F420386
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 356 | 174 | 356 | 123 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_11544026|Ga0070658_115440261 |
| Length | 147 |
| Sequence | MIIAIASILAIAVLGFILTVRPEDLPVPEPVSPFAHLDERKSAIYDNLRDAQFEYRVGKLSDEDYQQTKLGLQKELAVVMAEIDRIKATLPTPAMESAKGARGTGSKPAVPKASAAANVNVCPSCGAQFAQSLKFCGECGKSMKVRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 75 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 76 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 118 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 120 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 121 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 122 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 123 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 124 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 125 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 126 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 127 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 129 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 130 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 131 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 132 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 133 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 138 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 139 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 140 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 141 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 142 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 143 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 144 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 145 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 159 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 160 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 161 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0 |
| Rhizoplane | 1.12 |
| Rhizosphere | 94.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_11544026 | 3300005327 | Unclassified | 576 |
| 2 | Ga0070658_11652065 | 3300005327 | Unclassified | 555 |
| 3 | Ga0070683_100000967 | 3300005329 | Bacteria | 21380 |
| 4 | Ga0070683_100087142 | 3300005329 | Unclassified | 2928 |
| 5 | Ga0070683_100095844 | 3300005329 | Bacteria | 2790 |
| 6 | Ga0070683_100818928 | 3300005329 | Unclassified | 893 |
| 7 | Ga0070666_10294437 | 3300005335 | Unclassified | 1155 |
| 8 | Ga0070680_100057136 | 3300005336 | Bacteria | 3190 |
| 9 | Ga0068868_100504914 | 3300005338 | Unclassified | 1060 |
| 10 | Ga0070689_101022016 | 3300005340 | Unclassified | 736 |
| 11 | Ga0070691_10000088 | 3300005341 | Bacteria | 26073 |
| 12 | Ga0070687_100149248 | 3300005343 | Bacteria | 1370 |
| 13 | Ga0070661_100096493 | 3300005344 | Bacteria | 2194 |
| 14 | Ga0070668_100225825 | 3300005347 | Bacteria | 1546 |
| 15 | Ga0070667_100686510 | 3300005367 | Unclassified | 947 |
| 16 | Ga0070709_10055778 | 3300005434 | Bacteria | 2496 |
| 17 | Ga0070709_10193355 | 3300005434 | Bacteria | 1437 |
| 18 | Ga0070709_10399351 | 3300005434 | Unclassified | 1026 |
| 19 | Ga0070714_100024506 | 3300005435 | Bacteria | 4970 |
| 20 | Ga0070713_100015152 | 3300005436 | Bacteria | 5748 |
| 21 | Ga0070713_100137323 | 3300005436 | Unclassified | 2162 |
| 22 | Ga0070713_100468563 | 3300005436 | Unclassified | 1185 |
| 23 | Ga0070710_10462355 | 3300005437 | Unclassified | 862 |
| 24 | Ga0070711_100134549 | 3300005439 | Bacteria | 1845 |
| 25 | Ga0070711_100297167 | 3300005439 | Bacteria | 1283 |
| 26 | Ga0070700_101499708 | 3300005441 | Unclassified | 573 |
| 27 | Ga0070694_100421907 | 3300005444 | Unclassified | 1048 |
| 28 | Ga0070708_100621546 | 3300005445 | Unclassified | 1018 |
| 29 | Ga0070681_10003257 | 3300005458 | Bacteria | 15139 |
| 30 | Ga0070681_10105217 | 3300005458 | Bacteria | 2764 |
| 31 | Ga0070681_10679614 | 3300005458 | Bacteria | 945 |
| 32 | Ga0070681_10968740 | 3300005458 | Unclassified | 770 |
| 33 | Ga0068867_100040614 | 3300005459 | Bacteria | 3397 |
| 34 | Ga0068867_100740598 | 3300005459 | Unclassified | 871 |
| 35 | Ga0070707_100432636 | 3300005468 | Unclassified | 1276 |
| 36 | Ga0070698_100228458 | 3300005471 | Bacteria | 1794 |
| 37 | Ga0070698_100383018 | 3300005471 | Unclassified | 1339 |
| 38 | Ga0070699_100505274 | 3300005518 | Unclassified | 1098 |
| 39 | Ga0070679_100001383 | 3300005530 | Bacteria | 21358 |
| 40 | Ga0070679_100327822 | 3300005530 | Bacteria | 1480 |
| 41 | Ga0070679_100914548 | 3300005530 | Unclassified | 821 |
| 42 | Ga0070679_101236426 | 3300005530 | Bacteria | 692 |
| 43 | Ga0070684_100001873 | 3300005535 | Bacteria | 15400 |
| 44 | Ga0070684_100044596 | 3300005535 | Bacteria | 3836 |
| 45 | Ga0070684_100067822 | 3300005535 | Bacteria | 3134 |
| 46 | Ga0070684_100680102 | 3300005535 | Bacteria | 959 |
| 47 | Ga0070697_100123995 | 3300005536 | Unclassified | 2163 |
| 48 | Ga0068853_100082154 | 3300005539 | Bacteria | 2822 |
| 49 | Ga0068853_100414907 | 3300005539 | Bacteria | 1262 |
| 50 | Ga0068853_100941883 | 3300005539 | Bacteria | 830 |
| 51 | Ga0070695_100137369 | 3300005545 | Unclassified | 1691 |
| 52 | Ga0070693_100192843 | 3300005547 | Bacteria | 1319 |
| 53 | Ga0070693_100390918 | 3300005547 | Bacteria | 962 |
| 54 | Ga0070693_100418630 | 3300005547 | Bacteria | 933 |
| 55 | Ga0070665_100380408 | 3300005548 | Unclassified | 1419 |
| 56 | Ga0068855_100039930 | 3300005563 | Bacteria | 5571 |
| 57 | Ga0068855_100209392 | 3300005563 | Bacteria | 2192 |
| 58 | Ga0068855_101350246 | 3300005563 | Bacteria | 736 |
| 59 | Ga0068855_101373077 | 3300005563 | Unclassified | 729 |
| 60 | Ga0070664_100888515 | 3300005564 | Unclassified | 835 |
| 61 | Ga0068857_100000850 | 3300005577 | Bacteria | 22895 |
| 62 | Ga0068857_100013902 | 3300005577 | Bacteria | 7008 |
| 63 | Ga0068857_100917950 | 3300005577 | Unclassified | 840 |
| 64 | Ga0068854_100492017 | 3300005578 | Unclassified | 1031 |
| 65 | Ga0068856_100016259 | 3300005614 | Bacteria | 7198 |
| 66 | Ga0068856_102433847 | 3300005614 | Bacteria | 531 |
| 67 | Ga0070702_101716161 | 3300005615 | Unclassified | 522 |
