F420427

General Info

Members Datasets Scaffolds Average Seq Length
356 176 356 215

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100002022|Ga0068867_1000020223
Length 239
Sequence MPRGYLSHQTILLDSLKGTWHNSNMLANANDMRALVNLFHSGTKLTYSKGEFIIRPGESPPGVFYIEEGLVKAYDITKYGEENLLIIRKSGEMLGMTWGVTGQDRHIIYSALAPTQVWLVQRDNFIDFIRNHPSASLPIIDTLTNMYRVHSERIMTLEYRTVRERLISFLLTTARRFGETTPEGIRIGVPLKHQDIASSISATRETTSRALSELERKGHIKAEQSHITIIDEETLRTFL

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
69 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
122 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
157 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
158 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
161 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
164 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
165 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
166 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
167 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
168 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
169 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
170 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
171 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
172 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
173 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
176 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.44
Nodule 0
Rhizoplane 1.4
Rhizosphere 72.19
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000363 3300001915 Bacteria 13560
2 JGI24741J21665_1004600 3300001915 Bacteria 3024
3 JGI24740J21852_10002100 3300001979 Bacteria 9114
4 JGI24737J22298_10000003 3300001990 Bacteria 67128
5 JGI24742J22300_10000001 3300002244 Bacteria 61784
6 rootH1_10003673 3300003316 Bacteria 1724
7 rootH2_10000311 3300003320 Bacteria 277677
8 rootH2_10210293 3300003320 Bacteria 1725
9 rootH2_10253104 3300003320 Unclassified 3496
10 rootH1_10051165 3300003323 Bacteria 3041
11 Ga0065704_10223447 3300005289 Unclassified 1066
12 Ga0070658_10000660 3300005327 Bacteria 29772
13 Ga0070658_10002570 3300005327 Bacteria 15124
14 Ga0070658_10031963 3300005327 Bacteria 4230
15 Ga0070676_10000131 3300005328 Bacteria 28364
16 Ga0070683_100000239 3300005329 Bacteria 37590
17 Ga0070683_100000380 3300005329 Bacteria 30907
18 Ga0070683_100128692 3300005329 Unclassified 2395
19 Ga0070683_100471878 3300005329 Bacteria 1198
20 Ga0070690_100001023 3300005330 Bacteria 14301
21 Ga0070680_100231378 3300005336 Bacteria 1561
22 Ga0070682_100029398 3300005337 Unclassified 3309
23 Ga0070660_100219222 3300005339 Unclassified 1546
24 Ga0070689_100285641 3300005340 Bacteria 1370
25 Ga0070687_100087018 3300005343 Bacteria 1719
26 Ga0070661_100046897 3300005344 Unclassified 3161
27 Ga0070668_100310863 3300005347 Bacteria 1324
28 Ga0070671_100046727 3300005355 Bacteria 3600
29 Ga0070674_100171308 3300005356 Bacteria 1655
30 Ga0070674_100189714 3300005356 Unclassified 1580
31 Ga0070673_100010485 3300005364 Bacteria 6275
32 Ga0070667_100000503 3300005367 Bacteria 39598
33 Ga0070667_100009384 3300005367 Bacteria 8115
34 Ga0070714_100000277 3300005435 Bacteria 39221
35 Ga0070700_100160915 3300005441 Unclassified 1545
36 Ga0070663_100076629 3300005455 Bacteria 2446
37 Ga0070678_100001026 3300005456 Bacteria 14546
38 Ga0070678_100089324 3300005456 Bacteria 2358
39 Ga0070678_100135793 3300005456 Unclassified 1961
40 Ga0070681_10002091 3300005458 Bacteria 18140
41 Ga0068867_100002022 3300005459 Bacteria 14179
42 Ga0068867_100033552 3300005459 Bacteria 3718
43 Ga0070685_10003022 3300005466 Bacteria 8576
44 Ga0070685_10005597 3300005466 Bacteria 6373
45 Ga0070679_100043753 3300005530 Unclassified 4459
46 Ga0070679_100049549 3300005530 Unclassified 4183
47 Ga0070679_100227261 3300005530 Unclassified 1826
48 Ga0070679_100358831 3300005530 Bacteria 1405
49 Ga0070679_100840171 3300005530 Unclassified 861
50 Ga0070684_100000280 3300005535 Bacteria 35451
51 Ga0070684_100003029 3300005535 Bacteria 12528
52 Ga0070684_100949945 3300005535 Unclassified 806
53 Ga0068853_100059449 3300005539 Bacteria 3302
54 Ga0070672_100002279 3300005543 Bacteria 12117
55 Ga0070665_100035840 3300005548 Bacteria 4991
56 Ga0068855_100000001 3300005563 Bacteria 818777
57 Ga0068855_100067781 3300005563 Bacteria 4156
58 Ga0068855_100101815 3300005563 Bacteria 3306
59 Ga0068855_100196271 3300005563 Bacteria 2274
60 Ga0068855_100416483 3300005563 Bacteria 1470
61 Ga0068855_100636832 3300005563 Unclassified 1146
62 Ga0068855_100681099 3300005563 Bacteria 1102
63 Ga0068855_100896316 3300005563 Unclassified 937
64 Ga0068855_100939356 3300005563 Bacteria 912
65 Ga0070664_100275544 3300005564 Bacteria 1516
66 Ga0068857_100001306 3300005577 Bacteria 19580
67 Ga0068857_100012500 3300005577 Bacteria 7392
68 Ga0068857_100299707 3300005577 Bacteria 1482
69 Ga0068857_100340093 3300005577 Bacteria 1388
70 Ga0068856_100002238 3300005614 Bacteria 19969
71 Ga0068856_100035207 3300005614 Bacteria 4906
72 Ga0068856_100624931 3300005614 Unclassified 1098
73 Ga0068852_100266331 3300005616 Bacteria 1647
74 Ga0068863_100024442 3300005841 Bacteria 5761
75 Ga0068858_100011400 3300005842 Bacteria 8392
76 Ga0068860_101262007 3300005843 Bacteria 759
77 Ga0075365_10000007 3300006038 Bacteria 116889
78 Ga0075365_10020286 3300006038 Bacteria 4118
79 Ga0075368_10000026 3300006042 Bacteria 35367
80 Ga0075363_100000389 3300006048 Bacteria 13367
81 Ga0075364_10001296 3300006051 Bacteria 13454
82 Ga0075364_10001478 3300006051 Bacteria 12801
83 Ga0075364_10054374 3300006051 Bacteria 2618
84 Ga0075364_10674960 3300006051 Unclassified 705
85 Ga0075362_10000084 3300006177 Bacteria 25989
86 Ga0075362_10254546 3300006177 Unclassified 864
87 Ga0075367_10000268 3300006178 Bacteria 17938
88 Ga0075367_10004166 3300006178 Bacteria 7015
