F420386

General Info

Members Datasets Scaffolds Average Seq Length
356 174 356 123

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_11544026|Ga0070658_115440261
Length 147
Sequence MIIAIASILAIAVLGFILTVRPEDLPVPEPVSPFAHLDERKSAIYDNLRDAQFEYRVGKLSDEDYQQTKLGLQKELAVVMAEIDRIKATLPTPAMESAKGARGTGSKPAVPKASAAANVNVCPSCGAQFAQSLKFCGECGKSMKVRA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 1.12
Rhizosphere 94.38
Stem 0
Stem Tuber 0
Unclassified 4.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_11544026 3300005327 Unclassified 576
2 Ga0070658_11652065 3300005327 Unclassified 555
3 Ga0070683_100000967 3300005329 Bacteria 21380
4 Ga0070683_100087142 3300005329 Unclassified 2928
5 Ga0070683_100095844 3300005329 Bacteria 2790
6 Ga0070683_100818928 3300005329 Unclassified 893
7 Ga0070666_10294437 3300005335 Unclassified 1155
8 Ga0070680_100057136 3300005336 Bacteria 3190
9 Ga0068868_100504914 3300005338 Unclassified 1060
10 Ga0070689_101022016 3300005340 Unclassified 736
11 Ga0070691_10000088 3300005341 Bacteria 26073
12 Ga0070687_100149248 3300005343 Bacteria 1370
13 Ga0070661_100096493 3300005344 Bacteria 2194
14 Ga0070668_100225825 3300005347 Bacteria 1546
15 Ga0070667_100686510 3300005367 Unclassified 947
16 Ga0070709_10055778 3300005434 Bacteria 2496
17 Ga0070709_10193355 3300005434 Bacteria 1437
18 Ga0070709_10399351 3300005434 Unclassified 1026
19 Ga0070714_100024506 3300005435 Bacteria 4970
20 Ga0070713_100015152 3300005436 Bacteria 5748
21 Ga0070713_100137323 3300005436 Unclassified 2162
22 Ga0070713_100468563 3300005436 Unclassified 1185
23 Ga0070710_10462355 3300005437 Unclassified 862
24 Ga0070711_100134549 3300005439 Bacteria 1845
25 Ga0070711_100297167 3300005439 Bacteria 1283
26 Ga0070700_101499708 3300005441 Unclassified 573
27 Ga0070694_100421907 3300005444 Unclassified 1048
28 Ga0070708_100621546 3300005445 Unclassified 1018
29 Ga0070681_10003257 3300005458 Bacteria 15139
30 Ga0070681_10105217 3300005458 Bacteria 2764
31 Ga0070681_10679614 3300005458 Bacteria 945
32 Ga0070681_10968740 3300005458 Unclassified 770
33 Ga0068867_100040614 3300005459 Bacteria 3397
34 Ga0068867_100740598 3300005459 Unclassified 871
35 Ga0070707_100432636 3300005468 Unclassified 1276
36 Ga0070698_100228458 3300005471 Bacteria 1794
37 Ga0070698_100383018 3300005471 Unclassified 1339
38 Ga0070699_100505274 3300005518 Unclassified 1098
39 Ga0070679_100001383 3300005530 Bacteria 21358
40 Ga0070679_100327822 3300005530 Bacteria 1480
41 Ga0070679_100914548 3300005530 Unclassified 821
42 Ga0070679_101236426 3300005530 Bacteria 692
43 Ga0070684_100001873 3300005535 Bacteria 15400
44 Ga0070684_100044596 3300005535 Bacteria 3836
45 Ga0070684_100067822 3300005535 Bacteria 3134
46 Ga0070684_100680102 3300005535 Bacteria 959
47 Ga0070697_100123995 3300005536 Unclassified 2163
48 Ga0068853_100082154 3300005539 Bacteria 2822
49 Ga0068853_100414907 3300005539 Bacteria 1262
50 Ga0068853_100941883 3300005539 Bacteria 830
51 Ga0070695_100137369 3300005545 Unclassified 1691
52 Ga0070693_100192843 3300005547 Bacteria 1319
53 Ga0070693_100390918 3300005547 Bacteria 962
54 Ga0070693_100418630 3300005547 Bacteria 933
55 Ga0070665_100380408 3300005548 Unclassified 1419
56 Ga0068855_100039930 3300005563 Bacteria 5571
57 Ga0068855_100209392 3300005563 Bacteria 2192
58 Ga0068855_101350246 3300005563 Bacteria 736
59 Ga0068855_101373077 3300005563 Unclassified 729
60 Ga0070664_100888515 3300005564 Unclassified 835
61 Ga0068857_100000850 3300005577 Bacteria 22895
62 Ga0068857_100013902 3300005577 Bacteria 7008
63 Ga0068857_100917950 3300005577 Unclassified 840
64 Ga0068854_100492017 3300005578 Unclassified 1031
65 Ga0068856_100016259 3300005614 Bacteria 7198
66 Ga0068856_102433847 3300005614 Bacteria 531
67 Ga0070702_101716161 3300005615 Unclassified 522
68 Ga0068859_100104975 3300005617 Bacteria 2885
69 Ga0068859_100368565 3300005617 Bacteria 1532
70 Ga0068861_100899074 3300005719 Bacteria 838
71 Ga0068863_100608440 3300005841 Unclassified 1082
72 Ga0068858_100049391 3300005842 Bacteria 3896
73 Ga0068860_100866805 3300005843 Bacteria 918
74 Ga0070717_10091998 3300006028 Bacteria 2562
75 Ga0070717_10242915 3300006028 Bacteria 1588
76 Ga0070716_100543561 3300006173 Unclassified 865
77 Ga0070716_100733305 3300006173 Bacteria 758
78 Ga0070712_100173456 3300006175 Bacteria 1675
79 Ga0097621_100036180 3300006237 Bacteria 3950
80 Ga0097621_100355929 3300006237 Unclassified 1303
81 Ga0097621_100720456 3300006237 Unclassified 920
82 Ga0068871_100015189 3300006358 Bacteria 5758
83 Ga0068871_101335955 3300006358 Unclassified 675
84 Ga0068865_100297943 3300006881 Unclassified 1290
85 Ga0075436_100448860 3300006914 Bacteria 939
86 Ga0097620_100104975 3300006931 Bacteria 2885
87 Ga0097620_100368571 3300006931 Bacteria 1532
88 Ga0105240_10002386 3300009093 Bacteria 30286
89 Ga0105240_10010794 3300009093 Bacteria 12802
90 Ga0105240_10225127 3300009093 Bacteria 2183