| 68 | Ga0068859_100104975 | 3300005617 | Bacteria | 2885 |
| 69 | Ga0068859_100368565 | 3300005617 | Bacteria | 1532 |
| 70 | Ga0068861_100899074 | 3300005719 | Bacteria | 838 |
| 71 | Ga0068863_100608440 | 3300005841 | Unclassified | 1082 |
| 72 | Ga0068858_100049391 | 3300005842 | Bacteria | 3896 |
| 73 | Ga0068860_100866805 | 3300005843 | Bacteria | 918 |
| 74 | Ga0070717_10091998 | 3300006028 | Bacteria | 2562 |
| 75 | Ga0070717_10242915 | 3300006028 | Bacteria | 1588 |
| 76 | Ga0070716_100543561 | 3300006173 | Unclassified | 865 |
| 77 | Ga0070716_100733305 | 3300006173 | Bacteria | 758 |
| 78 | Ga0070712_100173456 | 3300006175 | Bacteria | 1675 |
| 79 | Ga0097621_100036180 | 3300006237 | Bacteria | 3950 |
| 80 | Ga0097621_100355929 | 3300006237 | Unclassified | 1303 |
| 81 | Ga0097621_100720456 | 3300006237 | Unclassified | 920 |
| 82 | Ga0068871_100015189 | 3300006358 | Bacteria | 5758 |
| 83 | Ga0068871_101335955 | 3300006358 | Unclassified | 675 |
| 84 | Ga0068865_100297943 | 3300006881 | Unclassified | 1290 |
| 85 | Ga0075436_100448860 | 3300006914 | Bacteria | 939 |
| 86 | Ga0097620_100104975 | 3300006931 | Bacteria | 2885 |
| 87 | Ga0097620_100368571 | 3300006931 | Bacteria | 1532 |
| 88 | Ga0105240_10002386 | 3300009093 | Bacteria | 30286 |
| 89 | Ga0105240_10010794 | 3300009093 | Bacteria | 12802 |
| 90 | Ga0105240_10225127 | 3300009093 | Bacteria | 2183 |
| 91 | Ga0105240_10321409 | 3300009093 | Bacteria | 1764 |
| 92 | Ga0105240_10465892 | 3300009093 | Bacteria | 1411 |
| 93 | Ga0105240_10973699 | 3300009093 | Unclassified | 909 |
| 94 | Ga0105245_10007356 | 3300009098 | Bacteria | 9642 |
| 95 | Ga0105245_10014489 | 3300009098 | Bacteria | 6866 |
| 96 | Ga0105245_10336156 | 3300009098 | Bacteria | 1492 |
| 97 | Ga0105245_10431029 | 3300009098 | Bacteria | 1323 |
| 98 | Ga0105245_11821013 | 3300009098 | Unclassified | 662 |
| 99 | Ga0105245_11843083 | 3300009098 | Bacteria | 658 |
| 100 | Ga0105245_12126112 | 3300009098 | Bacteria | 615 |
| 101 | Ga0105245_13234713 | 3300009098 | Unclassified | 505 |
| 102 | Ga0105243_10143268 | 3300009148 | Bacteria | 2041 |
| 103 | Ga0105241_10019433 | 3300009174 | Bacteria | 5009 |
| 104 | Ga0105241_10028909 | 3300009174 | Bacteria | 4131 |
| 105 | Ga0105241_10308741 | 3300009174 | Unclassified | 1360 |
| 106 | Ga0105242_10055226 | 3300009176 | Bacteria | 3249 |
| 107 | Ga0105242_10062768 | 3300009176 | Bacteria | 3058 |
| 108 | Ga0105242_10153369 | 3300009176 | Unclassified | 2011 |
| 109 | Ga0105242_11361131 | 3300009176 | Bacteria | 736 |
| 110 | Ga0105248_10156466 | 3300009177 | Bacteria | 2572 |
| 111 | Ga0105248_10386658 | 3300009177 | Bacteria | 1575 |
| 112 | Ga0105248_10664532 | 3300009177 | Unclassified | 1176 |
| 113 | Ga0105248_12670205 | 3300009177 | Unclassified | 569 |
| 114 | Ga0105237_10003915 | 3300009545 | Bacteria | 17441 |
| 115 | Ga0105237_10039431 | 3300009545 | Bacteria | 4769 |
| 116 | Ga0105237_10240139 | 3300009545 | Bacteria | 1813 |
| 117 | Ga0105237_10263632 | 3300009545 | Unclassified | 1726 |
| 118 | Ga0105238_10003062 | 3300009551 | Bacteria | 16671 |
| 119 | Ga0105238_10005455 | 3300009551 | Bacteria | 12566 |
| 120 | Ga0105238_10018894 | 3300009551 | Bacteria | 7018 |
| 121 | Ga0105238_10138941 | 3300009551 | Bacteria | 2407 |
| 122 | Ga0105249_10001874 | 3300009553 | Bacteria | 18219 |
| 123 | Ga0105249_10470457 | 3300009553 | Bacteria | 1298 |
| 124 | Ga0105249_11497568 | 3300009553 | Unclassified | 747 |
| 125 | Ga0099796_10355392 | 3300010159 | Bacteria | 633 |
| 126 | Ga0105239_10008216 | 3300010375 | Bacteria | 11905 |
| 127 | Ga0105239_10025651 | 3300010375 | Bacteria | 6491 |
| 128 | Ga0105239_10503207 | 3300010375 | Bacteria | 1377 |
| 129 | Ga0105246_10048178 | 3300011119 | Bacteria | 2913 |
| 130 | Ga0105246_10054156 | 3300011119 | Bacteria | 2763 |
| 131 | Ga0105246_10629895 | 3300011119 | Unclassified | 931 |
| 132 | Ga0157373_10430053 | 3300013100 | Unclassified | 948 |
| 133 | Ga0157371_10034931 | 3300013102 | Bacteria | 3605 |
| 134 | Ga0157370_10002060 | 3300013104 | Bacteria | 24636 |
| 135 | Ga0157370_10244005 | 3300013104 | Bacteria | 1662 |
| 136 | Ga0157370_10602413 | 3300013104 | Bacteria | 1006 |
| 137 | Ga0157369_10001410 | 3300013105 | Bacteria | 29531 |
| 138 | Ga0157369_10291526 | 3300013105 | Bacteria | 1699 |
| 139 | Ga0157369_10314894 | 3300013105 | Bacteria | 1627 |
| 140 | Ga0157369_10638677 | 3300013105 | Bacteria | 1098 |
| 141 | Ga0157374_10376306 | 3300013296 | Bacteria | 1414 |
| 142 | Ga0157374_10747762 | 3300013296 | Bacteria | 992 |
| 143 | Ga0157378_10016658 | 3300013297 | Bacteria | 6440 |
| 144 | Ga0157378_11669213 | 3300013297 | Unclassified | 684 |
| 145 | Ga0157372_10000671 | 3300013307 | Bacteria | 37684 |
| 146 | Ga0157372_10323244 | 3300013307 | Bacteria | 1796 |
| 147 | Ga0157372_10527331 | 3300013307 | Unclassified | 1377 |
| 148 | Ga0157372_12262183 | 3300013307 | Unclassified | 624 |
| 149 | Ga0157375_10004889 | 3300013308 | Bacteria | 11645 |
| 150 | Ga0157375_10417340 | 3300013308 | Unclassified | 1508 |
| 151 | Ga0163163_10171112 | 3300014325 | Bacteria | 2219 |
| 152 | Ga0163163_11009832 | 3300014325 | Unclassified | 895 |
| 153 | Ga0163163_11088219 | 3300014325 | Bacteria | 862 |
| 154 | Ga0157377_10479879 | 3300014745 | Bacteria | 865 |
| 155 | Ga0157376_10261022 | 3300014969 | Bacteria | 1623 |
| 156 | Ga0157376_11834718 | 3300014969 | Unclassified | 643 |
| 157 | Ga0213876_10014242 | 3300021384 | Bacteria | 4216 |
| 158 | Ga0213875_10005717 | 3300021388 | Bacteria | 6624 |
| 159 | Ga0213875_10024583 | 3300021388 | Bacteria | 2872 |
| 160 | Ga0213875_10065615 | 3300021388 | Bacteria | 1696 |
| 161 | Ga0213875_10116307 | 3300021388 | Bacteria | 1249 |
| 162 | Ga0207699_10023434 | 3300025906 | Bacteria | 3360 |
| 163 | Ga0207699_11206087 | 3300025906 | Unclassified | 560 |
| 164 | Ga0207705_11173133 | 3300025909 | Unclassified | 590 |
| 165 | Ga0207705_11199951 | 3300025909 | Unclassified | 582 |
| 166 | Ga0207654_10016868 | 3300025911 | Bacteria | 3810 |
| 167 | Ga0207654_10357533 | 3300025911 | Unclassified | 1007 |
| 168 | Ga0207707_10000835 | 3300025912 | Bacteria | 30284 |
| 169 | Ga0207707_10000925 | 3300025912 | Bacteria | 28483 |