89 Ga0075367_10094449 3300006178 Bacteria 1823
90 Ga0075369_10000004 3300006186 Bacteria 154675
91 Ga0075369_10001191 3300006186 Bacteria 8804
92 Ga0075366_10000003 3300006195 Bacteria 114017
93 Ga0075366_10000015 3300006195 Bacteria 66498
94 Ga0075366_10000095 3300006195 Bacteria 35412
95 Ga0075366_10000406 3300006195 Bacteria 20104
96 Ga0075366_10010130 3300006195 Bacteria 5286
97 Ga0075366_10024504 3300006195 Bacteria 3519
98 Ga0097621_100000052 3300006237 Bacteria 60152
99 Ga0075370_10000286 3300006353 Bacteria 18095
100 Ga0075370_10077711 3300006353 Bacteria 1905
101 Ga0075370_10146965 3300006353 Unclassified 1380
102 Ga0075370_10158251 3300006353 Unclassified 1329
103 Ga0075370_10280158 3300006353 Unclassified 990
104 Ga0068871_100000006 3300006358 Bacteria 116822
105 Ga0068871_100165427 3300006358 Unclassified 1893
106 Ga0068871_100556480 3300006358 Bacteria 1039
107 Ga0075430_100016116 3300006846 Bacteria 6365
108 Ga0075430_100471213 3300006846 Bacteria 1036
109 Ga0075431_100792245 3300006847 Bacteria 921
110 Ga0105240_10000003 3300009093 Bacteria 1183681
111 Ga0105240_10008596 3300009093 Bacteria 14592
112 Ga0105240_10092220 3300009093 Bacteria 3699
113 Ga0105240_10272593 3300009093 Bacteria 1947
114 Ga0111539_10000377 3300009094 Bacteria 55154
115 Ga0105245_10000096 3300009098 Bacteria 84679
116 Ga0105245_10000127 3300009098 Bacteria 72844
117 Ga0105245_10055122 3300009098 Bacteria 3570
118 Ga0105245_10191934 3300009098 Bacteria 1957
119 Ga0105247_10082042 3300009101 Bacteria 2034
120 Ga0105243_10000001 3300009148 Bacteria 1156578
121 Ga0105241_10000009 3300009174 Bacteria 258876
122 Ga0105241_10001553 3300009174 Bacteria 17582
123 Ga0105241_10137533 3300009174 Bacteria 1985
124 Ga0105241_10137864 3300009174 Unclassified 1983
125 Ga0105241_10288533 3300009174 Unclassified 1404
126 Ga0105241_10376020 3300009174 Unclassified 1240
127 Ga0105241_10414990 3300009174 Bacteria 1183
128 Ga0105241_11180565 3300009174 Unclassified 724
129 Ga0105242_10000001 3300009176 Bacteria 574039
130 Ga0105242_10195901 3300009176 Bacteria 1792
131 Ga0105248_10020908 3300009177 Bacteria 7254
132 Ga0105248_10220874 3300009177 Bacteria 2133
133 Ga0105248_11267908 3300009177 Unclassified 833
134 Ga0105237_10217689 3300009545 Bacteria 1910
135 Ga0105237_11381565 3300009545 Unclassified 710
136 Ga0105238_10001584 3300009551 Bacteria 22783
137 Ga0105238_10733132 3300009551 Unclassified 1001
138 Ga0105249_10096796 3300009553 Bacteria 2770
139 Ga0105033_100111 3300009986 Bacteria 6242
140 Ga0105033_103143 3300009986 Unclassified 1383
141 Ga0105030_100079 3300009987 Bacteria 7247
142 Ga0105239_10018299 3300010375 Bacteria 7745
143 Ga0105239_10085519 3300010375 Bacteria 3476
144 Ga0157373_10000092 3300013100 Bacteria 74657
145 Ga0157371_10000207 3300013102 Bacteria 86226
146 Ga0157370_10047453 3300013104 Bacteria 4117
147 Ga0157370_10108353 3300013104 Bacteria 2598
148 Ga0157370_10676093 3300013104 Bacteria 943
149 Ga0157369_10000227 3300013105 Bacteria 77626
150 Ga0157369_10038909 3300013105 Bacteria 5199
151 Ga0157369_10146446 3300013105 Unclassified 2497
152 Ga0157369_11064439 3300013105 Unclassified 827
153 Ga0157374_10000014 3300013296 Bacteria 396846
154 Ga0157374_10000598 3300013296 Bacteria 31965
155 Ga0157374_10007139 3300013296 Bacteria 9516
156 Ga0157374_10330660 3300013296 Bacteria 1511
157 Ga0157378_10003734 3300013297 Bacteria 13496
158 Ga0157378_10113851 3300013297 Bacteria 2484
159 Ga0157372_10060763 3300013307 Unclassified 4228
160 Ga0157372_10066647 3300013307 Bacteria 4045
161 Ga0157372_10173028 3300013307 Bacteria 2498
162 Ga0163163_10000992 3300014325 Bacteria 24016
163 Ga0163163_10208933 3300014325 Bacteria 2001
164 Ga0163163_10587979 3300014325 Unclassified 1176
165 Ga0157377_10110775 3300014745 Unclassified 1650
166 Ga0157376_10000001 3300014969 Bacteria 842910
167 Ga0207645_10014711 3300025907 Bacteria 5224
168 Ga0207705_10003401 3300025909 Bacteria 12098
169 Ga0207705_10005488 3300025909 Bacteria 9484
170 Ga0207705_10043064 3300025909 Bacteria 3242
171 Ga0207654_10000002 3300025911 Bacteria 1460142
172 Ga0207654_10006035 3300025911 Bacteria 6091
173 Ga0207654_10022163 3300025911 Unclassified 3386
174 Ga0207654_10665915 3300025911 Bacteria 746
175 Ga0207707_10004376 3300025912 Bacteria 12482
176 Ga0207707_10006211 3300025912 Bacteria 10438
177 Ga0207707_10138956 3300025912 Unclassified 2124
178 Ga0207695_10000005 3300025913 Bacteria 1196715
179 Ga0207695_10031044 3300025913 Bacteria 5871
180 Ga0207695_10071376 3300025913 Bacteria 3547
181 Ga0207695_10164271 3300025913 Unclassified 2149
182 Ga0207695_10264843 3300025913 Bacteria 1615
183 Ga0207660_10052988 3300025917 Unclassified 2890
184 Ga0207660_10072505 3300025917 Unclassified 2508
185 Ga0207660_10357655 3300025917 Bacteria 1171
186 Ga0207660_10475794 3300025917 Bacteria 1012
187 Ga0207662_10115705 3300025918 Bacteria 1676
188 Ga0207652_10008527 3300025921 Bacteria 8250
189 Ga0207652_10018148 3300025921 Bacteria 5767
190 Ga0207652_10028453 3300025921 Bacteria 4663
191 Ga0207652_10056374 3300025921 Bacteria 3383
192 Ga0207652_10086456 3300025921 Unclassified 2749
193 Ga0207652_10096235 3300025921 Bacteria 2608
194 Ga0207652_10935796 3300025921 Unclassified 764
195 Ga0207694_10002474 3300025924 Bacteria 15034
196 Ga0207694_10125487 3300025924 Bacteria 2053
197 Ga0207694_10545907 3300025924 Unclassified 972
198 Ga0207687_10000008 3300025927 Bacteria 497738
199 Ga0207687_10000107 3300025927 Bacteria 60194
200 Ga0207687_10171597 3300025927 Bacteria 1673
201 Ga0207687_10496361 3300025927 Bacteria 1018
202 Ga0207664_10005367 3300025929 Bacteria 8759
203 Ga0207644_10056105 3300025931 Bacteria 2842
204 Ga0207686_10000001 3300025934 Bacteria 1169580
205 Ga0207709_10000002 3300025935 Bacteria 1171536
206 Ga0207669_10091625 3300025937 Bacteria 1980