91 Ga0105240_10321409 3300009093 Bacteria 1764
92 Ga0105240_10465892 3300009093 Bacteria 1411
93 Ga0105240_10973699 3300009093 Unclassified 909
94 Ga0105245_10007356 3300009098 Bacteria 9642
95 Ga0105245_10014489 3300009098 Bacteria 6866
96 Ga0105245_10336156 3300009098 Bacteria 1492
97 Ga0105245_10431029 3300009098 Bacteria 1323
98 Ga0105245_11821013 3300009098 Unclassified 662
99 Ga0105245_11843083 3300009098 Bacteria 658
100 Ga0105245_12126112 3300009098 Bacteria 615
101 Ga0105245_13234713 3300009098 Unclassified 505
102 Ga0105243_10143268 3300009148 Bacteria 2041
103 Ga0105241_10019433 3300009174 Bacteria 5009
104 Ga0105241_10028909 3300009174 Bacteria 4131
105 Ga0105241_10308741 3300009174 Unclassified 1360
106 Ga0105242_10055226 3300009176 Bacteria 3249
107 Ga0105242_10062768 3300009176 Bacteria 3058
108 Ga0105242_10153369 3300009176 Unclassified 2011
109 Ga0105242_11361131 3300009176 Bacteria 736
110 Ga0105248_10156466 3300009177 Bacteria 2572
111 Ga0105248_10386658 3300009177 Bacteria 1575
112 Ga0105248_10664532 3300009177 Unclassified 1176
113 Ga0105248_12670205 3300009177 Unclassified 569
114 Ga0105237_10003915 3300009545 Bacteria 17441
115 Ga0105237_10039431 3300009545 Bacteria 4769
116 Ga0105237_10240139 3300009545 Bacteria 1813
117 Ga0105237_10263632 3300009545 Unclassified 1726
118 Ga0105238_10003062 3300009551 Bacteria 16671
119 Ga0105238_10005455 3300009551 Bacteria 12566
120 Ga0105238_10018894 3300009551 Bacteria 7018
121 Ga0105238_10138941 3300009551 Bacteria 2407
122 Ga0105249_10001874 3300009553 Bacteria 18219
123 Ga0105249_10470457 3300009553 Bacteria 1298
124 Ga0105249_11497568 3300009553 Unclassified 747
125 Ga0099796_10355392 3300010159 Bacteria 633
126 Ga0105239_10008216 3300010375 Bacteria 11905
127 Ga0105239_10025651 3300010375 Bacteria 6491
128 Ga0105239_10503207 3300010375 Bacteria 1377
129 Ga0105246_10048178 3300011119 Bacteria 2913
130 Ga0105246_10054156 3300011119 Bacteria 2763
131 Ga0105246_10629895 3300011119 Unclassified 931
132 Ga0157373_10430053 3300013100 Unclassified 948
133 Ga0157371_10034931 3300013102 Bacteria 3605
134 Ga0157370_10002060 3300013104 Bacteria 24636
135 Ga0157370_10244005 3300013104 Bacteria 1662
136 Ga0157370_10602413 3300013104 Bacteria 1006
137 Ga0157369_10001410 3300013105 Bacteria 29531
138 Ga0157369_10291526 3300013105 Bacteria 1699
139 Ga0157369_10314894 3300013105 Bacteria 1627
140 Ga0157369_10638677 3300013105 Bacteria 1098
141 Ga0157374_10376306 3300013296 Bacteria 1414
142 Ga0157374_10747762 3300013296 Bacteria 992
143 Ga0157378_10016658 3300013297 Bacteria 6440
144 Ga0157378_11669213 3300013297 Unclassified 684
145 Ga0157372_10000671 3300013307 Bacteria 37684
146 Ga0157372_10323244 3300013307 Bacteria 1796
147 Ga0157372_10527331 3300013307 Unclassified 1377
148 Ga0157372_12262183 3300013307 Unclassified 624
149 Ga0157375_10004889 3300013308 Bacteria 11645
150 Ga0157375_10417340 3300013308 Unclassified 1508
151 Ga0163163_10171112 3300014325 Bacteria 2219
152 Ga0163163_11009832 3300014325 Unclassified 895
153 Ga0163163_11088219 3300014325 Bacteria 862
154 Ga0157377_10479879 3300014745 Bacteria 865
155 Ga0157376_10261022 3300014969 Bacteria 1623
156 Ga0157376_11834718 3300014969 Unclassified 643
157 Ga0213876_10014242 3300021384 Bacteria 4216
158 Ga0213875_10005717 3300021388 Bacteria 6624
159 Ga0213875_10024583 3300021388 Bacteria 2872
160 Ga0213875_10065615 3300021388 Bacteria 1696
161 Ga0213875_10116307 3300021388 Bacteria 1249
162 Ga0207699_10023434 3300025906 Bacteria 3360
163 Ga0207699_11206087 3300025906 Unclassified 560
164 Ga0207705_11173133 3300025909 Unclassified 590
165 Ga0207705_11199951 3300025909 Unclassified 582
166 Ga0207654_10016868 3300025911 Bacteria 3810
167 Ga0207654_10357533 3300025911 Unclassified 1007
168 Ga0207707_10000835 3300025912 Bacteria 30284
169 Ga0207707_10000925 3300025912 Bacteria 28483
170 Ga0207707_10678733 3300025912 Unclassified 866
171 Ga0207707_10942776 3300025912 Unclassified 711
172 Ga0207707_11128411 3300025912 Unclassified 638
173 Ga0207695_10000790 3300025913 Bacteria 59450
174 Ga0207695_10002118 3300025913 Bacteria 30141
175 Ga0207695_10017129 3300025913 Bacteria 8447
176 Ga0207695_10084060 3300025913 Bacteria 3214
177 Ga0207695_10285820 3300025913 Bacteria 1542
178 Ga0207695_10522864 3300025913 Unclassified 1068
179 Ga0207671_10031710 3300025914 Unclassified 3938
180 Ga0207671_10049956 3300025914 Bacteria 3097
181 Ga0207671_10124825 3300025914 Unclassified 1970
182 Ga0207671_10223240 3300025914 Bacteria 1476
183 Ga0207671_10996196 3300025914 Unclassified 660
184 Ga0207671_11435891 3300025914 Unclassified 534
185 Ga0207693_10284988 3300025915 Bacteria 1294
186 Ga0207663_10089562 3300025916 Bacteria 2038
187 Ga0207663_10274598 3300025916 Unclassified 1250
188 Ga0207660_10008302 3300025917 Bacteria 6711
189 Ga0207660_11034053 3300025917 Unclassified 670
190 Ga0207662_10117814 3300025918 Bacteria 1662