| 170 | Ga0207707_10678733 | 3300025912 | Unclassified | 866 |
| 171 | Ga0207707_10942776 | 3300025912 | Unclassified | 711 |
| 172 | Ga0207707_11128411 | 3300025912 | Unclassified | 638 |
| 173 | Ga0207695_10000790 | 3300025913 | Bacteria | 59450 |
| 174 | Ga0207695_10002118 | 3300025913 | Bacteria | 30141 |
| 175 | Ga0207695_10017129 | 3300025913 | Bacteria | 8447 |
| 176 | Ga0207695_10084060 | 3300025913 | Bacteria | 3214 |
| 177 | Ga0207695_10285820 | 3300025913 | Bacteria | 1542 |
| 178 | Ga0207695_10522864 | 3300025913 | Unclassified | 1068 |
| 179 | Ga0207671_10031710 | 3300025914 | Unclassified | 3938 |
| 180 | Ga0207671_10049956 | 3300025914 | Bacteria | 3097 |
| 181 | Ga0207671_10124825 | 3300025914 | Unclassified | 1970 |
| 182 | Ga0207671_10223240 | 3300025914 | Bacteria | 1476 |
| 183 | Ga0207671_10996196 | 3300025914 | Unclassified | 660 |
| 184 | Ga0207671_11435891 | 3300025914 | Unclassified | 534 |
| 185 | Ga0207693_10284988 | 3300025915 | Bacteria | 1294 |
| 186 | Ga0207663_10089562 | 3300025916 | Bacteria | 2038 |
| 187 | Ga0207663_10274598 | 3300025916 | Unclassified | 1250 |
| 188 | Ga0207660_10008302 | 3300025917 | Bacteria | 6711 |
| 189 | Ga0207660_11034053 | 3300025917 | Unclassified | 670 |
| 190 | Ga0207662_10117814 | 3300025918 | Bacteria | 1662 |
| 191 | Ga0207657_10375359 | 3300025919 | Bacteria | 1120 |
| 192 | Ga0207652_10016707 | 3300025921 | Bacteria | 5996 |
| 193 | Ga0207694_10000521 | 3300025924 | Bacteria | 34747 |
| 194 | Ga0207694_10008025 | 3300025924 | Bacteria | 7984 |
| 195 | Ga0207694_10017071 | 3300025924 | Bacteria | 5483 |
| 196 | Ga0207687_10004103 | 3300025927 | Bacteria | 9761 |
| 197 | Ga0207687_10004241 | 3300025927 | Bacteria | 9584 |
| 198 | Ga0207687_10007146 | 3300025927 | Bacteria | 7361 |
| 199 | Ga0207687_10404280 | 3300025927 | Unclassified | 1124 |
| 200 | Ga0207687_11427806 | 3300025927 | Unclassified | 595 |
| 201 | Ga0207700_10005080 | 3300025928 | Bacteria | 7824 |
| 202 | Ga0207700_10123679 | 3300025928 | Unclassified | 2101 |
| 203 | Ga0207700_11785759 | 3300025928 | Unclassified | 541 |
| 204 | Ga0207664_10013222 | 3300025929 | Bacteria | 5915 |
| 205 | Ga0207686_10025959 | 3300025934 | Bacteria | 3415 |
| 206 | Ga0207686_10039842 | 3300025934 | Bacteria | 2852 |
| 207 | Ga0207686_10466891 | 3300025934 | Bacteria | 974 |
| 208 | Ga0207709_10426679 | 3300025935 | Unclassified | 1020 |
| 209 | Ga0207704_10098724 | 3300025938 | Bacteria | 1941 |
| 210 | Ga0207665_10443353 | 3300025939 | Unclassified | 995 |
| 211 | Ga0207711_10933432 | 3300025941 | Unclassified | 806 |
| 212 | Ga0207711_11245054 | 3300025941 | Unclassified | 686 |
| 213 | Ga0207661_10012587 | 3300025944 | Bacteria | 6154 |
| 214 | Ga0207661_10030247 | 3300025944 | Bacteria | 4169 |
| 215 | Ga0207661_10328347 | 3300025944 | Unclassified | 1376 |
| 216 | Ga0207679_11010263 | 3300025945 | Unclassified | 762 |
| 217 | Ga0207667_10000563 | 3300025949 | Bacteria | 48455 |
| 218 | Ga0207667_10293280 | 3300025949 | Bacteria | 1662 |
| 219 | Ga0207651_10274422 | 3300025960 | Unclassified | 1390 |
| 220 | Ga0207712_10007406 | 3300025961 | Bacteria | 6930 |
| 221 | Ga0207712_11521260 | 3300025961 | Unclassified | 599 |
| 222 | Ga0207712_12023926 | 3300025961 | Unclassified | 515 |
| 223 | Ga0207668_10207432 | 3300025972 | Bacteria | 1565 |
| 224 | Ga0207640_10441262 | 3300025981 | Unclassified | 1070 |
| 225 | Ga0207677_10479522 | 3300026023 | Unclassified | 1071 |
| 226 | Ga0207703_10095876 | 3300026035 | Bacteria | 2503 |
| 227 | Ga0207703_10114108 | 3300026035 | Unclassified | 2310 |
| 228 | Ga0207639_10053790 | 3300026041 | Bacteria | 3073 |
| 229 | Ga0207639_10616845 | 3300026041 | Unclassified | 1001 |
| 230 | Ga0207639_11066960 | 3300026041 | Bacteria | 757 |
| 231 | Ga0207639_11119850 | 3300026041 | Bacteria | 738 |
| 232 | Ga0207708_10783516 | 3300026075 | Unclassified | 820 |
| 233 | Ga0207708_11338958 | 3300026075 | Unclassified | 628 |
| 234 | Ga0207702_10032361 | 3300026078 | Bacteria | 4364 |
| 235 | Ga0207702_10250163 | 3300026078 | Bacteria | 1664 |
| 236 | Ga0207702_10267488 | 3300026078 | Bacteria | 1612 |
| 237 | Ga0207702_11884835 | 3300026078 | Unclassified | 589 |
| 238 | Ga0207641_10358377 | 3300026088 | Unclassified | 1392 |
| 239 | Ga0207648_10110065 | 3300026089 | Bacteria | 2418 |
| 240 | Ga0207648_11087826 | 3300026089 | Unclassified | 750 |
| 241 | Ga0207674_10001649 | 3300026116 | Bacteria | 28706 |
| 242 | Ga0207674_10003599 | 3300026116 | Bacteria | 18894 |
| 243 | Ga0207698_10029186 | 3300026142 | Bacteria | 3946 |
| 244 | Ga0268266_10444005 | 3300028379 | Unclassified | 1232 |
| 245 | Ga0268264_10564806 | 3300028381 | Bacteria | 1118 |
| 246 | Ga0265334_10240813 | 3300028573 | Bacteria | 624 |
| 247 | Ga0265338_10130644 | 3300028800 | Bacteria | 1984 |
| 248 | Ga0265316_10019066 | 3300031344 | Bacteria | 5878 |
| 249 | Ga0265342_10114441 | 3300031712 | Bacteria | 1524 |
| 250 | Ga0373926_0268515 | 3300035083 | Unclassified | 663 |
| 251 | Ga0373934_0003272 | 3300035086 | Bacteria | 5927 |
| 252 | Ga0373934_0028187 | 3300035086 | Bacteria | 2186 |
| 253 | Ga0373944_0021892 | 3300035089 | Bacteria | 1854 |
| 254 | Ga0373923_0026640 | 3300035111 | Bacteria | 2301 |
| 255 | Ga0373923_0097485 | 3300035111 | Bacteria | 1293 |
| 256 | Ga0373953_0036023 | 3300035117 | Bacteria | 1947 |
| 257 | Ga0373954_0039439 | 3300035118 | Bacteria | 2198 |
| 258 | Ga0373954_0131492 | 3300035118 | Unclassified | 1218 |
| 259 | Ga0373954_0201567 | 3300035118 | Bacteria | 978 |
| 260 | Ga0373956_0106193 | 3300035119 | Bacteria | 1305 |
| 261 | Ga0373956_0180532 | 3300035119 | Unclassified | 998 |
| 262 | Ga0373957_0064013 | 3300035120 | Bacteria | 1429 |
| 263 | Ga0373957_0278038 | 3300035120 | Unclassified | 707 |
| 264 | Ga0373943_0093913 | 3300035170 | Unclassified | 1558 |
| 265 | Ga0373943_0275600 | 3300035170 | Unclassified | 950 |
| 266 | Ga0373955_0087261 | 3300035172 | Bacteria | 1773 |
| 267 | Ga0373924_0057676 | 3300035410 | Unclassified | 1620 |
| 268 | Ga0373935_0010261 | 3300035692 | Bacteria | 5615 |
| 269 | Ga0373935_0161411 | 3300035692 | Bacteria | 1528 |
| 270 | Ga0373935_0406704 | 3300035692 | Bacteria | 978 |