207 Ga0207669_10286846 3300025937 Bacteria 1244
208 Ga0207691_10008435 3300025940 Bacteria 9894
209 Ga0207711_10972452 3300025941 Unclassified 788
210 Ga0207661_10001467 3300025944 Bacteria 15941
211 Ga0207661_10002072 3300025944 Bacteria 13787
212 Ga0207661_10212607 3300025944 Bacteria 1705
213 Ga0207661_10685443 3300025944 Unclassified 942
214 Ga0207679_10233662 3300025945 Bacteria 1554
215 Ga0207667_10000003 3300025949 Bacteria 822935
216 Ga0207667_10000278 3300025949 Bacteria 70630
217 Ga0207667_10069158 3300025949 Unclassified 3675
218 Ga0207667_10248932 3300025949 Bacteria 1818
219 Ga0207667_10283251 3300025949 Bacteria 1693
220 Ga0207667_10365611 3300025949 Bacteria 1471
221 Ga0207667_10405009 3300025949 Bacteria 1389
222 Ga0207651_10001510 3300025960 Bacteria 10615
223 Ga0207712_10005969 3300025961 Bacteria 7682
224 Ga0207712_11028970 3300025961 Bacteria 731
225 Ga0207668_10111316 3300025972 Bacteria 2055
226 Ga0207668_10301014 3300025972 Bacteria 1323
227 Ga0207658_10013248 3300025986 Bacteria 5631
228 Ga0207658_10027781 3300025986 Unclassified 3979
229 Ga0207703_10007911 3300026035 Bacteria 8407
230 Ga0207639_10205968 3300026041 Bacteria 1690
231 Ga0207639_10745681 3300026041 Bacteria 910
232 Ga0207678_11090073 3300026067 Bacteria 707
233 Ga0207708_10484155 3300026075 Unclassified 1035
234 Ga0207702_10001968 3300026078 Bacteria 19973
235 Ga0207702_10025440 3300026078 Bacteria 4913
236 Ga0207702_10175333 3300026078 Bacteria 1970
237 Ga0207641_10017902 3300026088 Bacteria 5804
238 Ga0207648_10048051 3300026089 Bacteria 3738
239 Ga0207648_10049288 3300026089 Bacteria 3686
240 Ga0207674_10002189 3300026116 Bacteria 24731
241 Ga0207674_10090196 3300026116 Bacteria 3057
242 Ga0207674_10118814 3300026116 Bacteria 2613
243 Ga0207674_10182856 3300026116 Bacteria 2047
244 Ga0207674_10368662 3300026116 Bacteria 1388
245 Ga0207674_10430018 3300026116 Bacteria 1276
246 Ga0207683_10003903 3300026121 Bacteria 12921
247 Ga0207683_10023491 3300026121 Bacteria 5305
248 Ga0207683_10160205 3300026121 Bacteria 2034
249 Ga0207698_10023267 3300026142 Bacteria 4325
250 Ga0209813_10000003 3300027866 Bacteria 207060
251 Ga0207428_10021580 3300027907 Bacteria 5450
252 Ga0268266_10046816 3300028379 Bacteria 3702
253 Ga0268264_10501831 3300028381 Bacteria 1183
254 Ga0265337_1000048 3300028556 Bacteria 53749
255 Ga0265319_1007955 3300028563 Bacteria 4699
256 Ga0265334_10000041 3300028573 Bacteria 98258
257 Ga0265322_10026946 3300028654 Bacteria 1642
258 Ga0265338_10000268 3300028800 Bacteria 95143
259 Ga0265338_10000368 3300028800 Bacteria 80896
260 Ga0265338_10000462 3300028800 Bacteria 72395
261 Ga0265338_10002586 3300028800 Bacteria 26752
262 Ga0265338_10006564 3300028800 Bacteria 14767
263 Ga0265338_10009618 3300028800 Bacteria 11484
264 Ga0265338_10014791 3300028800 Bacteria 8637
265 Ga0265338_10015083 3300028800 Bacteria 8527
266 Ga0265338_10068684 3300028800 Bacteria 3051
267 Ga0265338_10362470 3300028800 Unclassified 1040
268 Ga0265320_10007451 3300031240 Bacteria 6789
269 Ga0265340_10000084 3300031247 Bacteria 44441
270 Ga0265327_10031390 3300031251 Unclassified 2985
271 Ga0265327_10133895 3300031251 Unclassified 1164
272 Ga0265316_10103158 3300031344 Bacteria 2165
273 Ga0265316_10156307 3300031344 Bacteria 1706
274 Ga0265314_10029367 3300031711 Bacteria 4088
275 Ga0307516_10251599 3300031730 Bacteria 1461
276 Ga0395900_0004483 3300037418 Bacteria 14787
277 Ga0395900_0439699 3300037418 Bacteria 1262
278 Ga0395898_0025835 3300037466 Bacteria 5913
279 Ga0395905_0000604 3300037471 Bacteria 48071
280 Ga0395905_0166447 3300037471 Bacteria 2072
281 Ga0395901_0000815 3300038443 Bacteria 34538
282 Ga0466960_0277917 3300044901 Unclassified 938
283 Ga0495588_0000594 3300046674 Bacteria 17175
284 Ga0495649_0000209 3300046694 Bacteria 51400
285 Ga0496100_0247962 3300048903 Unclassified 1316
286 Ga0496105_0244534 3300048908 Bacteria 1455
287 Ga0496109_0199362 3300048912 Bacteria 1882
288 Ga0496112_0003788 3300048915 Bacteria 12635
289 Ga0496112_0567564 3300048915 Bacteria 1068
290 Ga0496126_0448092 3300048929 Bacteria 1039
291 Ga0501046_0507007 3300049580 Unclassified 864
292 Ga0501073_0084531 3300049589 Bacteria 2208
293 Ga0501080_0000007 3300049742 Bacteria 135749
294 nmdc:mga03683_226362_c1 3300050489 Unclassified 864
295 nmdc:mga03683_43_c2 3300050489 Bacteria 43939
296 nmdc:mga03n38_12688_c1 3300050490 Bacteria 3179
297 nmdc:mga03n38_49_c1 3300050490 Bacteria 25851
298 nmdc:mga00v17_1326_c1 3300050491 Bacteria 12961
299 nmdc:mga00v17_1469_c1 3300050491 Bacteria 12340
300 nmdc:mga00v17_45299_c1 3300050491 Bacteria 2657
301 nmdc:mga0yw44_51866_c1 3300050492 Unclassified 2485
302 nmdc:mga0yw44_7_c1 3300050492 Bacteria 260877
303 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
304 nmdc:mga0k408_32_c1 3300050493 Bacteria 81544
305 nmdc:mga0k408_4338_c1 3300050493 Bacteria 7533
306 nmdc:mga0k408_498_c1 3300050493 Bacteria 21546
307 nmdc:mga0k408_54_c1 3300050493 Bacteria 57640
308 nmdc:mga0k408_9284_c1 3300050493 Bacteria 5300
309 nmdc:mga06z11_185034_c1 3300050494 Bacteria 1203
310 nmdc:mga06z11_867_c1 3300050494 Bacteria 11036
311 nmdc:mga06z11_92_c1 3300050494 Bacteria 38165
312 nmdc:mga04h51_3_c1 3300050495 Bacteria 207078
313 nmdc:mga07m45_138309_c1 3300050496 Unclassified 1410
314 nmdc:mga07m45_269745_c1 3300050496 Unclassified 990
315 nmdc:mga07m45_3648_c3 3300050496 Bacteria 3803
316 nmdc:mga07m45_99105_c1 3300050496 Bacteria 1673
317 nmdc:mga0qj67_17829_c1 3300050509 Bacteria 5401
318 nmdc:mga06r32_774555_c1 3300050510 Bacteria 921
319 nmdc:mga08y16_287_c1 3300050511 Bacteria 45722
320 nmdc:mga0sz30_10_c2 3300050516 Bacteria 32861
321 nmdc:mga0sz30_123905_c1 3300050516 Bacteria 1136
322 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
323 nmdc:mga0sz30_93526_c1 3300050516 Bacteria 1309
324 Ga0500610_0000009 3300053079 Bacteria 105876
