 GO:0016020
GO:0022857
AF-A0A1F3N5R7-F1-model_v4 MFS transporter 0.9311 5 355 GO:0016020
GO:0022857

Map