| 271 | Ga0373935_0505490 | 3300035692 | Bacteria | 878 |
| 272 | Ga0373935_0526832 | 3300035692 | Bacteria | 860 |
| 273 | Ga0373927_0002123 | 3300035695 | Bacteria | 14611 |
| 274 | Ga0373927_0032080 | 3300035695 | Bacteria | 3422 |
| 275 | Ga0373927_0447373 | 3300035695 | Bacteria | 853 |
| 276 | Ga0373933_0009968 | 3300035724 | Bacteria | 5202 |
| 277 | Ga0373933_0029738 | 3300035724 | Bacteria | 3161 |
| 278 | Ga0373933_0178920 | 3300035724 | Bacteria | 1352 |
| 279 | Ga0373933_0306494 | 3300035724 | Bacteria | 1029 |
| 280 | Ga0373933_0579907 | 3300035724 | Bacteria | 736 |
| 281 | Ga0373933_1190225 | 3300035724 | Unclassified | 502 |
| 282 | Ga0373947_0272906 | 3300035725 | Bacteria | 1123 |
| 283 | Ga0373947_0306956 | 3300035725 | Unclassified | 1059 |
| 284 | Ga0373947_0377978 | 3300035725 | Bacteria | 953 |
| 285 | Ga0373937_0010975 | 3300036401 | Bacteria | 7936 |
| 286 | Ga0373937_0029368 | 3300036401 | Bacteria | 4979 |
| 287 | Ga0373937_0037960 | 3300036401 | Bacteria | 4390 |
| 288 | Ga0373937_0048480 | 3300036401 | Bacteria | 3889 |
| 289 | Ga0373937_0378232 | 3300036401 | Bacteria | 1343 |
| 290 | Ga0373937_1523021 | 3300036401 | Bacteria | 616 |
| 291 | Ga0373925_0082098 | 3300037068 | Bacteria | 2452 |
| 292 | Ga0373925_0108820 | 3300037068 | Bacteria | 2139 |
| 293 | Ga0373925_0930137 | 3300037068 | Unclassified | 716 |
| 294 | Ga0373925_1400701 | 3300037068 | Bacteria | 573 |
| 295 | Ga0373925_1501287 | 3300037068 | Bacteria | 551 |
| 296 | Ga0395905_1779329 | 3300037471 | Unclassified | 522 |
| 297 | Ga0436364_0278639 | 3300037853 | Unclassified | 527 |
| 298 | Ga0436364_0320230 | 3300037853 | Bacteria | 4168 |
| 299 | Ga0436364_0457458 | 3300037853 | Bacteria | 889 |
| 300 | Ga0436364_0736713 | 3300037853 | Bacteria | 1844 |
| 301 | Ga0436364_0959300 | 3300037853 | Bacteria | 1234 |
| 302 | Ga0436364_1065030 | 3300037853 | Bacteria | 28547 |
| 303 | Ga0436364_1461867 | 3300037853 | Bacteria | 7682 |
| 304 | Ga0436365_0395688 | 3300039437 | Unclassified | 1124 |
| 305 | Ga0436365_0574946 | 3300039437 | Bacteria | 6864 |
| 306 | Ga0436365_0761374 | 3300039437 | Unclassified | 1080 |
| 307 | Ga0451577_0183468 | 3300042876 | Bacteria | 1887 |
| 308 | Ga0466969_0359848 | 3300044656 | Unclassified | 659 |
| 309 | Ga0466963_0485764 | 3300044694 | Bacteria | 872 |
| 310 | Ga0453684_0435969 | 3300044712 | Bacteria | 1461 |
| 311 | Ga0453684_2466744 | 3300044712 | Bacteria | 514 |
| 312 | Ga0466960_0224367 | 3300044901 | Unclassified | 1035 |
| 313 | Ga0451576_0122022 | 3300045051 | Bacteria | 2714 |
| 314 | Ga0495651_0661356 | 3300046462 | Bacteria | 654 |
| 315 | Ga0495580_0011083 | 3300046472 | Bacteria | 6986 |
| 316 | Ga0495580_0024685 | 3300046472 | Bacteria | 4398 |
| 317 | Ga0495580_0044100 | 3300046472 | Bacteria | 3173 |
| 318 | Ga0495580_0251506 | 3300046472 | Unclassified | 1210 |
| 319 | Ga0495580_0264530 | 3300046472 | Bacteria | 1176 |
| 320 | Ga0495580_0765523 | 3300046472 | Unclassified | 628 |
| 321 | Ga0495582_0009225 | 3300046473 | Bacteria | 5442 |
| 322 | Ga0495630_0170333 | 3300046517 | Bacteria | 1659 |
| 323 | Ga0495652_0209937 | 3300046529 | Unclassified | 1471 |
| 324 | Ga0495586_0611405 | 3300046535 | Unclassified | 630 |
| 325 | Ga0495587_0074407 | 3300046536 | Bacteria | 1973 |
| 326 | Ga0495599_0186301 | 3300046678 | Bacteria | 1278 |
| 327 | Ga0495658_0020580 | 3300046683 | Bacteria | 3465 |
| 328 | Ga0495613_0139911 | 3300046689 | Bacteria | 1730 |
| 329 | Ga0495613_0501454 | 3300046689 | Bacteria | 817 |
| 330 | Ga0495674_0225815 | 3300047319 | Unclassified | 1547 |
| 331 | Ga0495684_0009787 | 3300047471 | Bacteria | 7398 |
| 332 | Ga0495684_0062768 | 3300047471 | Bacteria | 2826 |
| 333 | Ga0495684_0297875 | 3300047471 | Unclassified | 1159 |
| 334 | Ga0495684_0549117 | 3300047471 | Unclassified | 787 |
| 335 | Ga0495593_0526437 | 3300047673 | Bacteria | 593 |
| 336 | Ga0496104_0105824 | 3300048907 | Bacteria | 2696 |
| 337 | Ga0496114_0335845 | 3300048917 | Bacteria | 1336 |
| 338 | Ga0496115_0054652 | 3300048918 | Bacteria | 3207 |
| 339 | Ga0496115_0324169 | 3300048918 | Unclassified | 1259 |
| 340 | Ga0501034_0045455 | 3300049571 | Bacteria | 4437 |
| 341 | Ga0501037_0148548 | 3300049573 | Unclassified | 1676 |
| 342 | Ga0501038_0040064 | 3300049574 | Bacteria | 4095 |
| 343 | Ga0501042_1310208 | 3300049578 | Unclassified | 528 |
| 344 | Ga0501043_0013913 | 3300049579 | Bacteria | 6296 |
| 345 | Ga0501046_0217447 | 3300049580 | Unclassified | 1416 |
| 346 | Ga0501047_0028792 | 3300049581 | Bacteria | 5357 |
| 347 | Ga0501048_0129942 | 3300049582 | Unclassified | 1781 |
| 348 | Ga0501074_0374414 | 3300049590 | Unclassified | 1010 |
| 349 | Ga0501035_0010913 | 3300049822 | Bacteria | 8412 |
| 350 | Ga0501035_0801289 | 3300049822 | Unclassified | 752 |
| 351 | Ga0501044_0003837 | 3300049823 | Bacteria | 16861 |
| 352 | Ga0501044_0007244 | 3300049823 | Bacteria | 12196 |
| 353 | Ga0501044_0030979 | 3300049823 | Bacteria | 5633 |
| 354 | Ga0495612_0076765 | 3300053078 | Bacteria | 1400 |
| 355 | Ga0495595_0191659 | 3300053084 | Bacteria | 1016 |
| 356 | Ga0500568_0000704 | 3300053139 | Bacteria | 23996 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013100 | Ga0157373_10430053 | Ga0157373_104300532 | 103 |
| 2 | 3300035724 | Ga0373933_0579907 | Ga0373933_0579907_26_346 | 103 |
| 3 | 3300005329 | Ga0070683_100818928 | Ga0070683_1008189282 | 105 |
| 4 | 3300005347 | Ga0070668_100225825 | Ga0070668_1002258252 | 105 |
| 5 | 3300005436 | Ga0070713_100137323 | Ga0070713_1001373233 | 105 |
| 6 | 3300005441 | Ga0070700_101499708 | Ga0070700_1014997081 | 105 |
| 7 | 3300005459 | Ga0068867_100040614 | Ga0068867_1000406142 | 105 |
| 8 | 3300005617 | Ga0068859_100104975 | Ga0068859_1001049753 | 105 |
| 9 | 3300005719 | Ga0068861_100899074 | Ga0068861_1008990742 | 105 |
| 10 | 3300006931 | Ga0097620_100104975 | Ga0097620_1001049753 | 105 |
| 11 | 3300009098 | Ga0105245_13234713 | Ga0105245_132347131 | 105 |
| 12 | 3300009148 | Ga0105243_10143268 | Ga0105243_101432682 | 105 |
| 13 | 3300009176 | Ga0105242_10055226 | Ga0105242_100552263 | 105 |
| 14 | 3300009545 | Ga0105237_10263632 | Ga0105237_102636322 | 105 |