191 Ga0207657_10375359 3300025919 Bacteria 1120
192 Ga0207652_10016707 3300025921 Bacteria 5996
193 Ga0207694_10000521 3300025924 Bacteria 34747
194 Ga0207694_10008025 3300025924 Bacteria 7984
195 Ga0207694_10017071 3300025924 Bacteria 5483
196 Ga0207687_10004103 3300025927 Bacteria 9761
197 Ga0207687_10004241 3300025927 Bacteria 9584
198 Ga0207687_10007146 3300025927 Bacteria 7361
199 Ga0207687_10404280 3300025927 Unclassified 1124
200 Ga0207687_11427806 3300025927 Unclassified 595
201 Ga0207700_10005080 3300025928 Bacteria 7824
202 Ga0207700_10123679 3300025928 Unclassified 2101
203 Ga0207700_11785759 3300025928 Unclassified 541
204 Ga0207664_10013222 3300025929 Bacteria 5915
205 Ga0207686_10025959 3300025934 Bacteria 3415
206 Ga0207686_10039842 3300025934 Bacteria 2852
207 Ga0207686_10466891 3300025934 Bacteria 974
208 Ga0207709_10426679 3300025935 Unclassified 1020
209 Ga0207704_10098724 3300025938 Bacteria 1941
210 Ga0207665_10443353 3300025939 Unclassified 995
211 Ga0207711_10933432 3300025941 Unclassified 806
212 Ga0207711_11245054 3300025941 Unclassified 686
213 Ga0207661_10012587 3300025944 Bacteria 6154
214 Ga0207661_10030247 3300025944 Bacteria 4169
215 Ga0207661_10328347 3300025944 Unclassified 1376
216 Ga0207679_11010263 3300025945 Unclassified 762
217 Ga0207667_10000563 3300025949 Bacteria 48455
218 Ga0207667_10293280 3300025949 Bacteria 1662
219 Ga0207651_10274422 3300025960 Unclassified 1390
220 Ga0207712_10007406 3300025961 Bacteria 6930
221 Ga0207712_11521260 3300025961 Unclassified 599
222 Ga0207712_12023926 3300025961 Unclassified 515
223 Ga0207668_10207432 3300025972 Bacteria 1565
224 Ga0207640_10441262 3300025981 Unclassified 1070
225 Ga0207677_10479522 3300026023 Unclassified 1071
226 Ga0207703_10095876 3300026035 Bacteria 2503
227 Ga0207703_10114108 3300026035 Unclassified 2310
228 Ga0207639_10053790 3300026041 Bacteria 3073
229 Ga0207639_10616845 3300026041 Unclassified 1001
230 Ga0207639_11066960 3300026041 Bacteria 757
231 Ga0207639_11119850 3300026041 Bacteria 738
232 Ga0207708_10783516 3300026075 Unclassified 820
233 Ga0207708_11338958 3300026075 Unclassified 628
234 Ga0207702_10032361 3300026078 Bacteria 4364
235 Ga0207702_10250163 3300026078 Bacteria 1664
236 Ga0207702_10267488 3300026078 Bacteria 1612
237 Ga0207702_11884835 3300026078 Unclassified 589
238 Ga0207641_10358377 3300026088 Unclassified 1392
239 Ga0207648_10110065 3300026089 Bacteria 2418
240 Ga0207648_11087826 3300026089 Unclassified 750
241 Ga0207674_10001649 3300026116 Bacteria 28706
242 Ga0207674_10003599 3300026116 Bacteria 18894
243 Ga0207698_10029186 3300026142 Bacteria 3946
244 Ga0268266_10444005 3300028379 Unclassified 1232
245 Ga0268264_10564806 3300028381 Bacteria 1118
246 Ga0265334_10240813 3300028573 Bacteria 624
247 Ga0265338_10130644 3300028800 Bacteria 1984
248 Ga0265316_10019066 3300031344 Bacteria 5878
249 Ga0265342_10114441 3300031712 Bacteria 1524
250 Ga0373926_0268515 3300035083 Unclassified 663
251 Ga0373934_0003272 3300035086 Bacteria 5927
252 Ga0373934_0028187 3300035086 Bacteria 2186
253 Ga0373944_0021892 3300035089 Bacteria 1854
254 Ga0373923_0026640 3300035111 Bacteria 2301
255 Ga0373923_0097485 3300035111 Bacteria 1293
256 Ga0373953_0036023 3300035117 Bacteria 1947
257 Ga0373954_0039439 3300035118 Bacteria 2198
258 Ga0373954_0131492 3300035118 Unclassified 1218
259 Ga0373954_0201567 3300035118 Bacteria 978
260 Ga0373956_0106193 3300035119 Bacteria 1305
261 Ga0373956_0180532 3300035119 Unclassified 998
262 Ga0373957_0064013 3300035120 Bacteria 1429
263 Ga0373957_0278038 3300035120 Unclassified 707
264 Ga0373943_0093913 3300035170 Unclassified 1558
265 Ga0373943_0275600 3300035170 Unclassified 950
266 Ga0373955_0087261 3300035172 Bacteria 1773
267 Ga0373924_0057676 3300035410 Unclassified 1620
268 Ga0373935_0010261 3300035692 Bacteria 5615
269 Ga0373935_0161411 3300035692 Bacteria 1528
270 Ga0373935_0406704 3300035692 Bacteria 978
271 Ga0373935_0505490 3300035692 Bacteria 878
272 Ga0373935_0526832 3300035692 Bacteria 860
273 Ga0373927_0002123 3300035695 Bacteria 14611
274 Ga0373927_0032080 3300035695 Bacteria 3422
275 Ga0373927_0447373 3300035695 Bacteria 853
276 Ga0373933_0009968 3300035724 Bacteria 5202
277 Ga0373933_0029738 3300035724 Bacteria 3161
278 Ga0373933_0178920 3300035724 Bacteria 1352
279 Ga0373933_0306494 3300035724 Bacteria 1029
280 Ga0373933_0579907 3300035724 Bacteria 736
281 Ga0373933_1190225 3300035724 Unclassified 502
282 Ga0373947_0272906 3300035725 Bacteria 1123
283 Ga0373947_0306956 3300035725 Unclassified 1059
284 Ga0373947_0377978 3300035725 Bacteria 953
285 Ga0373937_0010975 3300036401 Bacteria 7936
286 Ga0373937_0029368 3300036401 Bacteria 4979
287 Ga0373937_0037960 3300036401 Bacteria 4390
288 Ga0373937_0048480 3300036401 Bacteria 3889
289 Ga0373937_0378232 3300036401 Bacteria 1343
290 Ga0373937_1523021 3300036401 Bacteria 616
291 Ga0373925_0082098 3300037068 Bacteria 2452