325 Ga0500643_000009 3300053087 Bacteria 444150
326 Ga0500643_002224 3300053087 Bacteria 10249
327 Ga0500643_066208 3300053087 Bacteria 1007
328 Ga0500644_0000137 3300053088 Bacteria 45112
329 Ga0500644_0001390 3300053088 Bacteria 6453
330 Ga0500644_0002619 3300053088 Bacteria 4493
331 Ga0500646_0020600 3300053090 Bacteria 1752
332 Ga0500583_0000119 3300053092 Bacteria 37999
333 Ga0500583_0011566 3300053092 Bacteria 3332
334 Ga0500583_0107485 3300053092 Bacteria 1371
335 Ga0500651_0000235 3300053093 Bacteria 34448
336 Ga0500651_0004713 3300053093 Bacteria 7686
337 Ga0500651_0024508 3300053093 Unclassified 3783
338 Ga0500650_0000003 3300053098 Bacteria 164144
339 Ga0500555_000001 3300053103 Bacteria 1353713
340 Ga0500555_000002 3300053103 Bacteria 1314346
341 Ga0500562_035551 3300053108 Bacteria 1320
342 Ga0500594_0000001 3300053118 Bacteria 1178472
343 Ga0500594_0000019 3300053118 Bacteria 56688
344 Ga0500614_000001 3300053123 Bacteria 1274484
345 Ga0500614_000913 3300053123 Bacteria 7432
346 Ga0500628_000005 3300053129 Bacteria 201423
347 Ga0500628_021871 3300053129 Bacteria 1302
348 Ga0500652_000012 3300053131 Bacteria 155076
349 Ga0500577_0000143 3300053142 Bacteria 17463
350 Ga0500577_0025312 3300053142 Unclassified 2006
351 Ga0500579_002247 3300053143 Bacteria 11390
352 Ga0500589_000003 3300053147 Bacteria 220717
353 Ga0500604_0022291 3300053151 Bacteria 1796
354 Ga0500616_0000005 3300053153 Bacteria 961725
355 Ga0500649_000006 3300053722 Bacteria 116211
356 Ga0500611_003643 3300053727 Bacteria 1996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005441 Ga0070700_100160915 Ga0070700_1001609152 195
2 3300005563 Ga0068855_100196271 Ga0068855_1001962711 195
3 3300006186 Ga0075369_10000004 Ga0075369_10000004107 195
4 3300025937 Ga0207669_10091625 Ga0207669_100916252 195
5 3300026116 Ga0207674_10182856 Ga0207674_101828562 195
6 3300005337 Ga0070682_100029398 Ga0070682_1000293984 199
7 3300005455 Ga0070663_100076629 Ga0070663_1000766293 199
8 3300005456 Ga0070678_100089324 Ga0070678_1000893243 199
9 3300005563 Ga0068855_100681099 Ga0068855_1006810992 199
10 3300009174 Ga0105241_10414990 Ga0105241_104149901 199
11 3300025949 Ga0207667_10405009 Ga0207667_104050092 199
12 3300013307 Ga0157372_10060763 Ga0157372_100607633 202
13 3300025961 Ga0207712_11028970 Ga0207712_110289701 202
14 3300050509 nmdc:mga0qj67_17829_c1 nmdc:mga0qj67_17829_c1_1311_1922 203
15 3300050510 nmdc:mga06r32_774555_c1 nmdc:mga06r32_774555_c1_131_742 203
16 3300005329 Ga0070683_100128692 Ga0070683_1001286923 204
17 3300005329 Ga0070683_100471878 Ga0070683_1004718781 204
18 3300013307 Ga0157372_10173028 Ga0157372_101730283 204
19 3300025944 Ga0207661_10212607 Ga0207661_102126072 204
20 3300026078 Ga0207702_10175333 Ga0207702_101753333 204
21 3300003320 rootH2_10210293 rootH2_102102932 205
22 3300028654 Ga0265322_10026946 Ga0265322_100269461 206
23 3300028800 Ga0265338_10006564 Ga0265338_1000656417 206
24 3300031251 Ga0265327_10031390 Ga0265327_100313903 206
25 3300031344 Ga0265316_10156307 Ga0265316_101563073 206
26 3300009545 Ga0105237_11381565 Ga0105237_113815651 207
27 3300005327 Ga0070658_10000660 Ga0070658_1000066028 208
28 3300005356 Ga0070674_100171308 Ga0070674_1001713082 208
29 3300005364 Ga0070673_100010485 Ga0070673_10001048510 208
30 3300005456 Ga0070678_100001026 Ga0070678_10000102611 208
31 3300005466 Ga0070685_10003022 Ga0070685_100030221 208
32 3300005530 Ga0070679_100049549 Ga0070679_1000495493 208
33 3300005577 Ga0068857_100299707 Ga0068857_1002997071 208
34 3300005842 Ga0068858_100011400 Ga0068858_1000114003 208
35 3300025909 Ga0207705_10003401 Ga0207705_100034013 208
36 3300025921 Ga0207652_10056374 Ga0207652_100563743 208
37 3300026035 Ga0207703_10007911 Ga0207703_1000791112 208
38 3300003320 rootH2_10000311 rootH2_10000311271 209
39 3300005339 Ga0070660_100219222 Ga0070660_1002192222 209
40 3300005344 Ga0070661_100046897 Ga0070661_1000468974 209
41 3300005530 Ga0070679_100358831 Ga0070679_1003588312 209
42 3300005530 Ga0070679_100840171 Ga0070679_1008401711 209
43 3300005563 Ga0068855_100067781 Ga0068855_1000677816 209
44 3300005563 Ga0068855_100636832 Ga0068855_1006368321 209
45 3300005577 Ga0068857_100001306 Ga0068857_1000013064 209
46 3300005577 Ga0068857_100012500 Ga0068857_10001250012 209
47 3300005616 Ga0068852_100266331 Ga0068852_1002663311 209
48 3300009093 Ga0105240_10272593 Ga0105240_102725932 209
49 3300009551 Ga0105238_10733132 Ga0105238_107331321 209
50 3300013104 Ga0157370_10047453 Ga0157370_100474535 209
51 3300013105 Ga0157369_10038909 Ga0157369_100389095 209
52 3300025912 Ga0207707_10006211 Ga0207707_100062112 209
53 3300025912 Ga0207707_10138956 Ga0207707_101389562 209
54 3300025913 Ga0207695_10071376 Ga0207695_100713763 209
55 3300025913 Ga0207695_10264843 Ga0207695_102648432 209
56 3300025917 Ga0207660_10052988 Ga0207660_100529882 209
57 3300025917 Ga0207660_10072505 Ga0207660_100725052 209
58 3300025921 Ga0207652_10008527 Ga0207652_100085273 209
59 3300025921 Ga0207652_10086456 Ga0207652_100864562 209
60 3300025921 Ga0207652_10096235 Ga0207652_100962353 209
61 3300025924 Ga0207694_10545907 Ga0207694_105459071 209
62 3300025949 Ga0207667_10069158 Ga0207667_100691583 209
63 3300025949 Ga0207667_10248932 Ga0207667_102489322 209
64 3300026041 Ga0207639_10205968 Ga0207639_102059682 209
65 3300026116 Ga0207674_10002189 Ga0207674_1000218921 209
66 3300026116 Ga0207674_10118814 Ga0207674_101188143 209
67 3300026142 Ga0207698_10023267 Ga0207698_100232674 209
68 3300005530 Ga0070679_100227261 Ga0070679_1002272612 210
69 3300009098 Ga0105245_10000096 Ga0105245_1000009636 210
70 3300009174 Ga0105241_10001553 Ga0105241_1000155317 210
71 3300009174 Ga0105241_10137864 Ga0105241_101378642 210
72 3300009174 Ga0105241_11180565 Ga0105241_111805651 210