| 15 | 3300009553 | Ga0105249_10470457 | Ga0105249_104704572 | 105 |
| 16 | 3300025914 | Ga0207671_10124825 | Ga0207671_101248252 | 105 |
| 17 | 3300025927 | Ga0207687_11427806 | Ga0207687_114278062 | 105 |
| 18 | 3300025928 | Ga0207700_10123679 | Ga0207700_101236792 | 105 |
| 19 | 3300025934 | Ga0207686_10039842 | Ga0207686_100398424 | 105 |
| 20 | 3300025935 | Ga0207709_10426679 | Ga0207709_104266792 | 105 |
| 21 | 3300025961 | Ga0207712_12023926 | Ga0207712_120239262 | 105 |
| 22 | 3300025972 | Ga0207668_10207432 | Ga0207668_102074322 | 105 |
| 23 | 3300026075 | Ga0207708_11338958 | Ga0207708_113389582 | 105 |
| 24 | 3300026078 | Ga0207702_11884835 | Ga0207702_118848352 | 105 |
| 25 | 3300026089 | Ga0207648_10110065 | Ga0207648_101100652 | 105 |
| 26 | 3300005329 | Ga0070683_100000967 | Ga0070683_10000096717 | 107 |
| 27 | 3300005329 | Ga0070683_100087142 | Ga0070683_1000871423 | 107 |
| 28 | 3300005336 | Ga0070680_100057136 | Ga0070680_1000571363 | 107 |
| 29 | 3300005341 | Ga0070691_10000088 | Ga0070691_1000008817 | 107 |
| 30 | 3300005344 | Ga0070661_100096493 | Ga0070661_1000964932 | 107 |
| 31 | 3300005458 | Ga0070681_10003257 | Ga0070681_1000325715 | 107 |
| 32 | 3300005530 | Ga0070679_100001383 | Ga0070679_10000138318 | 107 |
| 33 | 3300005535 | Ga0070684_100001873 | Ga0070684_1000018733 | 107 |
| 34 | 3300005535 | Ga0070684_100044596 | Ga0070684_1000445963 | 107 |
| 35 | 3300005535 | Ga0070684_100680102 | Ga0070684_1006801022 | 107 |
| 36 | 3300005539 | Ga0068853_100082154 | Ga0068853_1000821542 | 107 |
| 37 | 3300005563 | Ga0068855_100039930 | Ga0068855_1000399306 | 107 |
| 38 | 3300005577 | Ga0068857_100013902 | Ga0068857_1000139024 | 107 |
| 39 | 3300005578 | Ga0068854_100492017 | Ga0068854_1004920172 | 107 |
| 40 | 3300005614 | Ga0068856_100016259 | Ga0068856_1000162592 | 107 |
| 41 | 3300005842 | Ga0068858_100049391 | Ga0068858_1000493916 | 107 |
| 42 | 3300006237 | Ga0097621_100355929 | Ga0097621_1003559293 | 107 |
| 43 | 3300006358 | Ga0068871_101335955 | Ga0068871_1013359552 | 107 |
| 44 | 3300009093 | Ga0105240_10010794 | Ga0105240_100107949 | 107 |
| 45 | 3300009093 | Ga0105240_10465892 | Ga0105240_104658922 | 107 |
| 46 | 3300009098 | Ga0105245_10007356 | Ga0105245_1000735613 | 107 |
| 47 | 3300009098 | Ga0105245_11843083 | Ga0105245_118430832 | 107 |
| 48 | 3300009174 | Ga0105241_10019433 | Ga0105241_100194333 | 107 |
| 49 | 3300009174 | Ga0105241_10028909 | Ga0105241_100289092 | 107 |
| 50 | 3300009177 | Ga0105248_10156466 | Ga0105248_101564662 | 107 |
| 51 | 3300009545 | Ga0105237_10039431 | Ga0105237_100394314 | 107 |
| 52 | 3300009551 | Ga0105238_10005455 | Ga0105238_100054559 | 107 |
| 53 | 3300009551 | Ga0105238_10018894 | Ga0105238_100188949 | 107 |
| 54 | 3300009553 | Ga0105249_10001874 | Ga0105249_1000187410 | 107 |
| 55 | 3300010375 | Ga0105239_10008216 | Ga0105239_100082168 | 107 |
| 56 | 3300010375 | Ga0105239_10025651 | Ga0105239_100256513 | 107 |
| 57 | 3300011119 | Ga0105246_10054156 | Ga0105246_100541563 | 107 |
| 58 | 3300011119 | Ga0105246_10629895 | Ga0105246_106298952 | 107 |
| 59 | 3300013102 | Ga0157371_10034931 | Ga0157371_100349313 | 107 |
| 60 | 3300013104 | Ga0157370_10002060 | Ga0157370_100020609 | 107 |
| 61 | 3300013105 | Ga0157369_10001410 | Ga0157369_1000141016 | 107 |
| 62 | 3300013105 | Ga0157369_10291526 | Ga0157369_102915263 | 107 |
| 63 | 3300013296 | Ga0157374_10376306 | Ga0157374_103763061 | 107 |
| 64 | 3300013297 | Ga0157378_11669213 | Ga0157378_116692131 | 107 |
| 65 | 3300013307 | Ga0157372_10000671 | Ga0157372_1000067124 | 107 |
| 66 | 3300013307 | Ga0157372_10323244 | Ga0157372_103232443 | 107 |
| 67 | 3300013308 | Ga0157375_10004889 | Ga0157375_100048899 | 107 |
| 68 | 3300014325 | Ga0163163_11009832 | Ga0163163_110098321 | 107 |
| 69 | 3300014325 | Ga0163163_11088219 | Ga0163163_110882192 | 107 |
| 70 | 3300014745 | Ga0157377_10479879 | Ga0157377_104798791 | 107 |
| 71 | 3300014969 | Ga0157376_10261022 | Ga0157376_102610222 | 107 |
| 72 | 3300025911 | Ga0207654_10016868 | Ga0207654_100168683 | 107 |
| 73 | 3300025912 | Ga0207707_10000835 | Ga0207707_1000083524 | 107 |
| 74 | 3300025912 | Ga0207707_10000925 | Ga0207707_1000092524 | 107 |
| 75 | 3300025913 | Ga0207695_10000790 | Ga0207695_1000079029 | 107 |
| 76 | 3300025913 | Ga0207695_10002118 | Ga0207695_1000211824 | 107 |
| 77 | 3300025913 | Ga0207695_10285820 | Ga0207695_102858202 | 107 |
| 78 | 3300025914 | Ga0207671_10031710 | Ga0207671_100317104 | 107 |
| 79 | 3300025916 | Ga0207663_10274598 | Ga0207663_102745982 | 107 |
| 80 | 3300025917 | Ga0207660_10008302 | Ga0207660_100083029 | 107 |
| 81 | 3300025921 | Ga0207652_10016707 | Ga0207652_100167073 | 107 |
| 82 | 3300025924 | Ga0207694_10000521 | Ga0207694_1000052122 | 107 |
| 83 | 3300025924 | Ga0207694_10017071 | Ga0207694_100170718 | 107 |
| 84 | 3300025927 | Ga0207687_10004103 | Ga0207687_1000410313 | 107 |
| 85 | 3300025927 | Ga0207687_10007146 | Ga0207687_100071469 | 107 |
| 86 | 3300025944 | Ga0207661_10012587 | Ga0207661_100125878 | 107 |
| 87 | 3300025944 | Ga0207661_10328347 | Ga0207661_103283473 | 107 |
| 88 | 3300025949 | Ga0207667_10000563 | Ga0207667_1000056332 | 107 |
| 89 | 3300025961 | Ga0207712_10007406 | Ga0207712_100074062 | 107 |
| 90 | 3300025981 | Ga0207640_10441262 | Ga0207640_104412622 | 107 |
| 91 | 3300026035 | Ga0207703_10095876 | Ga0207703_100958764 | 107 |
| 92 | 3300026041 | Ga0207639_10053790 | Ga0207639_100537902 | 107 |
| 93 | 3300026078 | Ga0207702_10032361 | Ga0207702_100323612 | 107 |
| 94 | 3300026078 | Ga0207702_10267488 | Ga0207702_102674882 | 107 |
| 95 | 3300026116 | Ga0207674_10003599 | Ga0207674_100035994 | 107 |
| 96 | 3300026142 | Ga0207698_10029186 | Ga0207698_100291861 | 107 |
| 97 | 3300035119 | Ga0373956_0180532 | Ga0373956_0180532_124_516 | 107 |
| 98 | 3300046472 | Ga0495580_0765523 | Ga0495580_0765523_35_427 | 107 |
| 99 | 3300048907 | Ga0496104_0105824 | Ga0496104_0105824_1625_2029 | 107 |
| 100 | 3300009098 | Ga0105245_11821013 | Ga0105245_118210131 | 108 |
| 101 | 3300035086 | Ga0373934_0028187 | Ga0373934_0028187_1421_1819 | 108 |
| 102 | 3300035111 | Ga0373923_0026640 | Ga0373923_0026640_129_527 | 108 |