292 Ga0373925_0108820 3300037068 Bacteria 2139
293 Ga0373925_0930137 3300037068 Unclassified 716
294 Ga0373925_1400701 3300037068 Bacteria 573
295 Ga0373925_1501287 3300037068 Bacteria 551
296 Ga0395905_1779329 3300037471 Unclassified 522
297 Ga0436364_0278639 3300037853 Unclassified 527
298 Ga0436364_0320230 3300037853 Bacteria 4168
299 Ga0436364_0457458 3300037853 Bacteria 889
300 Ga0436364_0736713 3300037853 Bacteria 1844
301 Ga0436364_0959300 3300037853 Bacteria 1234
302 Ga0436364_1065030 3300037853 Bacteria 28547
303 Ga0436364_1461867 3300037853 Bacteria 7682
304 Ga0436365_0395688 3300039437 Unclassified 1124
305 Ga0436365_0574946 3300039437 Bacteria 6864
306 Ga0436365_0761374 3300039437 Unclassified 1080
307 Ga0451577_0183468 3300042876 Bacteria 1887
308 Ga0466969_0359848 3300044656 Unclassified 659
309 Ga0466963_0485764 3300044694 Bacteria 872
310 Ga0453684_0435969 3300044712 Bacteria 1461
311 Ga0453684_2466744 3300044712 Bacteria 514
312 Ga0466960_0224367 3300044901 Unclassified 1035
313 Ga0451576_0122022 3300045051 Bacteria 2714
314 Ga0495651_0661356 3300046462 Bacteria 654
315 Ga0495580_0011083 3300046472 Bacteria 6986
316 Ga0495580_0024685 3300046472 Bacteria 4398
317 Ga0495580_0044100 3300046472 Bacteria 3173
318 Ga0495580_0251506 3300046472 Unclassified 1210
319 Ga0495580_0264530 3300046472 Bacteria 1176
320 Ga0495580_0765523 3300046472 Unclassified 628
321 Ga0495582_0009225 3300046473 Bacteria 5442
322 Ga0495630_0170333 3300046517 Bacteria 1659
323 Ga0495652_0209937 3300046529 Unclassified 1471
324 Ga0495586_0611405 3300046535 Unclassified 630
325 Ga0495587_0074407 3300046536 Bacteria 1973
326 Ga0495599_0186301 3300046678 Bacteria 1278
327 Ga0495658_0020580 3300046683 Bacteria 3465
328 Ga0495613_0139911 3300046689 Bacteria 1730
329 Ga0495613_0501454 3300046689 Bacteria 817
330 Ga0495674_0225815 3300047319 Unclassified 1547
331 Ga0495684_0009787 3300047471 Bacteria 7398
332 Ga0495684_0062768 3300047471 Bacteria 2826
333 Ga0495684_0297875 3300047471 Unclassified 1159
334 Ga0495684_0549117 3300047471 Unclassified 787
335 Ga0495593_0526437 3300047673 Bacteria 593
336 Ga0496104_0105824 3300048907 Bacteria 2696
337 Ga0496114_0335845 3300048917 Bacteria 1336
338 Ga0496115_0054652 3300048918 Bacteria 3207
339 Ga0496115_0324169 3300048918 Unclassified 1259
340 Ga0501034_0045455 3300049571 Bacteria 4437
341 Ga0501037_0148548 3300049573 Unclassified 1676
342 Ga0501038_0040064 3300049574 Bacteria 4095
343 Ga0501042_1310208 3300049578 Unclassified 528
344 Ga0501043_0013913 3300049579 Bacteria 6296
345 Ga0501046_0217447 3300049580 Unclassified 1416
346 Ga0501047_0028792 3300049581 Bacteria 5357
347 Ga0501048_0129942 3300049582 Unclassified 1781
348 Ga0501074_0374414 3300049590 Unclassified 1010
349 Ga0501035_0010913 3300049822 Bacteria 8412
350 Ga0501035_0801289 3300049822 Unclassified 752
351 Ga0501044_0003837 3300049823 Bacteria 16861
352 Ga0501044_0007244 3300049823 Bacteria 12196
353 Ga0501044_0030979 3300049823 Bacteria 5633
354 Ga0495612_0076765 3300053078 Bacteria 1400
355 Ga0495595_0191659 3300053084 Bacteria 1016
356 Ga0500568_0000704 3300053139 Bacteria 23996

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10430053 Ga0157373_104300532 103
2 3300035724 Ga0373933_0579907 Ga0373933_0579907_26_346 103
3 3300005329 Ga0070683_100818928 Ga0070683_1008189282 105
4 3300005347 Ga0070668_100225825 Ga0070668_1002258252 105
5 3300005436 Ga0070713_100137323 Ga0070713_1001373233 105
6 3300005441 Ga0070700_101499708 Ga0070700_1014997081 105
7 3300005459 Ga0068867_100040614 Ga0068867_1000406142 105
8 3300005617 Ga0068859_100104975 Ga0068859_1001049753 105
9 3300005719 Ga0068861_100899074 Ga0068861_1008990742 105
10 3300006931 Ga0097620_100104975 Ga0097620_1001049753 105
11 3300009098 Ga0105245_13234713 Ga0105245_132347131 105
12 3300009148 Ga0105243_10143268 Ga0105243_101432682 105
13 3300009176 Ga0105242_10055226 Ga0105242_100552263 105
14 3300009545 Ga0105237_10263632 Ga0105237_102636322 105
15 3300009553 Ga0105249_10470457 Ga0105249_104704572 105
16 3300025914 Ga0207671_10124825 Ga0207671_101248252 105
17 3300025927 Ga0207687_11427806 Ga0207687_114278062 105
18 3300025928 Ga0207700_10123679 Ga0207700_101236792 105
19 3300025934 Ga0207686_10039842 Ga0207686_100398424 105
20 3300025935 Ga0207709_10426679 Ga0207709_104266792 105
21 3300025961 Ga0207712_12023926 Ga0207712_120239262 105
22 3300025972 Ga0207668_10207432 Ga0207668_102074322 105
23 3300026075 Ga0207708_11338958 Ga0207708_113389582 105
24 3300026078 Ga0207702_11884835 Ga0207702_118848352 105
25 3300026089 Ga0207648_10110065 Ga0207648_101100652 105
26 3300005329 Ga0070683_100000967 Ga0070683_10000096717 107
27 3300005329 Ga0070683_100087142 Ga0070683_1000871423 107
28 3300005336 Ga0070680_100057136 Ga0070680_1000571363 107
29 3300005341 Ga0070691_10000088 Ga0070691_1000008817 107
30 3300005344 Ga0070661_100096493 Ga0070661_1000964932 107
31 3300005458 Ga0070681_10003257 Ga0070681_1000325715 107