73 3300009551 Ga0105238_10001584 Ga0105238_100015849 210
74 3300009553 Ga0105249_10096796 Ga0105249_100967962 210
75 3300013296 Ga0157374_10000014 Ga0157374_10000014376 210
76 3300025911 Ga0207654_10022163 Ga0207654_100221633 210
77 3300025921 Ga0207652_10028453 Ga0207652_100284535 210
78 3300025924 Ga0207694_10002474 Ga0207694_100024748 210
79 3300003323 rootH1_10051165 rootH1_100511653 215
80 3300005327 Ga0070658_10002570 Ga0070658_1000257018 215
81 3300005327 Ga0070658_10031963 Ga0070658_100319633 215
82 3300005336 Ga0070680_100231378 Ga0070680_1002313782 215
83 3300005347 Ga0070668_100310863 Ga0070668_1003108632 215
84 3300005355 Ga0070671_100046727 Ga0070671_1000467271 215
85 3300005356 Ga0070674_100189714 Ga0070674_1001897142 215
86 3300005367 Ga0070667_100009384 Ga0070667_1000093845 215
87 3300005435 Ga0070714_100000277 Ga0070714_10000027713 215
88 3300005459 Ga0068867_100002022 Ga0068867_1000020223 215
89 3300005459 Ga0068867_100033552 Ga0068867_1000335523 215
90 3300005466 Ga0070685_10005597 Ga0070685_100055979 215
91 3300005530 Ga0070679_100043753 Ga0070679_1000437531 215
92 3300005539 Ga0068853_100059449 Ga0068853_1000594491 215
93 3300005543 Ga0070672_100002279 Ga0070672_10000227913 215
94 3300005548 Ga0070665_100035840 Ga0070665_1000358405 215
95 3300005563 Ga0068855_100101815 Ga0068855_1001018152 215
96 3300005563 Ga0068855_100939356 Ga0068855_1009393562 215
97 3300005614 Ga0068856_100035207 Ga0068856_1000352074 215
98 3300005614 Ga0068856_100624931 Ga0068856_1006249311 215
99 3300005841 Ga0068863_100024442 Ga0068863_1000244425 215
100 3300006358 Ga0068871_100165427 Ga0068871_1001654272 215
101 3300006358 Ga0068871_100556480 Ga0068871_1005564801 215
102 3300009093 Ga0105240_10000003 Ga0105240_1000000367 215
103 3300009093 Ga0105240_10092220 Ga0105240_100922202 215
104 3300009098 Ga0105245_10000127 Ga0105245_1000012734 215
105 3300009101 Ga0105247_10082042 Ga0105247_100820423 215
106 3300009148 Ga0105243_10000001 Ga0105243_100000011183 215
107 3300009174 Ga0105241_10137533 Ga0105241_101375332 215
108 3300009174 Ga0105241_10288533 Ga0105241_102885332 215
109 3300009174 Ga0105241_10376020 Ga0105241_103760202 215
110 3300009176 Ga0105242_10000001 Ga0105242_1000000174 215
111 3300009176 Ga0105242_10195901 Ga0105242_101959012 215
112 3300009177 Ga0105248_10020908 Ga0105248_100209082 215
113 3300009177 Ga0105248_11267908 Ga0105248_112679081 215
114 3300009545 Ga0105237_10217689 Ga0105237_102176892 215
115 3300010375 Ga0105239_10018299 Ga0105239_100182998 215
116 3300010375 Ga0105239_10085519 Ga0105239_100855193 215
117 3300013104 Ga0157370_10108353 Ga0157370_101083533 215
118 3300013105 Ga0157369_11064439 Ga0157369_110644391 215
119 3300013296 Ga0157374_10000598 Ga0157374_1000059821 215
120 3300013296 Ga0157374_10007139 Ga0157374_1000713913 215
121 3300013297 Ga0157378_10003734 Ga0157378_1000373413 215
122 3300013297 Ga0157378_10113851 Ga0157378_101138512 215
123 3300013307 Ga0157372_10066647 Ga0157372_100666473 215
124 3300014325 Ga0163163_10000992 Ga0163163_1000099222 215
125 3300014325 Ga0163163_10587979 Ga0163163_105879791 215
126 3300014745 Ga0157377_10110775 Ga0157377_101107752 215
127 3300014969 Ga0157376_10000001 Ga0157376_10000001844 215
128 3300025909 Ga0207705_10005488 Ga0207705_100054885 215
129 3300025909 Ga0207705_10043064 Ga0207705_100430643 215
130 3300025911 Ga0207654_10665915 Ga0207654_106659151 215
131 3300025913 Ga0207695_10000005 Ga0207695_1000000574 215
132 3300025913 Ga0207695_10164271 Ga0207695_101642712 215
133 3300025917 Ga0207660_10357655 Ga0207660_103576552 215
134 3300025921 Ga0207652_10018148 Ga0207652_1001814812 215
135 3300025921 Ga0207652_10935796 Ga0207652_109357961 215
136 3300025924 Ga0207694_10125487 Ga0207694_101254873 215
137 3300025927 Ga0207687_10000107 Ga0207687_1000010748 215
138 3300025927 Ga0207687_10496361 Ga0207687_104963611 215
139 3300025929 Ga0207664_10005367 Ga0207664_100053676 215
140 3300025931 Ga0207644_10056105 Ga0207644_100561051 215
141 3300025934 Ga0207686_10000001 Ga0207686_100000011216 215
142 3300025935 Ga0207709_10000002 Ga0207709_1000000274 215
143 3300025937 Ga0207669_10286846 Ga0207669_102868461 215
144 3300025940 Ga0207691_10008435 Ga0207691_100084358 215
145 3300025941 Ga0207711_10972452 Ga0207711_109724521 215
146 3300025949 Ga0207667_10000278 Ga0207667_100002789 215
147 3300025949 Ga0207667_10283251 Ga0207667_102832512 215
148 3300025960 Ga0207651_10001510 Ga0207651_100015108 215
149 3300025972 Ga0207668_10111316 Ga0207668_101113162 215
150 3300025972 Ga0207668_10301014 Ga0207668_103010142 215
151 3300025986 Ga0207658_10027781 Ga0207658_100277816 215
152 3300026041 Ga0207639_10745681 Ga0207639_107456811 215
153 3300026078 Ga0207702_10025440 Ga0207702_100254404 215
154 3300026088 Ga0207641_10017902 Ga0207641_100179025 215
155 3300026089 Ga0207648_10048051 Ga0207648_100480514 215
156 3300026089 Ga0207648_10049288 Ga0207648_100492882 215
157 3300026116 Ga0207674_10090196 Ga0207674_100901962 215
158 3300026121 Ga0207683_10003903 Ga0207683_100039037 215
159 3300028379 Ga0268266_10046816 Ga0268266_100468164 215
160 3300028381 Ga0268264_10501831 Ga0268264_105018312 215
161 3300028556 Ga0265337_1000048 Ga0265337_100004860 215
162 3300028563 Ga0265319_1007955 Ga0265319_10079553 215
163 3300028573 Ga0265334_10000041 Ga0265334_1000004122 215
164 3300028800 Ga0265338_10000268 Ga0265338_1000026858 215
165 3300028800 Ga0265338_10000368 Ga0265338_1000036857 215
166 3300028800 Ga0265338_10000462 Ga0265338_1000046254 215
167 3300028800 Ga0265338_10002586 Ga0265338_100025861 215
168 3300028800 Ga0265338_10009618 Ga0265338_100096183 215
169 3300028800 Ga0265338_10014791 Ga0265338_100147915 215
170 3300028800 Ga0265338_10015083 Ga0265338_1001508311 215
171 3300028800 Ga0265338_10068684 Ga0265338_100686841 215
172 3300028800 Ga0265338_10362470 Ga0265338_103624702 215
173 3300031240 Ga0265320_10007451 Ga0265320_100074513 215
174 3300031247 Ga0265340_10000084 Ga0265340_1000008412 215
175 3300031251 Ga0265327_10133895 Ga0265327_101338952 215
176 3300031344 Ga0265316_10103158 Ga0265316_101031583 215
177 3300031711 Ga0265314_10029367 Ga0265314_100293675 215
178 3300037418 Ga0395900_0004483 Ga0395900_0004483_5072_5719 215
179 3300037418 Ga0395900_0439699 Ga0395900_0439699_130_780 215
180 3300037466 Ga0395898_0025835 Ga0395898_0025835_2754_3401 215
181 3300037471 Ga0395905_0000604 Ga0395905_0000604_38958_39611 215
182 3300037471 Ga0395905_0166447 Ga0395905_0166447_861_1529 215
183 3300038443 Ga0395901_0000815 Ga0395901_0000815_21991_22641 215
184 3300048903 Ga0496100_0247962 Ga0496100_0247962_509_1159 215
185 3300048908 Ga0496105_0244534 Ga0496105_0244534_282_929 215
186 3300048912 Ga0496109_0199362 Ga0496109_0199362_186_833 215
187 3300048915 Ga0496112_0003788 Ga0496112_0003788_3222_3869 215
188 3300049589 Ga0501073_0084531 Ga0501073_0084531_1264_1911 215
189 3300049742 Ga0501080_0000007 Ga0501080_0000007_97792_98439 215
190 3300053087 Ga0500643_000009 Ga0500643_000009_164804_165451 215
191 3300053087 Ga0500643_066208 Ga0500643_066208_319_966 215
192 3300053093 Ga0500651_0000235 Ga0500651_0000235_27152_27799 215
193 3300053093 Ga0500651_0004713 Ga0500651_0004713_90_737 215
194 3300053123 Ga0500614_000913 Ga0500614_000913_4215_4862 215
195 3300053153 Ga0500616_0000005 Ga0500616_0000005_797200_797847 215
196 3300003316 rootH1_10003673 rootH1_100036732 216
197 3300003320 rootH2_10253104 rootH2_102531044 216
198 3300005289 Ga0065704_10223447 Ga0065704_102234471 216
199 3300005329 Ga0070683_100000380 Ga0070683_10000038022 216
200 3300005330 Ga0070690_100001023 Ga0070690_1000010235 216
201 3300005340 Ga0070689_100285641 Ga0070689_1002856412 216
202 3300005343 Ga0070687_100087018 Ga0070687_1000870182 216
203 3300005367 Ga0070667_100000503 Ga0070667_10000050310 216
204 3300005456 Ga0070678_100135793 Ga0070678_1001357932 216
205 3300005458 Ga0070681_10002091 Ga0070681_100020912 216
206 3300005535 Ga0070684_100000280 Ga0070684_10000028011 216
207 3300005535 Ga0070684_100949945 Ga0070684_1009499451 216
208 3300005563 Ga0068855_100000001 Ga0068855_100000001832 216
209 3300005563 Ga0068855_100896316 Ga0068855_1008963162 216
210 3300005564 Ga0070664_100275544 Ga0070664_1002755442 216
211 3300006038 Ga0075365_10000007 Ga0075365_1000000758 216
212 3300006038 Ga0075365_10020286 Ga0075365_100202863 216
213 3300006042 Ga0075368_10000026 Ga0075368_1000002618 216
214 3300006048 Ga0075363_100000389 Ga0075363_10000038914 216
215 3300006051 Ga0075364_10001296 Ga0075364_100012965 216
216 3300006051 Ga0075364_10001478 Ga0075364_1000147812 216
217 3300006177 Ga0075362_10000084 Ga0075362_100000842 216
218 3300006177 Ga0075362_10254546 Ga0075362_102545461 216
219 3300006178 Ga0075367_10000268 Ga0075367_100002687 216
220 3300006178 Ga0075367_10094449 Ga0075367_100944493 216
221 3300006186 Ga0075369_10001191 Ga0075369_100011912 216
222 3300006195 Ga0075366_10000003 Ga0075366_1000000385 216
223 3300006195 Ga0075366_10000015 Ga0075366_1000001551 216
224 3300006195 Ga0075366_10000406 Ga0075366_1000040616 216
225 3300006195 Ga0075366_10024504 Ga0075366_100245043 216
226 3300006353 Ga0075370_10000286 Ga0075370_1000028615 216
227 3300006353 Ga0075370_10077711 Ga0075370_100777112 216
228 3300006353 Ga0075370_10146965 Ga0075370_101469652 216
229 3300006353 Ga0075370_10158251 Ga0075370_101582511 216
230 3300006353 Ga0075370_10280158 Ga0075370_102801582 216
231 3300006846 Ga0075430_100016116 Ga0075430_1000161165 216
232 3300006846 Ga0075430_100471213 Ga0075430_1004712131 216
233 3300006847 Ga0075431_100792245 Ga0075431_1007922451 216
234 3300009094 Ga0111539_10000377 Ga0111539_100003773 216
235 3300009098 Ga0105245_10055122 Ga0105245_100551222 216
236 3300009098 Ga0105245_10191934 Ga0105245_101919341 216
237 3300009177 Ga0105248_10220874 Ga0105248_102208742 216
238 3300009987 Ga0105030_100079 Ga0105030_1000795 216
239 3300013102 Ga0157371_10000207 Ga0157371_1000020730 216
240 3300013104 Ga0157370_10676093 Ga0157370_106760931 216
241 3300013105 Ga0157369_10146446 Ga0157369_101464462 216
242 3300013296 Ga0157374_10330660 Ga0157374_103306601 216
243 3300014325 Ga0163163_10208933 Ga0163163_102089332 216
244 3300025911 Ga0207654_10000002 Ga0207654_1000000270 216
245 3300025912 Ga0207707_10004376 Ga0207707_1000437616 216
246 3300025918 Ga0207662_10115705 Ga0207662_101157052 216
247 3300025927 Ga0207687_10171597 Ga0207687_101715972 216
248 3300025944 Ga0207661_10001467 Ga0207661_100014679 216
249 3300025944 Ga0207661_10685443 Ga0207661_106854431 216
250 3300025945 Ga0207679_10233662 Ga0207679_102336622 216
251 3300025949 Ga0207667_10000003 Ga0207667_10000003815 216
252 3300025961 Ga0207712_10005969 Ga0207712_100059699 216
253 3300025986 Ga0207658_10013248 Ga0207658_100132483 216
254 3300026075 Ga0207708_10484155 Ga0207708_104841552 216
255 3300026116 Ga0207674_10430018 Ga0207674_104300182 216
256 3300026121 Ga0207683_10023491 Ga0207683_100234914 216
257 3300027866 Ga0209813_10000003 Ga0209813_10000003202 216
258 3300027907 Ga0207428_10021580 Ga0207428_100215805 216
259 3300031730 Ga0307516_10251599 Ga0307516_102515992 216
260 3300046674 Ga0495588_0000594 Ga0495588_0000594_7949_8602 216
261 3300046694 Ga0495649_0000209 Ga0495649_0000209_22631_23284 216
262 3300048915 Ga0496112_0567564 Ga0496112_0567564_304_954 216
263 3300049580 Ga0501046_0507007 Ga0501046_0507007_17_667 216
264 3300050489 nmdc:mga03683_226362_c1 nmdc:mga03683_226362_c1_112_762 216
265 3300050489 nmdc:mga03683_43_c2 nmdc:mga03683_43_c2_40659_41309 216
266 3300050490 nmdc:mga03n38_49_c1 nmdc:mga03n38_49_c1_19496_20146 216
267 3300050491 nmdc:mga00v17_1326_c1 nmdc:mga00v17_1326_c1_1047_1697 216
268 3300050491 nmdc:mga00v17_1469_c1 nmdc:mga00v17_1469_c1_10885_11544 216
269 3300050492 nmdc:mga0yw44_51866_c1 nmdc:mga0yw44_51866_c1_674_1327 216
270 3300050492 nmdc:mga0yw44_7_c1 nmdc:mga0yw44_7_c1_204805_205455 216
271 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_55026_55676 216
272 3300050493 nmdc:mga0k408_4338_c1 nmdc:mga0k408_4338_c1_1324_1974 216
273 3300050493 nmdc:mga0k408_498_c1 nmdc:mga0k408_498_c1_9700_10353 216
274 3300050493 nmdc:mga0k408_54_c1 nmdc:mga0k408_54_c1_40513_41163 216
275 3300050494 nmdc:mga06z11_185034_c1 nmdc:mga06z11_185034_c1_208_858 216
276 3300050494 nmdc:mga06z11_92_c1 nmdc:mga06z11_92_c1_20096_20746 216
277 3300050495 nmdc:mga04h51_3_c1 nmdc:mga04h51_3_c1_20078_20728 216
278 3300050496 nmdc:mga07m45_138309_c1 nmdc:mga07m45_138309_c1_444_1094 216
279 3300050496 nmdc:mga07m45_269745_c1 nmdc:mga07m45_269745_c1_254_913 216
280 3300050496 nmdc:mga07m45_3648_c3 nmdc:mga07m45_3648_c3_2668_3318 216
281 3300050496 nmdc:mga07m45_99105_c1 nmdc:mga07m45_99105_c1_496_1146 216
282 3300050511 nmdc:mga08y16_287_c1 nmdc:mga08y16_287_c1_43379_44029 216
283 3300050516 nmdc:mga0sz30_10_c2 nmdc:mga0sz30_10_c2_16645_17295 216
284 3300050516 nmdc:mga0sz30_123905_c1 nmdc:mga0sz30_123905_c1_262_912 216
285 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_122710_123360 216
286 3300050516 nmdc:mga0sz30_93526_c1 nmdc:mga0sz30_93526_c1_492_1142 216
287 3300053079 Ga0500610_0000009 Ga0500610_0000009_139_789 216
288 3300053087 Ga0500643_002224 Ga0500643_002224_5823_6473 216
289 3300053088 Ga0500644_0000137 Ga0500644_0000137_44327_44977 216
290 3300053088 Ga0500644_0001390 Ga0500644_0001390_739_1389 216
291 3300053088 Ga0500644_0002619 Ga0500644_0002619_1311_1961 216
292 3300053090 Ga0500646_0020600 Ga0500646_0020600_870_1520 216
293 3300053092 Ga0500583_0000119 Ga0500583_0000119_36316_36966 216
294 3300053092 Ga0500583_0011566 Ga0500583_0011566_1977_2627 216
295 3300053092 Ga0500583_0107485 Ga0500583_0107485_490_1140 216
296 3300053093 Ga0500651_0024508 Ga0500651_0024508_1290_1940 216
297 3300053098 Ga0500650_0000003 Ga0500650_0000003_148808_149458 216
298 3300053103 Ga0500555_000001 Ga0500555_000001_57917_58567 216
299 3300053103 Ga0500555_000002 Ga0500555_000002_1236884_1237534 216
300 3300053108 Ga0500562_035551 Ga0500562_035551_633_1283 216
301 3300053118 Ga0500594_0000001 Ga0500594_0000001_450798_451448 216
302 3300053118 Ga0500594_0000019 Ga0500594_0000019_33181_33831 216
303 3300053123 Ga0500614_000001 Ga0500614_000001_997588_998241 216
304 3300053129 Ga0500628_000005 Ga0500628_000005_107575_108225 216
305 3300053129 Ga0500628_021871 Ga0500628_021871_273_923 216
306 3300053131 Ga0500652_000012 Ga0500652_000012_54165_54815 216
307 3300053142 Ga0500577_0000143 Ga0500577_0000143_4782_5432 216
308 3300053142 Ga0500577_0025312 Ga0500577_0025312_272_922 216
309 3300053143 Ga0500579_002247 Ga0500579_002247_4975_5625 216
310 3300053147 Ga0500589_000003 Ga0500589_000003_51642_52292 216
311 3300053151 Ga0500604_0022291 Ga0500604_0022291_682_1335 216
312 3300053722 Ga0500649_000006 Ga0500649_000006_91152_91805 216
313 3300053727 Ga0500611_003643 Ga0500611_003643_914_1564 216
314 3300001915 JGI24741J21665_1004600 JGI24741J21665_10046004 217
315 3300001990 JGI24737J22298_10000003 JGI24737J22298_100000035 217
316 3300002244 JGI24742J22300_10000001 JGI24742J22300_100000016 217
317 3300005328 Ga0070676_10000131 Ga0070676_1000013119 217
318 3300005329 Ga0070683_100000239 Ga0070683_10000023938 217
319 3300005535 Ga0070684_100003029 Ga0070684_1000030294 217
320 3300005563 Ga0068855_100416483 Ga0068855_1004164832 217
321 3300005577 Ga0068857_100340093 Ga0068857_1003400932 217
322 3300005614 Ga0068856_100002238 Ga0068856_10000223818 217
323 3300005843 Ga0068860_101262007 Ga0068860_1012620071 217
324 3300006051 Ga0075364_10054374 Ga0075364_100543742 217
325 3300006178 Ga0075367_10004166 Ga0075367_100041663 217
326 3300006195 Ga0075366_10000095 Ga0075366_1000009526 217
327 3300006237 Ga0097621_100000052 Ga0097621_10000005252 217
328 3300006358 Ga0068871_100000006 Ga0068871_10000000689 217
329 3300009093 Ga0105240_10008596 Ga0105240_1000859614 217
330 3300009174 Ga0105241_10000009 Ga0105241_10000009207 217
331 3300013100 Ga0157373_10000092 Ga0157373_1000009238 217
332 3300013105 Ga0157369_10000227 Ga0157369_1000022767 217
333 3300025907 Ga0207645_10014711 Ga0207645_100147113 217
334 3300025911 Ga0207654_10006035 Ga0207654_100060354 217
335 3300025913 Ga0207695_10031044 Ga0207695_100310446 217
336 3300025927 Ga0207687_10000008 Ga0207687_10000008376 217
337 3300025944 Ga0207661_10002072 Ga0207661_1000207216 217
338 3300025949 Ga0207667_10365611 Ga0207667_103656112 217
339 3300026078 Ga0207702_10001968 Ga0207702_100019686 217
340 3300026116 Ga0207674_10368662 Ga0207674_103686622 217
341 3300044901 Ga0466960_0277917 Ga0466960_0277917_257_910 217
342 3300048929 Ga0496126_0448092 Ga0496126_0448092_218_874 217
343 3300050490 nmdc:mga03n38_12688_c1 nmdc:mga03n38_12688_c1_882_1535 217
344 3300050491 nmdc:mga00v17_45299_c1 nmdc:mga00v17_45299_c1_603_1259 217
345 3300050493 nmdc:mga0k408_32_c1 nmdc:mga0k408_32_c1_31685_32341 217
346 3300050494 nmdc:mga06z11_867_c1 nmdc:mga06z11_867_c1_5679_6335 217
347 3300001915 JGI24741J21665_1000363 JGI24741J21665_10003636 219
348 3300001979 JGI24740J21852_10002100 JGI24740J21852_1000210014 219
349 3300006051 Ga0075364_10674960 Ga0075364_106749601 219
350 3300006195 Ga0075366_10010130 Ga0075366_100101304 219
351 3300009986 Ga0105033_100111 Ga0105033_1001112 219
352 3300009986 Ga0105033_103143 Ga0105033_1031432 219
353 3300025917 Ga0207660_10475794 Ga0207660_104757941 219
354 3300026067 Ga0207678_11090073 Ga0207678_110900731 219
355 3300026121 Ga0207683_10160205 Ga0207683_101602053 219
356 3300050493 nmdc:mga0k408_9284_c1 nmdc:mga0k408_9284_c1_2228_2896 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

44

132

0.97

PF00325

Crp

Bacterial regulatory proteins, crp family

189

220

0.92

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

164

238

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cyd-assembly2.cif.gz_A glxr bound to camp 0.9152 9 219
3i59-assembly1.cif.gz_A crystal structure of mtbcrp in complex with n6-camp 0.9134 17 217
4cyd-assembly1.cif.gz_D glxr bound to camp 0.9118 10 214
3i54-assembly2.cif.gz_C crystal structure of mtbcrp in complex with camp 0.9072 11 217
7ff8-assembly1.cif.gz_A pseudomonas aeruginosa virulence factor regulator with camp ligand and cl(triethylphosphine)gold(i) 0.8957 10 208
ID Description Score Start End Superfamily
3n0rA01 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;PhyR, sigma-like (SL) domain 0.9629 170 196 1.20.140.160
2xkpF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9381 19 121 2.60.120.10
3i59B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9355 137 210 1.10.10.10
4byyB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9323 137 208 1.10.10.10
3i59B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9223 137 210 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1F5ZKQ6-F1-model_v4 HTH crp-type domain-containing protein 0.9418 5 208 GO:0003677
GO:0006355
AF-A0A7S6M4I6-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9287 21 218 GO:0003677
GO:0003700
GO:0005829
AF-A0A0J1F8Y4-F1-model_v4 Global nitrogen regulator 0.924 4 217 GO:0003677
GO:0003700
GO:0005829
AF-A0A7Y2ZSB7-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9226 25 215 GO:0003677
GO:0003700
GO:0005829
AF-A0A1Q5BK56-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9183 18 218 GO:0003677
GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
91.64 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map