| 103 | 3300035410 | Ga0373924_0057676 | Ga0373924_0057676_554_952 | 108 |
| 104 | 3300035692 | Ga0373935_0406704 | Ga0373935_0406704_173_571 | 108 |
| 105 | 3300035724 | Ga0373933_0029738 | Ga0373933_0029738_2598_2996 | 108 |
| 106 | 3300036401 | Ga0373937_0010975 | Ga0373937_0010975_2072_2470 | 108 |
| 107 | 3300037068 | Ga0373925_1501287 | Ga0373925_1501287_61_459 | 108 |
| 108 | 3300046536 | Ga0495587_0074407 | Ga0495587_0074407_1559_1957 | 108 |
| 109 | 3300046678 | Ga0495599_0186301 | Ga0495599_0186301_323_721 | 108 |
| 110 | 3300053078 | Ga0495612_0076765 | Ga0495612_0076765_407_805 | 108 |
| 111 | 3300053084 | Ga0495595_0191659 | Ga0495595_0191659_30_428 | 108 |
| 112 | 3300036401 | Ga0373937_1523021 | Ga0373937_1523021_118_531 | 109 |
| 113 | 3300046689 | Ga0495613_0139911 | Ga0495613_0139911_1163_1576 | 109 |
| 114 | 3300005340 | Ga0070689_101022016 | Ga0070689_1010220161 | 112 |
| 115 | 3300005547 | Ga0070693_100390918 | Ga0070693_1003909182 | 112 |
| 116 | 3300005841 | Ga0068863_100608440 | Ga0068863_1006084402 | 112 |
| 117 | 3300011119 | Ga0105246_10048178 | Ga0105246_100481783 | 112 |
| 118 | 3300013308 | Ga0157375_10417340 | Ga0157375_104173402 | 112 |
| 119 | 3300026088 | Ga0207641_10358377 | Ga0207641_103583772 | 112 |
| 120 | 3300044712 | Ga0453684_2466744 | Ga0453684_2466744_14_376 | 112 |
| 121 | 3300005329 | Ga0070683_100095844 | Ga0070683_1000958443 | 113 |
| 122 | 3300005458 | Ga0070681_10968740 | Ga0070681_109687401 | 113 |
| 123 | 3300005530 | Ga0070679_100327822 | Ga0070679_1003278222 | 113 |
| 124 | 3300005535 | Ga0070684_100067822 | Ga0070684_1000678223 | 113 |
| 125 | 3300005547 | Ga0070693_100192843 | Ga0070693_1001928432 | 113 |
| 126 | 3300005577 | Ga0068857_100000850 | Ga0068857_10000085015 | 113 |
| 127 | 3300005614 | Ga0068856_102433847 | Ga0068856_1024338472 | 113 |
| 128 | 3300006237 | Ga0097621_100720456 | Ga0097621_1007204562 | 113 |
| 129 | 3300009093 | Ga0105240_10973699 | Ga0105240_109736992 | 113 |
| 130 | 3300009174 | Ga0105241_10308741 | Ga0105241_103087412 | 113 |
| 131 | 3300009551 | Ga0105238_10003062 | Ga0105238_100030629 | 113 |
| 132 | 3300013307 | Ga0157372_10527331 | Ga0157372_105273313 | 113 |
| 133 | 3300014969 | Ga0157376_11834718 | Ga0157376_118347182 | 113 |
| 134 | 3300025911 | Ga0207654_10357533 | Ga0207654_103575332 | 113 |
| 135 | 3300025912 | Ga0207707_11128411 | Ga0207707_111284111 | 113 |
| 136 | 3300025913 | Ga0207695_10522864 | Ga0207695_105228642 | 113 |
| 137 | 3300025914 | Ga0207671_11435891 | Ga0207671_114358911 | 113 |
| 138 | 3300025924 | Ga0207694_10008025 | Ga0207694_100080252 | 113 |
| 139 | 3300025944 | Ga0207661_10030247 | Ga0207661_100302473 | 113 |
| 140 | 3300026041 | Ga0207639_10616845 | Ga0207639_106168452 | 113 |
| 141 | 3300026078 | Ga0207702_10250163 | Ga0207702_102501632 | 113 |
| 142 | 3300026116 | Ga0207674_10001649 | Ga0207674_1000164916 | 113 |
| 143 | 3300006237 | Ga0097621_100036180 | Ga0097621_1000361804 | 114 |
| 144 | 3300009098 | Ga0105245_10014489 | Ga0105245_100144893 | 114 |
| 145 | 3300013297 | Ga0157378_10016658 | Ga0157378_100166589 | 114 |
| 146 | 3300021388 | Ga0213875_10005717 | Ga0213875_100057176 | 114 |
| 147 | 3300025927 | Ga0207687_10004241 | Ga0207687_100042413 | 114 |
| 148 | 3300035118 | Ga0373954_0201567 | Ga0373954_0201567_79_507 | 114 |
| 149 | 3300035692 | Ga0373935_0505490 | Ga0373935_0505490_378_806 | 114 |
| 150 | 3300035724 | Ga0373933_0178920 | Ga0373933_0178920_336_764 | 114 |
| 151 | 3300035725 | Ga0373947_0272906 | Ga0373947_0272906_201_629 | 114 |
| 152 | 3300036401 | Ga0373937_0048480 | Ga0373937_0048480_774_1202 | 114 |
| 153 | 3300037068 | Ga0373925_0108820 | Ga0373925_0108820_1151_1579 | 114 |
| 154 | 3300037853 | Ga0436364_1461867 | Ga0436364_1461867_2829_3224 | 114 |
| 155 | 3300046472 | Ga0495580_0044100 | Ga0495580_0044100_773_1201 | 114 |
| 156 | 3300046517 | Ga0495630_0170333 | Ga0495630_0170333_638_1066 | 114 |
| 157 | 3300046535 | Ga0495586_0611405 | Ga0495586_0611405_79_507 | 114 |
| 158 | 3300047471 | Ga0495684_0062768 | Ga0495684_0062768_2317_2745 | 114 |
| 159 | 3300047673 | Ga0495593_0526437 | Ga0495593_0526437_83_511 | 114 |
| 160 | 3300005439 | Ga0070711_100297167 | Ga0070711_1002971673 | 115 |
| 161 | 3300006358 | Ga0068871_100015189 | Ga0068871_1000151897 | 115 |
| 162 | 3300009177 | Ga0105248_12670205 | Ga0105248_126702051 | 115 |
| 163 | 3300025916 | Ga0207663_10089562 | Ga0207663_100895623 | 115 |
| 164 | 3300025941 | Ga0207711_11245054 | Ga0207711_112450542 | 115 |
| 165 | 3300048917 | Ga0496114_0335845 | Ga0496114_0335845_401_805 | 115 |
| 166 | 3300048918 | Ga0496115_0324169 | Ga0496115_0324169_805_1209 | 115 |
| 167 | 3300005444 | Ga0070694_100421907 | Ga0070694_1004219072 | 116 |
| 168 | 3300035089 | Ga0373944_0021892 | Ga0373944_0021892_1210_1608 | 116 |
| 169 | 3300046473 | Ga0495582_0009225 | Ga0495582_0009225_798_1196 | 116 |
| 170 | 3300046683 | Ga0495658_0020580 | Ga0495658_0020580_1983_2381 | 116 |
| 171 | 3300047471 | Ga0495684_0549117 | Ga0495684_0549117_69_467 | 116 |
| 172 | 3300005471 | Ga0070698_100228458 | Ga0070698_1002284581 | 117 |
| 173 | 3300010159 | Ga0099796_10355392 | Ga0099796_103553921 | 117 |
| 174 | 3300014325 | Ga0163163_10171112 | Ga0163163_101711123 | 117 |
| 175 | 3300035170 | Ga0373943_0093913 | Ga0373943_0093913_383_778 | 117 |
| 176 | 3300037068 | Ga0373925_0082098 | Ga0373925_0082098_25_420 | 117 |
| 177 | 3300046472 | Ga0495580_0024685 | Ga0495580_0024685_3530_3925 | 117 |
| 178 | 3300006173 | Ga0070716_100733305 | Ga0070716_1007333052 | 120 |
| 179 | 3300046529 | Ga0495652_0209937 | Ga0495652_0209937_862_1254 | 120 |
| 180 | 3300005434 | Ga0070709_10055778 | Ga0070709_100557784 | 121 |
| 181 | 3300013296 | Ga0157374_10747762 | Ga0157374_107477622 | 121 |
| 182 | 3300005617 | Ga0068859_100368565 | Ga0068859_1003685653 | 122 |
| 183 | 3300006931 | Ga0097620_100368571 | Ga0097620_1003685713 | 122 |
| 184 | 3300026075 | Ga0207708_10783516 | Ga0207708_107835162 | 122 |
| 185 | 3300053139 | Ga0500568_0000704 | Ga0500568_0000704_6301_6687 | 122 |
| 186 | 3300013104 | Ga0157370_10602413 | Ga0157370_106024131 | 123 |
| 187 | 3300046472 | Ga0495580_0251506 | Ga0495580_0251506_35_448 | 123 |