32 3300005530 Ga0070679_100001383 Ga0070679_10000138318 107
33 3300005535 Ga0070684_100001873 Ga0070684_1000018733 107
34 3300005535 Ga0070684_100044596 Ga0070684_1000445963 107
35 3300005535 Ga0070684_100680102 Ga0070684_1006801022 107
36 3300005539 Ga0068853_100082154 Ga0068853_1000821542 107
37 3300005563 Ga0068855_100039930 Ga0068855_1000399306 107
38 3300005577 Ga0068857_100013902 Ga0068857_1000139024 107
39 3300005578 Ga0068854_100492017 Ga0068854_1004920172 107
40 3300005614 Ga0068856_100016259 Ga0068856_1000162592 107
41 3300005842 Ga0068858_100049391 Ga0068858_1000493916 107
42 3300006237 Ga0097621_100355929 Ga0097621_1003559293 107
43 3300006358 Ga0068871_101335955 Ga0068871_1013359552 107
44 3300009093 Ga0105240_10010794 Ga0105240_100107949 107
45 3300009093 Ga0105240_10465892 Ga0105240_104658922 107
46 3300009098 Ga0105245_10007356 Ga0105245_1000735613 107
47 3300009098 Ga0105245_11843083 Ga0105245_118430832 107
48 3300009174 Ga0105241_10019433 Ga0105241_100194333 107
49 3300009174 Ga0105241_10028909 Ga0105241_100289092 107
50 3300009177 Ga0105248_10156466 Ga0105248_101564662 107
51 3300009545 Ga0105237_10039431 Ga0105237_100394314 107
52 3300009551 Ga0105238_10005455 Ga0105238_100054559 107
53 3300009551 Ga0105238_10018894 Ga0105238_100188949 107
54 3300009553 Ga0105249_10001874 Ga0105249_1000187410 107
55 3300010375 Ga0105239_10008216 Ga0105239_100082168 107
56 3300010375 Ga0105239_10025651 Ga0105239_100256513 107
57 3300011119 Ga0105246_10054156 Ga0105246_100541563 107
58 3300011119 Ga0105246_10629895 Ga0105246_106298952 107
59 3300013102 Ga0157371_10034931 Ga0157371_100349313 107
60 3300013104 Ga0157370_10002060 Ga0157370_100020609 107
61 3300013105 Ga0157369_10001410 Ga0157369_1000141016 107
62 3300013105 Ga0157369_10291526 Ga0157369_102915263 107
63 3300013296 Ga0157374_10376306 Ga0157374_103763061 107
64 3300013297 Ga0157378_11669213 Ga0157378_116692131 107
65 3300013307 Ga0157372_10000671 Ga0157372_1000067124 107
66 3300013307 Ga0157372_10323244 Ga0157372_103232443 107
67 3300013308 Ga0157375_10004889 Ga0157375_100048899 107
68 3300014325 Ga0163163_11009832 Ga0163163_110098321 107
69 3300014325 Ga0163163_11088219 Ga0163163_110882192 107
70 3300014745 Ga0157377_10479879 Ga0157377_104798791 107
71 3300014969 Ga0157376_10261022 Ga0157376_102610222 107
72 3300025911 Ga0207654_10016868 Ga0207654_100168683 107
73 3300025912 Ga0207707_10000835 Ga0207707_1000083524 107
74 3300025912 Ga0207707_10000925 Ga0207707_1000092524 107
75 3300025913 Ga0207695_10000790 Ga0207695_1000079029 107
76 3300025913 Ga0207695_10002118 Ga0207695_1000211824 107
77 3300025913 Ga0207695_10285820 Ga0207695_102858202 107
78 3300025914 Ga0207671_10031710 Ga0207671_100317104 107
79 3300025916 Ga0207663_10274598 Ga0207663_102745982 107
80 3300025917 Ga0207660_10008302 Ga0207660_100083029 107
81 3300025921 Ga0207652_10016707 Ga0207652_100167073 107
82 3300025924 Ga0207694_10000521 Ga0207694_1000052122 107
83 3300025924 Ga0207694_10017071 Ga0207694_100170718 107
84 3300025927 Ga0207687_10004103 Ga0207687_1000410313 107
85 3300025927 Ga0207687_10007146 Ga0207687_100071469 107
86 3300025944 Ga0207661_10012587 Ga0207661_100125878 107
87 3300025944 Ga0207661_10328347 Ga0207661_103283473 107
88 3300025949 Ga0207667_10000563 Ga0207667_1000056332 107
89 3300025961 Ga0207712_10007406 Ga0207712_100074062 107
90 3300025981 Ga0207640_10441262 Ga0207640_104412622 107
91 3300026035 Ga0207703_10095876 Ga0207703_100958764 107
92 3300026041 Ga0207639_10053790 Ga0207639_100537902 107
93 3300026078 Ga0207702_10032361 Ga0207702_100323612 107
94 3300026078 Ga0207702_10267488 Ga0207702_102674882 107
95 3300026116 Ga0207674_10003599 Ga0207674_100035994 107
96 3300026142 Ga0207698_10029186 Ga0207698_100291861 107
97 3300035119 Ga0373956_0180532 Ga0373956_0180532_124_516 107
98 3300046472 Ga0495580_0765523 Ga0495580_0765523_35_427 107
99 3300048907 Ga0496104_0105824 Ga0496104_0105824_1625_2029 107
100 3300009098 Ga0105245_11821013 Ga0105245_118210131 108
101 3300035086 Ga0373934_0028187 Ga0373934_0028187_1421_1819 108
102 3300035111 Ga0373923_0026640 Ga0373923_0026640_129_527 108
103 3300035410 Ga0373924_0057676 Ga0373924_0057676_554_952 108
104 3300035692 Ga0373935_0406704 Ga0373935_0406704_173_571 108
105 3300035724 Ga0373933_0029738 Ga0373933_0029738_2598_2996 108
106 3300036401 Ga0373937_0010975 Ga0373937_0010975_2072_2470 108
107 3300037068 Ga0373925_1501287 Ga0373925_1501287_61_459 108
108 3300046536 Ga0495587_0074407 Ga0495587_0074407_1559_1957 108
109 3300046678 Ga0495599_0186301 Ga0495599_0186301_323_721 108
110 3300053078 Ga0495612_0076765 Ga0495612_0076765_407_805 108
111 3300053084 Ga0495595_0191659 Ga0495595_0191659_30_428 108
112 3300036401 Ga0373937_1523021 Ga0373937_1523021_118_531 109
113 3300046689 Ga0495613_0139911 Ga0495613_0139911_1163_1576 109
114 3300005340 Ga0070689_101022016 Ga0070689_1010220161 112
115 3300005547 Ga0070693_100390918 Ga0070693_1003909182 112
116 3300005841 Ga0068863_100608440 Ga0068863_1006084402 112
117 3300011119 Ga0105246_10048178 Ga0105246_100481783 112
118 3300013308 Ga0157375_10417340 Ga0157375_104173402 112
119 3300026088 Ga0207641_10358377 Ga0207641_103583772 112
120 3300044712 Ga0453684_2466744 Ga0453684_2466744_14_376 112
121 3300005329 Ga0070683_100095844 Ga0070683_1000958443 113
122 3300005458 Ga0070681_10968740 Ga0070681_109687401 113
123 3300005530 Ga0070679_100327822 Ga0070679_1003278222 113
124 3300005535 Ga0070684_100067822 Ga0070684_1000678223 113
125 3300005547 Ga0070693_100192843 Ga0070693_1001928432 113
126 3300005577 Ga0068857_100000850 Ga0068857_10000085015 113
127 3300005614 Ga0068856_102433847 Ga0068856_1024338472 113
128 3300006237 Ga0097621_100720456 Ga0097621_1007204562 113
129 3300009093 Ga0105240_10973699 Ga0105240_109736992 113
130 3300009174 Ga0105241_10308741 Ga0105241_103087412 113
131 3300009551 Ga0105238_10003062 Ga0105238_100030629 113
132 3300013307 Ga0157372_10527331 Ga0157372_105273313 113
133 3300014969 Ga0157376_11834718 Ga0157376_118347182 113
134 3300025911 Ga0207654_10357533 Ga0207654_103575332 113
135 3300025912 Ga0207707_11128411 Ga0207707_111284111 113
136 3300025913 Ga0207695_10522864 Ga0207695_105228642 113
137 3300025914 Ga0207671_11435891 Ga0207671_114358911 113
138 3300025924 Ga0207694_10008025 Ga0207694_100080252 113
139 3300025944 Ga0207661_10030247 Ga0207661_100302473 113
140 3300026041 Ga0207639_10616845 Ga0207639_106168452 113
141 3300026078 Ga0207702_10250163 Ga0207702_102501632 113
142 3300026116 Ga0207674_10001649 Ga0207674_1000164916 113
143 3300006237 Ga0097621_100036180 Ga0097621_1000361804 114
144 3300009098 Ga0105245_10014489 Ga0105245_100144893 114
145 3300013297 Ga0157378_10016658 Ga0157378_100166589 114
146 3300021388 Ga0213875_10005717 Ga0213875_100057176 114
147 3300025927 Ga0207687_10004241 Ga0207687_100042413 114
148 3300035118 Ga0373954_0201567 Ga0373954_0201567_79_507 114
149 3300035692 Ga0373935_0505490 Ga0373935_0505490_378_806 114
150 3300035724 Ga0373933_0178920 Ga0373933_0178920_336_764 114
151 3300035725 Ga0373947_0272906 Ga0373947_0272906_201_629 114
152 3300036401 Ga0373937_0048480 Ga0373937_0048480_774_1202 114
153 3300037068 Ga0373925_0108820 Ga0373925_0108820_1151_1579 114
154 3300037853 Ga0436364_1461867 Ga0436364_1461867_2829_3224 114
155 3300046472 Ga0495580_0044100 Ga0495580_0044100_773_1201 114
156 3300046517 Ga0495630_0170333 Ga0495630_0170333_638_1066 114
157 3300046535 Ga0495586_0611405 Ga0495586_0611405_79_507 114
158 3300047471 Ga0495684_0062768 Ga0495684_0062768_2317_2745 114
159 3300047673 Ga0495593_0526437 Ga0495593_0526437_83_511 114
160 3300005439 Ga0070711_100297167 Ga0070711_1002971673 115
161 3300006358 Ga0068871_100015189 Ga0068871_1000151897 115
162 3300009177 Ga0105248_12670205 Ga0105248_126702051 115
163 3300025916 Ga0207663_10089562 Ga0207663_100895623 115
164 3300025941 Ga0207711_11245054 Ga0207711_112450542 115
165 3300048917 Ga0496114_0335845 Ga0496114_0335845_401_805 115
166 3300048918 Ga0496115_0324169 Ga0496115_0324169_805_1209 115
167 3300005444 Ga0070694_100421907 Ga0070694_1004219072 116
168 3300035089 Ga0373944_0021892 Ga0373944_0021892_1210_1608 116
169 3300046473 Ga0495582_0009225 Ga0495582_0009225_798_1196 116
170 3300046683 Ga0495658_0020580 Ga0495658_0020580_1983_2381 116
171 3300047471 Ga0495684_0549117 Ga0495684_0549117_69_467 116
172 3300005471 Ga0070698_100228458 Ga0070698_1002284581 117
173 3300010159 Ga0099796_10355392 Ga0099796_103553921 117
174 3300014325 Ga0163163_10171112 Ga0163163_101711123 117
175 3300035170 Ga0373943_0093913 Ga0373943_0093913_383_778 117
176 3300037068 Ga0373925_0082098 Ga0373925_0082098_25_420 117
177 3300046472 Ga0495580_0024685 Ga0495580_0024685_3530_3925 117
178 3300006173 Ga0070716_100733305 Ga0070716_1007333052 120
179 3300046529 Ga0495652_0209937 Ga0495652_0209937_862_1254 120
180 3300005434 Ga0070709_10055778 Ga0070709_100557784 121
181 3300013296 Ga0157374_10747762 Ga0157374_107477622 121
182 3300005617 Ga0068859_100368565 Ga0068859_1003685653 122
183 3300006931 Ga0097620_100368571 Ga0097620_1003685713 122
184 3300026075 Ga0207708_10783516 Ga0207708_107835162 122
185 3300053139 Ga0500568_0000704 Ga0500568_0000704_6301_6687 122
186 3300013104 Ga0157370_10602413 Ga0157370_106024131 123
187 3300046472 Ga0495580_0251506 Ga0495580_0251506_35_448 123
188 3300047319 Ga0495674_0225815 Ga0495674_0225815_44_457 123
189 3300049578 Ga0501042_1310208 Ga0501042_1310208_86_487 123
190 3300005343 Ga0070687_100149248 Ga0070687_1001492483 124
191 3300005843 Ga0068860_100866805 Ga0068860_1008668052 124
192 3300009176 Ga0105242_10062768 Ga0105242_100627685 124
193 3300025918 Ga0207662_10117814 Ga0207662_101178145 124
194 3300025934 Ga0207686_10025959 Ga0207686_100259593 124
195 3300025960 Ga0207651_10274422 Ga0207651_102744222 124
196 3300028381 Ga0268264_10564806 Ga0268264_105648063 124
197 3300005434 Ga0070709_10399351 Ga0070709_103993512 125
198 3300005545 Ga0070695_100137369 Ga0070695_1001373691 125
199 3300005547 Ga0070693_100418630 Ga0070693_1004186302 125
200 3300005615 Ga0070702_101716161 Ga0070702_1017161611 125
201 3300006173 Ga0070716_100543561 Ga0070716_1005435612 125
202 3300006881 Ga0068865_100297943 Ga0068865_1002979432 125
203 3300009098 Ga0105245_10431029 Ga0105245_104310292 125
204 3300009176 Ga0105242_11361131 Ga0105242_113611312 125
205 3300025934 Ga0207686_10466891 Ga0207686_104668912 125
206 3300025938 Ga0207704_10098724 Ga0207704_100987242 125
207 3300028573 Ga0265334_10240813 Ga0265334_102408132 125
208 3300042876 Ga0451577_0183468 Ga0451577_0183468_1284_1739 125
209 3300006028 Ga0070717_10091998 Ga0070717_100919983 126
210 3300025928 Ga0207700_11785759 Ga0207700_117857591 126
211 3300035086 Ga0373934_0003272 Ga0373934_0003272_2183_2575 126
212 3300035117 Ga0373953_0036023 Ga0373953_0036023_713_1105 126
213 3300035118 Ga0373954_0039439 Ga0373954_0039439_1565_1957 126
214 3300035119 Ga0373956_0106193 Ga0373956_0106193_874_1266 126
215 3300035120 Ga0373957_0064013 Ga0373957_0064013_396_788 126
216 3300035172 Ga0373955_0087261 Ga0373955_0087261_1342_1734 126
217 3300035724 Ga0373933_0009968 Ga0373933_0009968_70_462 126
218 3300036401 Ga0373937_0029368 Ga0373937_0029368_2369_2761 126
219 3300036401 Ga0373937_0378232 Ga0373937_0378232_232_621 126
220 3300046689 Ga0495613_0501454 Ga0495613_0501454_29_421 126
221 3300047471 Ga0495684_0009787 Ga0495684_0009787_3918_4310 126
222 3300049822 Ga0501035_0801289 Ga0501035_0801289_228_626 126
223 3300049823 Ga0501044_0007244 Ga0501044_0007244_852_1250 126
224 3300049823 Ga0501044_0030979 Ga0501044_0030979_1877_2275 126
225 3300005458 Ga0070681_10105217 Ga0070681_101052173 127
226 3300005530 Ga0070679_100914548 Ga0070679_1009145482 127
227 3300005539 Ga0068853_100414907 Ga0068853_1004149072 127
228 3300009093 Ga0105240_10002386 Ga0105240_100023869 127
229 3300009545 Ga0105237_10003915 Ga0105237_100039159 127
230 3300013307 Ga0157372_12262183 Ga0157372_122621832 127
231 3300025912 Ga0207707_10678733 Ga0207707_106787332 127
232 3300025913 Ga0207695_10017129 Ga0207695_100171297 127
233 3300025914 Ga0207671_10049956 Ga0207671_100499563 127
234 3300025917 Ga0207660_11034053 Ga0207660_110340532 127
235 3300025939 Ga0207665_10443353 Ga0207665_104433532 127
236 3300047471 Ga0495684_0297875 Ga0495684_0297875_229_621 127
237 3300005437 Ga0070710_10462355 Ga0070710_104623552 128
238 3300044712 Ga0453684_0435969 Ga0453684_0435969_646_1068 128
239 3300045051 Ga0451576_0122022 Ga0451576_0122022_1282_1704 128
240 3300005436 Ga0070713_100468563 Ga0070713_1004685632 129
241 3300006914 Ga0075436_100448860 Ga0075436_1004488602 129
242 3300021388 Ga0213875_10065615 Ga0213875_100656152 129
243 3300035083 Ga0373926_0268515 Ga0373926_0268515_36_428 129
244 3300035692 Ga0373935_0161411 Ga0373935_0161411_746_1138 129
245 3300035695 Ga0373927_0002123 Ga0373927_0002123_5315_5707 129
246 3300037853 Ga0436364_0320230 Ga0436364_0320230_2116_2526 129
247 3300044901 Ga0466960_0224367 Ga0466960_0224367_312_719 129
248 3300048918 Ga0496115_0054652 Ga0496115_0054652_1591_2010 129
249 3300005458 Ga0070681_10679614 Ga0070681_106796142 130
250 3300005563 Ga0068855_101373077 Ga0068855_1013730772 130
251 3300009093 Ga0105240_10225127 Ga0105240_102251272 130
252 3300013105 Ga0157369_10638677 Ga0157369_106386772 130
253 3300021384 Ga0213876_10014242 Ga0213876_100142425 130
254 3300021388 Ga0213875_10024583 Ga0213875_100245833 130
255 3300025912 Ga0207707_10942776 Ga0207707_109427761 130
256 3300028800 Ga0265338_10130644 Ga0265338_101306443 130
257 3300035111 Ga0373923_0097485 Ga0373923_0097485_853_1254 130
258 3300035118 Ga0373954_0131492 Ga0373954_0131492_228_629 130
259 3300035120 Ga0373957_0278038 Ga0373957_0278038_270_671 130
260 3300035170 Ga0373943_0275600 Ga0373943_0275600_242_643 130
261 3300035692 Ga0373935_0010261 Ga0373935_0010261_4869_5270 130
262 3300035692 Ga0373935_0526832 Ga0373935_0526832_20_415 130
263 3300035695 Ga0373927_0032080 Ga0373927_0032080_1375_1770 130
264 3300035724 Ga0373933_0306494 Ga0373933_0306494_546_941 130
265 3300035724 Ga0373933_1190225 Ga0373933_1190225_81_482 130
266 3300035725 Ga0373947_0377978 Ga0373947_0377978_502_897 130
267 3300036401 Ga0373937_0037960 Ga0373937_0037960_3942_4343 130
268 3300037068 Ga0373925_0930137 Ga0373925_0930137_212_613 130
269 3300037471 Ga0395905_1779329 Ga0395905_1779329_82_492 130
270 3300037853 Ga0436364_1065030 Ga0436364_1065030_12275_12673 130
271 3300039437 Ga0436365_0395688 Ga0436365_0395688_579_986 130
272 3300039437 Ga0436365_0574946 Ga0436365_0574946_2040_2438 130
273 3300039437 Ga0436365_0761374 Ga0436365_0761374_169_561 130
274 3300046462 Ga0495651_0661356 Ga0495651_0661356_114_509 130
275 3300046472 Ga0495580_0011083 Ga0495580_0011083_3370_3765 130
276 3300009177 Ga0105248_10386658 Ga0105248_103866582 131