| 188 | 3300047319 | Ga0495674_0225815 | Ga0495674_0225815_44_457 | 123 |
| 189 | 3300049578 | Ga0501042_1310208 | Ga0501042_1310208_86_487 | 123 |
| 190 | 3300005343 | Ga0070687_100149248 | Ga0070687_1001492483 | 124 |
| 191 | 3300005843 | Ga0068860_100866805 | Ga0068860_1008668052 | 124 |
| 192 | 3300009176 | Ga0105242_10062768 | Ga0105242_100627685 | 124 |
| 193 | 3300025918 | Ga0207662_10117814 | Ga0207662_101178145 | 124 |
| 194 | 3300025934 | Ga0207686_10025959 | Ga0207686_100259593 | 124 |
| 195 | 3300025960 | Ga0207651_10274422 | Ga0207651_102744222 | 124 |
| 196 | 3300028381 | Ga0268264_10564806 | Ga0268264_105648063 | 124 |
| 197 | 3300005434 | Ga0070709_10399351 | Ga0070709_103993512 | 125 |
| 198 | 3300005545 | Ga0070695_100137369 | Ga0070695_1001373691 | 125 |
| 199 | 3300005547 | Ga0070693_100418630 | Ga0070693_1004186302 | 125 |
| 200 | 3300005615 | Ga0070702_101716161 | Ga0070702_1017161611 | 125 |
| 201 | 3300006173 | Ga0070716_100543561 | Ga0070716_1005435612 | 125 |
| 202 | 3300006881 | Ga0068865_100297943 | Ga0068865_1002979432 | 125 |
| 203 | 3300009098 | Ga0105245_10431029 | Ga0105245_104310292 | 125 |
| 204 | 3300009176 | Ga0105242_11361131 | Ga0105242_113611312 | 125 |
| 205 | 3300025934 | Ga0207686_10466891 | Ga0207686_104668912 | 125 |
| 206 | 3300025938 | Ga0207704_10098724 | Ga0207704_100987242 | 125 |
| 207 | 3300028573 | Ga0265334_10240813 | Ga0265334_102408132 | 125 |
| 208 | 3300042876 | Ga0451577_0183468 | Ga0451577_0183468_1284_1739 | 125 |
| 209 | 3300006028 | Ga0070717_10091998 | Ga0070717_100919983 | 126 |
| 210 | 3300025928 | Ga0207700_11785759 | Ga0207700_117857591 | 126 |
| 211 | 3300035086 | Ga0373934_0003272 | Ga0373934_0003272_2183_2575 | 126 |
| 212 | 3300035117 | Ga0373953_0036023 | Ga0373953_0036023_713_1105 | 126 |
| 213 | 3300035118 | Ga0373954_0039439 | Ga0373954_0039439_1565_1957 | 126 |
| 214 | 3300035119 | Ga0373956_0106193 | Ga0373956_0106193_874_1266 | 126 |
| 215 | 3300035120 | Ga0373957_0064013 | Ga0373957_0064013_396_788 | 126 |
| 216 | 3300035172 | Ga0373955_0087261 | Ga0373955_0087261_1342_1734 | 126 |
| 217 | 3300035724 | Ga0373933_0009968 | Ga0373933_0009968_70_462 | 126 |
| 218 | 3300036401 | Ga0373937_0029368 | Ga0373937_0029368_2369_2761 | 126 |
| 219 | 3300036401 | Ga0373937_0378232 | Ga0373937_0378232_232_621 | 126 |
| 220 | 3300046689 | Ga0495613_0501454 | Ga0495613_0501454_29_421 | 126 |
| 221 | 3300047471 | Ga0495684_0009787 | Ga0495684_0009787_3918_4310 | 126 |
| 222 | 3300049822 | Ga0501035_0801289 | Ga0501035_0801289_228_626 | 126 |
| 223 | 3300049823 | Ga0501044_0007244 | Ga0501044_0007244_852_1250 | 126 |
| 224 | 3300049823 | Ga0501044_0030979 | Ga0501044_0030979_1877_2275 | 126 |
| 225 | 3300005458 | Ga0070681_10105217 | Ga0070681_101052173 | 127 |
| 226 | 3300005530 | Ga0070679_100914548 | Ga0070679_1009145482 | 127 |
| 227 | 3300005539 | Ga0068853_100414907 | Ga0068853_1004149072 | 127 |
| 228 | 3300009093 | Ga0105240_10002386 | Ga0105240_100023869 | 127 |
| 229 | 3300009545 | Ga0105237_10003915 | Ga0105237_100039159 | 127 |
| 230 | 3300013307 | Ga0157372_12262183 | Ga0157372_122621832 | 127 |
| 231 | 3300025912 | Ga0207707_10678733 | Ga0207707_106787332 | 127 |
| 232 | 3300025913 | Ga0207695_10017129 | Ga0207695_100171297 | 127 |
| 233 | 3300025914 | Ga0207671_10049956 | Ga0207671_100499563 | 127 |
| 234 | 3300025917 | Ga0207660_11034053 | Ga0207660_110340532 | 127 |
| 235 | 3300025939 | Ga0207665_10443353 | Ga0207665_104433532 | 127 |
| 236 | 3300047471 | Ga0495684_0297875 | Ga0495684_0297875_229_621 | 127 |
| 237 | 3300005437 | Ga0070710_10462355 | Ga0070710_104623552 | 128 |
| 238 | 3300044712 | Ga0453684_0435969 | Ga0453684_0435969_646_1068 | 128 |
| 239 | 3300045051 | Ga0451576_0122022 | Ga0451576_0122022_1282_1704 | 128 |
| 240 | 3300005436 | Ga0070713_100468563 | Ga0070713_1004685632 | 129 |
| 241 | 3300006914 | Ga0075436_100448860 | Ga0075436_1004488602 | 129 |
| 242 | 3300021388 | Ga0213875_10065615 | Ga0213875_100656152 | 129 |
| 243 | 3300035083 | Ga0373926_0268515 | Ga0373926_0268515_36_428 | 129 |
| 244 | 3300035692 | Ga0373935_0161411 | Ga0373935_0161411_746_1138 | 129 |
| 245 | 3300035695 | Ga0373927_0002123 | Ga0373927_0002123_5315_5707 | 129 |
| 246 | 3300037853 | Ga0436364_0320230 | Ga0436364_0320230_2116_2526 | 129 |
| 247 | 3300044901 | Ga0466960_0224367 | Ga0466960_0224367_312_719 | 129 |
| 248 | 3300048918 | Ga0496115_0054652 | Ga0496115_0054652_1591_2010 | 129 |
| 249 | 3300005458 | Ga0070681_10679614 | Ga0070681_106796142 | 130 |
| 250 | 3300005563 | Ga0068855_101373077 | Ga0068855_1013730772 | 130 |
| 251 | 3300009093 | Ga0105240_10225127 | Ga0105240_102251272 | 130 |
| 252 | 3300013105 | Ga0157369_10638677 | Ga0157369_106386772 | 130 |
| 253 | 3300021384 | Ga0213876_10014242 | Ga0213876_100142425 | 130 |
| 254 | 3300021388 | Ga0213875_10024583 | Ga0213875_100245833 | 130 |
| 255 | 3300025912 | Ga0207707_10942776 | Ga0207707_109427761 | 130 |
| 256 | 3300028800 | Ga0265338_10130644 | Ga0265338_101306443 | 130 |
| 257 | 3300035111 | Ga0373923_0097485 | Ga0373923_0097485_853_1254 | 130 |
| 258 | 3300035118 | Ga0373954_0131492 | Ga0373954_0131492_228_629 | 130 |
| 259 | 3300035120 | Ga0373957_0278038 | Ga0373957_0278038_270_671 | 130 |
| 260 | 3300035170 | Ga0373943_0275600 | Ga0373943_0275600_242_643 | 130 |
| 261 | 3300035692 | Ga0373935_0010261 | Ga0373935_0010261_4869_5270 | 130 |
| 262 | 3300035692 | Ga0373935_0526832 | Ga0373935_0526832_20_415 | 130 |
| 263 | 3300035695 | Ga0373927_0032080 | Ga0373927_0032080_1375_1770 | 130 |
| 264 | 3300035724 | Ga0373933_0306494 | Ga0373933_0306494_546_941 | 130 |
| 265 | 3300035724 | Ga0373933_1190225 | Ga0373933_1190225_81_482 | 130 |
| 266 | 3300035725 | Ga0373947_0377978 | Ga0373947_0377978_502_897 | 130 |
| 267 | 3300036401 | Ga0373937_0037960 | Ga0373937_0037960_3942_4343 | 130 |
| 268 | 3300037068 | Ga0373925_0930137 | Ga0373925_0930137_212_613 | 130 |
| 269 | 3300037471 | Ga0395905_1779329 | Ga0395905_1779329_82_492 | 130 |
| 270 | 3300037853 | Ga0436364_1065030 | Ga0436364_1065030_12275_12673 | 130 |
| 271 | 3300039437 | Ga0436365_0395688 | Ga0436365_0395688_579_986 | 130 |