277 3300037853 Ga0436364_0457458 Ga0436364_0457458_242_649 131
278 3300037853 Ga0436364_0736713 Ga0436364_0736713_216_611 131
279 3300005434 Ga0070709_10193355 Ga0070709_101933553 132
280 3300005435 Ga0070714_100024506 Ga0070714_1000245063 132
281 3300005436 Ga0070713_100015152 Ga0070713_1000151525 132
282 3300005439 Ga0070711_100134549 Ga0070711_1001345493 132
283 3300006175 Ga0070712_100173456 Ga0070712_1001734562 132
284 3300025906 Ga0207699_10023434 Ga0207699_100234342 132
285 3300025927 Ga0207687_10404280 Ga0207687_104042802 132
286 3300025928 Ga0207700_10005080 Ga0207700_100050805 132
287 3300025929 Ga0207664_10013222 Ga0207664_100132227 132
288 3300035695 Ga0373927_0447373 Ga0373927_0447373_415_822 132
289 3300035725 Ga0373947_0306956 Ga0373947_0306956_212_619 132
290 3300037068 Ga0373925_1400701 Ga0373925_1400701_106_513 132
291 3300046472 Ga0495580_0264530 Ga0495580_0264530_745_1152 132
292 3300049571 Ga0501034_0045455 Ga0501034_0045455_54_470 132
293 3300049573 Ga0501037_0148548 Ga0501037_0148548_1190_1606 132
294 3300049574 Ga0501038_0040064 Ga0501038_0040064_1485_1901 132
295 3300049579 Ga0501043_0013913 Ga0501043_0013913_5383_5799 132
296 3300049580 Ga0501046_0217447 Ga0501046_0217447_800_1216 132
297 3300049581 Ga0501047_0028792 Ga0501047_0028792_988_1404 132
298 3300049582 Ga0501048_0129942 Ga0501048_0129942_1288_1704 132
299 3300049590 Ga0501074_0374414 Ga0501074_0374414_13_429 132
300 3300049822 Ga0501035_0010913 Ga0501035_0010913_4912_5328 132
301 3300049823 Ga0501044_0003837 Ga0501044_0003837_14297_14713 132
302 3300005530 Ga0070679_101236426 Ga0070679_1012364261 133
303 3300021388 Ga0213875_10116307 Ga0213875_101163072 133
304 3300025915 Ga0207693_10284988 Ga0207693_102849882 133
305 3300031344 Ga0265316_10019066 Ga0265316_100190668 133
306 3300031712 Ga0265342_10114441 Ga0265342_101144413 133
307 3300037853 Ga0436364_0959300 Ga0436364_0959300_542_961 133
308 3300044694 Ga0466963_0485764 Ga0466963_0485764_392_829 133
309 3300009098 Ga0105245_12126112 Ga0105245_121261121 134
310 3300037853 Ga0436364_0278639 Ga0436364_0278639_31_438 134
311 3300005445 Ga0070708_100621546 Ga0070708_1006215462 135
312 3300005468 Ga0070707_100432636 Ga0070707_1004326362 135
313 3300005471 Ga0070698_100383018 Ga0070698_1003830182 135
314 3300005518 Ga0070699_100505274 Ga0070699_1005052742 135
315 3300005536 Ga0070697_100123995 Ga0070697_1001239953 135
316 3300044656 Ga0466969_0359848 Ga0466969_0359848_90_497 135
317 3300005563 Ga0068855_101350246 Ga0068855_1013502462 136
318 3300006028 Ga0070717_10242915 Ga0070717_102429152 136
319 3300009545 Ga0105237_10240139 Ga0105237_102401392 136
320 3300025914 Ga0207671_10223240 Ga0207671_102232403 136
321 3300026041 Ga0207639_11119850 Ga0207639_111198502 136
322 3300005335 Ga0070666_10294437 Ga0070666_102944372 137
323 3300005338 Ga0068868_100504914 Ga0068868_1005049142 137
324 3300005459 Ga0068867_100740598 Ga0068867_1007405982 137
325 3300005548 Ga0070665_100380408 Ga0070665_1003804082 137
326 3300009093 Ga0105240_10321409 Ga0105240_103214092 137
327 3300009098 Ga0105245_10336156 Ga0105245_103361562 137
328 3300009176 Ga0105242_10153369 Ga0105242_101533693 137
329 3300009177 Ga0105248_10664532 Ga0105248_106645322 137
330 3300009553 Ga0105249_11497568 Ga0105249_114975681 137
331 3300010375 Ga0105239_10503207 Ga0105239_105032072 137
332 3300025913 Ga0207695_10084060 Ga0207695_100840603 137
333 3300025941 Ga0207711_10933432 Ga0207711_109334322 137
334 3300025961 Ga0207712_11521260 Ga0207712_115212602 137
335 3300026023 Ga0207677_10479522 Ga0207677_104795223 137
336 3300026035 Ga0207703_10114108 Ga0207703_101141082 137
337 3300026089 Ga0207648_11087826 Ga0207648_110878262 137
338 3300028379 Ga0268266_10444005 Ga0268266_104440052 137
339 3300005563 Ga0068855_100209392 Ga0068855_1002093923 139
340 3300013104 Ga0157370_10244005 Ga0157370_102440052 139
341 3300013105 Ga0157369_10314894 Ga0157369_103148943 139
342 3300025906 Ga0207699_11206087 Ga0207699_112060872 139
343 3300025949 Ga0207667_10293280 Ga0207667_102932802 139
344 3300025914 Ga0207671_10996196 Ga0207671_109961962 140
345 3300005327 Ga0070658_11652065 Ga0070658_116520651 142
346 3300025909 Ga0207705_11173133 Ga0207705_111731331 142
347 3300005367 Ga0070667_100686510 Ga0070667_1006865102 144
348 3300005564 Ga0070664_100888515 Ga0070664_1008885152 144
349 3300005577 Ga0068857_100917950 Ga0068857_1009179502 144
350 3300025945 Ga0207679_11010263 Ga0207679_110102632 144
351 3300026041 Ga0207639_11066960 Ga0207639_110669602 144
352 3300005327 Ga0070658_11544026 Ga0070658_115440261 147
353 3300005539 Ga0068853_100941883 Ga0068853_1009418832 147
354 3300009551 Ga0105238_10138941 Ga0105238_101389413 147
355 3300025909 Ga0207705_11199951 Ga0207705_111999512 147
356 3300025919 Ga0207657_10375359 Ga0207657_103753592 147

Feature Viewer

pLDDT pTM Quality
73.05 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map