| 272 | 3300039437 | Ga0436365_0574946 | Ga0436365_0574946_2040_2438 | 130 |
| 273 | 3300039437 | Ga0436365_0761374 | Ga0436365_0761374_169_561 | 130 |
| 274 | 3300046462 | Ga0495651_0661356 | Ga0495651_0661356_114_509 | 130 |
| 275 | 3300046472 | Ga0495580_0011083 | Ga0495580_0011083_3370_3765 | 130 |
| 276 | 3300009177 | Ga0105248_10386658 | Ga0105248_103866582 | 131 |
| 277 | 3300037853 | Ga0436364_0457458 | Ga0436364_0457458_242_649 | 131 |
| 278 | 3300037853 | Ga0436364_0736713 | Ga0436364_0736713_216_611 | 131 |
| 279 | 3300005434 | Ga0070709_10193355 | Ga0070709_101933553 | 132 |
| 280 | 3300005435 | Ga0070714_100024506 | Ga0070714_1000245063 | 132 |
| 281 | 3300005436 | Ga0070713_100015152 | Ga0070713_1000151525 | 132 |
| 282 | 3300005439 | Ga0070711_100134549 | Ga0070711_1001345493 | 132 |
| 283 | 3300006175 | Ga0070712_100173456 | Ga0070712_1001734562 | 132 |
| 284 | 3300025906 | Ga0207699_10023434 | Ga0207699_100234342 | 132 |
| 285 | 3300025927 | Ga0207687_10404280 | Ga0207687_104042802 | 132 |
| 286 | 3300025928 | Ga0207700_10005080 | Ga0207700_100050805 | 132 |
| 287 | 3300025929 | Ga0207664_10013222 | Ga0207664_100132227 | 132 |
| 288 | 3300035695 | Ga0373927_0447373 | Ga0373927_0447373_415_822 | 132 |
| 289 | 3300035725 | Ga0373947_0306956 | Ga0373947_0306956_212_619 | 132 |
| 290 | 3300037068 | Ga0373925_1400701 | Ga0373925_1400701_106_513 | 132 |
| 291 | 3300046472 | Ga0495580_0264530 | Ga0495580_0264530_745_1152 | 132 |
| 292 | 3300049571 | Ga0501034_0045455 | Ga0501034_0045455_54_470 | 132 |
| 293 | 3300049573 | Ga0501037_0148548 | Ga0501037_0148548_1190_1606 | 132 |
| 294 | 3300049574 | Ga0501038_0040064 | Ga0501038_0040064_1485_1901 | 132 |
| 295 | 3300049579 | Ga0501043_0013913 | Ga0501043_0013913_5383_5799 | 132 |
| 296 | 3300049580 | Ga0501046_0217447 | Ga0501046_0217447_800_1216 | 132 |
| 297 | 3300049581 | Ga0501047_0028792 | Ga0501047_0028792_988_1404 | 132 |
| 298 | 3300049582 | Ga0501048_0129942 | Ga0501048_0129942_1288_1704 | 132 |
| 299 | 3300049590 | Ga0501074_0374414 | Ga0501074_0374414_13_429 | 132 |
| 300 | 3300049822 | Ga0501035_0010913 | Ga0501035_0010913_4912_5328 | 132 |
| 301 | 3300049823 | Ga0501044_0003837 | Ga0501044_0003837_14297_14713 | 132 |
| 302 | 3300005530 | Ga0070679_101236426 | Ga0070679_1012364261 | 133 |
| 303 | 3300021388 | Ga0213875_10116307 | Ga0213875_101163072 | 133 |
| 304 | 3300025915 | Ga0207693_10284988 | Ga0207693_102849882 | 133 |
| 305 | 3300031344 | Ga0265316_10019066 | Ga0265316_100190668 | 133 |
| 306 | 3300031712 | Ga0265342_10114441 | Ga0265342_101144413 | 133 |
| 307 | 3300037853 | Ga0436364_0959300 | Ga0436364_0959300_542_961 | 133 |
| 308 | 3300044694 | Ga0466963_0485764 | Ga0466963_0485764_392_829 | 133 |
| 309 | 3300009098 | Ga0105245_12126112 | Ga0105245_121261121 | 134 |
| 310 | 3300037853 | Ga0436364_0278639 | Ga0436364_0278639_31_438 | 134 |
| 311 | 3300005445 | Ga0070708_100621546 | Ga0070708_1006215462 | 135 |
| 312 | 3300005468 | Ga0070707_100432636 | Ga0070707_1004326362 | 135 |
| 313 | 3300005471 | Ga0070698_100383018 | Ga0070698_1003830182 | 135 |
| 314 | 3300005518 | Ga0070699_100505274 | Ga0070699_1005052742 | 135 |
| 315 | 3300005536 | Ga0070697_100123995 | Ga0070697_1001239953 | 135 |
| 316 | 3300044656 | Ga0466969_0359848 | Ga0466969_0359848_90_497 | 135 |
| 317 | 3300005563 | Ga0068855_101350246 | Ga0068855_1013502462 | 136 |
| 318 | 3300006028 | Ga0070717_10242915 | Ga0070717_102429152 | 136 |
| 319 | 3300009545 | Ga0105237_10240139 | Ga0105237_102401392 | 136 |
| 320 | 3300025914 | Ga0207671_10223240 | Ga0207671_102232403 | 136 |
| 321 | 3300026041 | Ga0207639_11119850 | Ga0207639_111198502 | 136 |
| 322 | 3300005335 | Ga0070666_10294437 | Ga0070666_102944372 | 137 |
| 323 | 3300005338 | Ga0068868_100504914 | Ga0068868_1005049142 | 137 |
| 324 | 3300005459 | Ga0068867_100740598 | Ga0068867_1007405982 | 137 |
| 325 | 3300005548 | Ga0070665_100380408 | Ga0070665_1003804082 | 137 |
| 326 | 3300009093 | Ga0105240_10321409 | Ga0105240_103214092 | 137 |
| 327 | 3300009098 | Ga0105245_10336156 | Ga0105245_103361562 | 137 |
| 328 | 3300009176 | Ga0105242_10153369 | Ga0105242_101533693 | 137 |
| 329 | 3300009177 | Ga0105248_10664532 | Ga0105248_106645322 | 137 |
| 330 | 3300009553 | Ga0105249_11497568 | Ga0105249_114975681 | 137 |
| 331 | 3300010375 | Ga0105239_10503207 | Ga0105239_105032072 | 137 |
| 332 | 3300025913 | Ga0207695_10084060 | Ga0207695_100840603 | 137 |
| 333 | 3300025941 | Ga0207711_10933432 | Ga0207711_109334322 | 137 |
| 334 | 3300025961 | Ga0207712_11521260 | Ga0207712_115212602 | 137 |
| 335 | 3300026023 | Ga0207677_10479522 | Ga0207677_104795223 | 137 |
| 336 | 3300026035 | Ga0207703_10114108 | Ga0207703_101141082 | 137 |
| 337 | 3300026089 | Ga0207648_11087826 | Ga0207648_110878262 | 137 |
| 338 | 3300028379 | Ga0268266_10444005 | Ga0268266_104440052 | 137 |
| 339 | 3300005563 | Ga0068855_100209392 | Ga0068855_1002093923 | 139 |
| 340 | 3300013104 | Ga0157370_10244005 | Ga0157370_102440052 | 139 |
| 341 | 3300013105 | Ga0157369_10314894 | Ga0157369_103148943 | 139 |
| 342 | 3300025906 | Ga0207699_11206087 | Ga0207699_112060872 | 139 |
| 343 | 3300025949 | Ga0207667_10293280 | Ga0207667_102932802 | 139 |
| 344 | 3300025914 | Ga0207671_10996196 | Ga0207671_109961962 | 140 |
| 345 | 3300005327 | Ga0070658_11652065 | Ga0070658_116520651 | 142 |
| 346 | 3300025909 | Ga0207705_11173133 | Ga0207705_111731331 | 142 |
| 347 | 3300005367 | Ga0070667_100686510 | Ga0070667_1006865102 | 144 |
| 348 | 3300005564 | Ga0070664_100888515 | Ga0070664_1008885152 | 144 |
| 349 | 3300005577 | Ga0068857_100917950 | Ga0068857_1009179502 | 144 |
| 350 | 3300025945 | Ga0207679_11010263 | Ga0207679_110102632 | 144 |
| 351 | 3300026041 | Ga0207639_11066960 | Ga0207639_110669602 | 144 |
| 352 | 3300005327 | Ga0070658_11544026 | Ga0070658_115440261 | 147 |
| 353 | 3300005539 | Ga0068853_100941883 | Ga0068853_1009418832 | 147 |
| 354 | 3300009551 | Ga0105238_10138941 | Ga0105238_101389413 | 147 |
| 355 | 3300025909 | Ga0207705_11199951 | Ga0207705_111999512 | 147 |
| 356 | 3300025919 | Ga0207657_10375359 | Ga0207657_103753592 | 147 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar