F420168

General Info

Members Datasets Scaffolds Average Seq Length
355 258 710 378

Family's Representative Sequence

Representative Sequence 3300026023|Ga0207677_10004154|Ga0207677_100041544
Length 467
Sequence MVGPWANSCPAYAGSVVTPEQVTAALASVRDPEIRRPITELNMVKDVRVDPNGTVTVGVYLTVAGCPLRDTITRDVTAAVSPLDGVSSVRVDLDVMSPEQRKALQEQLRGPGRVENEIPFAKPGSLTRVYAVASGKGGVGKSSLTVNLAVALADRGRTVGVVDADIYGHSVPRMLGVTGQPTQVEQMILPPQANGVRVISIGMFTPGNSPVVWRGPMLHRALQQFLADVYWGDLDVLLLDLPPGTGDIAISVAQLVPSAELLVVTTPQVAAQEVAERAGAIALQTHQQIVGVVENMSWWEQPDGSRVELFGSGGGAAVAASLSRLTGASVPLLGQVPIDQRLREGGDAGVPIVASAPDSPAAIALGEIADRLAARQRGLAGLQLGLSPATPLTPPHRPAGRAPTGLATSLGGRPARAGEAVLSGYVSAPPGEQRHSRRVCDGQPLPGPPLPRPVGAAGVPVGTAPVC

Samples

Sample ID Description Type Environment
1 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
121 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
122 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
123 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
124 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
127 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
128 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
129 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
130 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
131 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
132 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
133 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
134 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
139 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
204 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
205 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
206 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
207 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
208 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
209 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
210 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
211 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
212 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
213 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
214 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
215 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
216 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
217 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
218 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
219 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
220 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
221 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
222 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
223 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
224 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
225 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
226 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
227 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
228 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
229 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
230 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
231 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
232 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
233 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
234 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
235 2922554459 Rhodococcus sp. 66b Isolate Unclassified
236 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
237 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
238 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
239 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
240 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
241 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
242 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
243 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
244 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
245 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
246 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
247 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
248 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
249 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
250 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
251 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
252 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
253 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
254 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
255 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
256 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
257 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
258 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.94
Metatranscriptomes 0.28
Isolates 15.77

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 1.97
Nodule 0
Rhizoplane 10.99
Rhizosphere 78.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207677_10004154 3300026023 Bacteria 7749
2 LJQas_1000396 3300000549 Bacteria 7341
3 LJQas_1005357 3300000549 Bacteria 1633
4 JGI25152J39213_1000687 3300002773 Bacteria 17647
5 Ga0065714_10009923 3300005288 Bacteria 5333
6 Ga0070683_100202372 3300005329 Bacteria 1886
7 Ga0070670_100024161 3300005331 Bacteria 5229
8 Ga0068869_100037147 3300005334 Bacteria 3462
9 Ga0070680_100066610 3300005336 Bacteria 2953
10 Ga0070682_100045674 3300005337 Bacteria 2716
11 Ga0068868_100010506 3300005338 Bacteria 6708
12 Ga0070660_100094244 3300005339 Bacteria 2365
13 Ga0070689_100125802 3300005340 Bacteria 2051
14 Ga0070691_10003926 3300005341 Bacteria 6728
15 Ga0070669_100047416 3300005353 Bacteria 3134
16 Ga0070671_100000423 3300005355 Bacteria 29409
17 Ga0070671_100038229 3300005355 Bacteria 3984
18 Ga0070674_100237643 3300005356 Bacteria 1425
19 Ga0070659_100056659 3300005366 Bacteria 3090
20 Ga0070667_100039624 3300005367 Bacteria 3950
21 Ga0070709_10089825 3300005434 Bacteria 2024
22 Ga0070714_100027706 3300005435 Bacteria 4695
23 Ga0070713_100056883 3300005436 Bacteria 3254
24 Ga0070711_100005145 3300005439 Bacteria 7793
25 Ga0070663_100004764 3300005455 Bacteria 8004
26 Ga0070678_100001811 3300005456 Bacteria 11520
27 Ga0070678_100050161 3300005456 Bacteria 3017
28 Ga0070681_10120531 3300005458 Bacteria 2558
29 Ga0070664_100162881 3300005564 Bacteria 1974
30 Ga0068854_100094297 3300005578 Bacteria 2232
31 Ga0068856_100061096 3300005614 Bacteria 3722
32 Ga0070702_100017023 3300005615 Bacteria 3742
33 Ga0068852_100003907 3300005616 Bacteria 10471
34 Ga0068852_100237055 3300005616 Bacteria 1742
35 Ga0068859_100018104 3300005617 Bacteria 7081
36 Ga0068864_100020358 3300005618 Bacteria 5550
37 Ga0068864_100148966 3300005618 Bacteria 2118
38 Ga0068851_10104885 3300005834 Bacteria 1503
39 Ga0068870_10000378 3300005840 Bacteria 16740
40 Ga0068863_100003154 3300005841 Bacteria 16278
41 Ga0075432_10002093 3300006058 Bacteria 6644
42 Ga0097621_100133051 3300006237 Bacteria 2118
43 Ga0068871_100021222 3300006358 Bacteria 4989
44 Ga0075431_100115517 3300006847 Bacteria 2771
45 Ga0075433_10020121 3300006852 Bacteria 5573
46 Ga0075434_100039067 3300006871 Bacteria 4703
47 Ga0075436_100021210 3300006914 Bacteria 4457
48 Ga0097620_100018103 3300006931 Bacteria 7081
49 Ga0075435_100049543 3300007076 Bacteria 3379
50 Ga0105244_10038017 3300009036 Bacteria 2512
51 Ga0105240_10092708 3300009093 Bacteria 3688
52 Ga0111539_10254395 3300009094 Bacteria 2045
53 Ga0105245_10009937 3300009098 Bacteria 8290
54 Ga0105247_10004708 3300009101 Bacteria 8695
55 Ga0105243_10000243 3300009148 Bacteria 62451
56 Ga0105243_10010786 3300009148 Bacteria 6917
57 Ga0105242_10172897 3300009176 Bacteria 1900
58 Ga0105248_10001229 3300009177 Bacteria 28583
59 Ga0105248_10139088 3300009177 Bacteria 2739
60 Ga0105237_10185905 3300009545 Bacteria 2078
61 Ga0105246_10001005 3300011119 Bacteria 16194
62 Ga0105246_10001940 3300011119 Bacteria 12488
63 Ga0105246_10002771 3300011119 Bacteria 10610
64 Ga0105246_10029956 3300011119 Bacteria 3589
65 Ga0105246_10071429 3300011119 Bacteria 2444
66 Ga0105246_10249921 3300011119 Bacteria 1407
67 Ga0157371_10017375 3300013102 Bacteria 5346
68 Ga0157370_10008743 3300013104 Bacteria 10889
69 Ga0157370_10065726 3300013104 Bacteria 3431
70 Ga0157369_10042050 3300013105 Bacteria 4986
71 Ga0157369_10060252 3300013105 Bacteria 4093
72 Ga0157369_10092208 3300013105 Bacteria 3233
73 Ga0157369_10136512 3300013105 Bacteria 2596
74 Ga0157369_10142766 3300013105 Bacteria 2533
75 Ga0163162_10506917 3300013306 Bacteria 1337
76 Ga0157375_10023281 3300013308 Bacteria 5713
77 Ga0157375_10159333 3300013308 Bacteria 2398
78 Ga0157377_10027395 3300014745 Bacteria 3059
79 Ga0157379_10000003 3300014968 Bacteria 174612
80 Ga0206354_11468621 3300020081 Bacteria 4736
81 Ga0207425_1006465 3300025245 Bacteria 3202
82 Ga0209148_1001977 3300025254 Bacteria 8168
83 Ga0209129_1000176 3300025258 Bacteria 93584
84 Ga0209025_1001775 3300025294 Bacteria 25678
85 Ga0207697_10002874 3300025315 Bacteria 8722
86 Ga0207655_1008493 3300025728 Bacteria 6503
87 Ga0207655_1011392 3300025728 Bacteria 5299
88 Ga0207713_1029996 3300025735 Bacteria 2426
89 Ga0207710_10031473 3300025900 Bacteria 2320
90 Ga0207647_10051010 3300025904 Bacteria 2559
91 Ga0207699_10070888 3300025906 Bacteria 2129
92 Ga0207645_10019761 3300025907 Bacteria 4413
93 Ga0207643_10000027 3300025908 Bacteria 99423
94 Ga0207654_10016078 3300025911 Bacteria 3892
95 Ga0207707_10029975 3300025912 Bacteria 4757
96 Ga0207695_10140608 3300025913 Bacteria 2363
97 Ga0207693_10158115 3300025915 Bacteria 1783
98 Ga0207660_10008258 3300025917 Bacteria 6730
99 Ga0207657_10162962 3300025919 Bacteria 1810
100 Ga0207652_10046574 3300025921 Bacteria 3700
101 Ga0207681_10020789 3300025923 Bacteria 4165
102 Ga0207650_10008952 3300025925 Bacteria 6843
103 Ga0207659_10032483 3300025926 Bacteria 3583
104 Ga0207687_10004998 3300025927 Bacteria 8784
105 Ga0207700_10009354 3300025928 Bacteria 6116
106 Ga0207664_10111246 3300025929 Bacteria 2278
107 Ga0207644_10003193 3300025931 Bacteria 10555
108 Ga0207709_10002398 3300025935 Bacteria 11800
109 Ga0207670_10016896 3300025936 Bacteria 4398
110 Ga0207691_10003245 3300025940 Bacteria 15843
111 Ga0207691_10212475 3300025940 Bacteria 1680
112 Ga0207711_10162692 3300025941 Bacteria 2021
113 Ga0207689_10000694 3300025942 Bacteria 32241
114 Ga0207661_10004797 3300025944 Bacteria 9468
115 Ga0207661_10262780 3300025944 Bacteria 1538
116 Ga0207679_10006279 3300025945 Bacteria 7499
117 Ga0207658_10134788 3300025986 Bacteria 1989
118 Ga0207703_10000001 3300026035 Bacteria 822925
119 Ga0207678_10000488 3300026067 Bacteria 35948
120 Ga0207702_10001529 3300026078 Bacteria 22893
121 Ga0207702_10023136 3300026078 Bacteria 5153
122 Ga0207641_10007723 3300026088 Bacteria 8939
123 Ga0207676_10000549 3300026095 Bacteria 31348
124 Ga0207683_10001061 3300026121 Bacteria 25052
125 Ga0207698_10233068 3300026142 Bacteria 1673
126 Ga0207428_10026079 3300027907 Bacteria 4883
127 Ga0268266_10076666 3300028379 Bacteria 2906
128 Ga0307408_100000956 3300031548 Bacteria 22410
129 Ga0307408_100025575 3300031548 Bacteria 4044
130 Ga0307408_100128333 3300031548 Bacteria 1975
131 Ga0307408_100153924 3300031548 Bacteria 1818
132 Ga0307408_100170001 3300031548 Bacteria 1740
133 Ga0307405_10036257 3300031731 Bacteria 2953
134 Ga0307405_10091855 3300031731 Bacteria 2012
135 Ga0307405_10109226 3300031731 Bacteria 1870
136 Ga0307405_10121778 3300031731 Bacteria 1786
137 Ga0307413_10006432 3300031824 Bacteria 5364
138 Ga0307413_10022087 3300031824 Bacteria 3421
139 Ga0307413_10038152 3300031824 Bacteria 2782
140 Ga0307413_10055313 3300031824 Bacteria 2414
141 Ga0307413_10061658 3300031824 Bacteria 2315
142 Ga0307413_10211631 3300031824 Bacteria 1408
143 Ga0307410_10013576 3300031852 Bacteria 4758
144 Ga0307410_10022134 3300031852 Bacteria 3923
145 Ga0307410_10032039 3300031852 Bacteria 3378
146 Ga0307410_10114518 3300031852 Bacteria 1956
147 Ga0307407_10007474 3300031903 Bacteria 4951
148 Ga0307407_10020894 3300031903 Bacteria 3364
149 Ga0307412_10002704 3300031911 Bacteria 9848
150 Ga0307412_10006120 3300031911 Bacteria 6781
151 Ga0307412_10052198 3300031911 Bacteria 2706
152 Ga0307412_10053564 3300031911 Bacteria 2675
153 Ga0307412_10093975 3300031911 Bacteria 2105
154 Ga0307412_10102872 3300031911 Bacteria 2023
155 Ga0307412_10151324 3300031911 Bacteria 1712
156 Ga0307409_100049723 3300031995 Bacteria 3198
157 Ga0307409_100056031 3300031995 Bacteria 3047
158 Ga0307409_100107027 3300031995 Bacteria 2335
159 Ga0307409_100259223 3300031995 Bacteria 1594
160 Ga0307409_100364911 3300031995 Bacteria 1367
161 Ga0307416_100038773 3300032002 Bacteria 3679
162 Ga0307416_100103652 3300032002 Bacteria 2484
163 Ga0307416_100148954 3300032002 Bacteria 2142
164 Ga0307416_100268506 3300032002 Bacteria 1673
165 Ga0307414_10116136 3300032004 Bacteria 2048
166 Ga0307415_100011180 3300032126 Bacteria 5122
167 Ga0307415_100022823 3300032126 Bacteria 3871
168 Ga0307415_100169004 3300032126 Bacteria 1703
169 Ga0395900_0056619 3300037418 Bacteria 4035
170 Ga0395898_0036370 3300037466 Bacteria 4888
171 Ga0436364_0086996 3300037853 Bacteria 5122
172 Ga0436365_0844488 3300039437 Bacteria 2230
173 Ga0439436_0011123 3300041404 Bacteria 2735
174 Ga0439438_012213 3300041405 Bacteria 2640
175 Ga0439439_0001834 3300041406 Bacteria 4359
176 Ga0439461_0000848 3300041410 Bacteria 4521
177 Ga0439466_0022841 3300041411 Bacteria 2204
178 Ga0439465_0007384 3300041413 Bacteria 3492
179 Ga0439433_0000660 3300041999 Bacteria 6620
180 Ga0439433_0007319 3300041999 Bacteria 2383
181 Ga0439442_000104 3300042002 Bacteria 20823
182 Ga0439442_000863 3300042002 Bacteria 6245
183 Ga0439442_001194 3300042002 Bacteria 5170
184 Ga0439442_001822 3300042002 Bacteria 4169
185 Ga0439448_0034454 3300042005 Bacteria 1618
186 Ga0439432_003360 3300042006 Bacteria 5935
187 Ga0439449_0001244 3300042007 Bacteria 9983
188 Ga0439449_0021277 3300042007 Bacteria 2428
189 Ga0439452_004926 3300042010 Bacteria 4380
190 Ga0439457_000337 3300042014 Bacteria 12991
191 Ga0450920_000558 3300042122 Bacteria 5903
192 Ga0450920_010549 3300042122 Bacteria 1714
193 Ga0450907_000160 3300042146 Bacteria 25120
194 Ga0439446_0020770 3300042156 Bacteria 1852
195 Ga0450908_000360 3300042184 Bacteria 8790
196 Ga0439434_0013054 3300042435 Bacteria 2463
197 Ga0439459_0005314 3300042438 Bacteria 2112
198 Ga0450918_001161 3300042531 Bacteria 5399
199 Ga0450918_001338 3300042531 Bacteria 4943
200 Ga0466965_0102255 3300044683 Bacteria 1466
201 Ga0466963_0015935 3300044694 Bacteria 4667
202 Ga0466964_0086814 3300044706 Bacteria 1354
203 Ga0466958_0112540 3300045836 Bacteria 1700
204 Ga0466967_0011802 3300045976 Bacteria 6643
205 Ga0466967_0494395 3300045976 Bacteria 1200
206 Ga0495653_0004024 3300046463 Bacteria 11869
207 Ga0495580_0004638 3300046472 Bacteria 11545
208 Ga0495580_0022228 3300046472 Bacteria 4670
209 Ga0495582_0100471 3300046473 Bacteria 1619
210 Ga0495639_0004095 3300046475 Bacteria 6246
211 Ga0495639_0020935 3300046475 Bacteria 2861
212 Ga0495662_0040212 3300046476 Bacteria 2258
213 Ga0495664_0002097 3300046477 Bacteria 10661
214 Ga0495607_0012565 3300046501 Bacteria 5583
215 Ga0495631_0032348 3300046518 Bacteria 2360
216 Ga0495642_0019116 3300046528 Bacteria 2683
217 Ga0495665_0005559 3300046531 Bacteria 6793
218 Ga0495665_0038213 3300046531 Bacteria 2560
219 Ga0495586_0009788 3300046535 Bacteria 5102
220 Ga0495586_0084014 3300046535 Bacteria 1752
221 Ga0495586_0085619 3300046535 Bacteria 1736
222 Ga0495645_0000895 3300046543 Bacteria 20304
223 Ga0495622_0012575 3300046557 Bacteria 3922
224 Ga0495667_0001640 3300046559 Bacteria 14816
225 Ga0495656_0006135 3300046615 Bacteria 4197
226 Ga0495668_0000704 3300046616 Bacteria 40286
227 Ga0495635_0127664 3300046663 Bacteria 1734
228 Ga0495588_0001696 3300046674 Bacteria 9373
229 Ga0495588_0034652 3300046674 Bacteria 2555
230 Ga0495588_0075799 3300046674 Bacteria 1752
231 Ga0495670_0005577 3300046691 Bacteria 6176
232 Ga0495670_0087533 3300046691 Bacteria 1591
233 Ga0495600_0057040 3300046809 Bacteria 2551
234 Ga0495581_0002121 3300047315 Bacteria 11181
235 Ga0495581_0003523 3300047315 Bacteria 8978
236 Ga0495581_0026722 3300047315 Bacteria 3346
237 Ga0495636_0010341 3300047318 Bacteria 3684
238 Ga0495676_0134068 3300047321 Bacteria 1784
239 Ga0495680_0019919 3300047322 Bacteria 5655
240 Ga0495683_0000380 3300047323 Bacteria 36306
241 Ga0495675_0006657 3300047444 Bacteria 7076
242 Ga0495685_050198 3300047447 Bacteria 1416
243 Ga0495684_0149240 3300047471 Bacteria 1749
244 Ga0496100_0022093 3300048903 Bacteria 3844
245 Ga0496100_0224054 3300048903 Bacteria 1381
246 Ga0496101_0003224 3300048904 Bacteria 10118
247 Ga0496101_0104600 3300048904 Bacteria 2123
248 Ga0496101_0161438 3300048904 Bacteria 1719
249 Ga0496102_0020005 3300048905 Bacteria 5905
250 Ga0496102_0048417 3300048905 Bacteria 3865
251 Ga0496102_0074208 3300048905 Bacteria 3127
252 Ga0496103_0015142 3300048906 Bacteria 4586
253 Ga0496104_0015402 3300048907 Bacteria 6925
254 Ga0496104_0098941 3300048907 Bacteria 2792
255 Ga0496105_0011935 3300048908 Bacteria 6879
256 Ga0496105_0055039 3300048908 Bacteria 3285
257 Ga0496105_0121273 3300048908 Bacteria 2155
258 Ga0496106_0004227 3300048909 Bacteria 10690
259 Ga0496106_0017614 3300048909 Bacteria 5284
260 Ga0496106_0045892 3300048909 Bacteria 3283
261 Ga0496107_0021891 3300048910 Bacteria 4516
262 Ga0496107_0043823 3300048910 Bacteria 3215
263 Ga0496107_0084797 3300048910 Bacteria 2311
264 Ga0496108_0044545 3300048911 Bacteria 3703
265 Ga0496108_0053626 3300048911 Bacteria 3381
266 Ga0496108_0236050 3300048911 Bacteria 1590
267 Ga0496109_0027713 3300048912 Bacteria 5061
268 Ga0496110_0065405 3300048913 Bacteria 3214
269 Ga0496110_0152680 3300048913 Bacteria 2091
270 Ga0496110_0215820 3300048913 Bacteria 1744
271 Ga0496110_0335866 3300048913 Bacteria 1376
272 Ga0496110_0388700 3300048913 Bacteria 1272
273 Ga0496111_0008600 3300048914 Bacteria 6767
274 Ga0496111_0105297 3300048914 Bacteria 2075
275 Ga0496112_0006573 3300048915 Bacteria 10232
276 Ga0496112_0426554 3300048915 Bacteria 1264
277 Ga0496113_0011899 3300048916 Bacteria 5831
278 Ga0496113_0094361 3300048916 Bacteria 2311
279 Ga0496113_0198961 3300048916 Bacteria 1592
280 Ga0496114_0004897 3300048917 Bacteria 10429
281 Ga0496114_0060524 3300048917 Bacteria 3165
282 Ga0496115_0137502 3300048918 Bacteria 2015
283 Ga0496125_0053062 3300048928 Bacteria 3327
284 Ga0501032_0000135 3300049569 Bacteria 60174
285 Ga0501032_0008860 3300049569 Bacteria 7314
286 Ga0501034_0000505 3300049571 Bacteria 62933
287 Ga0501036_0136563 3300049572 Bacteria 2070
288 Ga0501037_0006975 3300049573 Bacteria 8250
289 Ga0501037_0114830 3300049573 Bacteria 1938
290 Ga0501039_0014706 3300049575 Bacteria 5986
291 Ga0501039_0225613 3300049575 Bacteria 1472
292 Ga0501043_0062112 3300049579 Bacteria 2933
293 nmdc:mga00v17_58689_c1 3300050491 Bacteria 2358
294 nmdc:mga05p37_94840_c1 3300050507 Bacteria 2708
295 nmdc:mga08y16_238829_c1 3300050511 Bacteria 1879
296 nmdc:mga0n895_62754_c1 3300050512 Bacteria 3674
297 nmdc:mga0rr50_5371_c1 3300050513 Bacteria 7636
298 nmdc:mga0a205_6270_c1 3300050515 Bacteria 10733
299 Ga0500568_0001142 3300053139 Bacteria 17813
300 2566997363 2565956761 Bacteria 6601618
301 2643851071 2643221567 Bacteria 4163945
302 2644134824 2643221624 Bacteria 4384879
303 2644491023 2643221687 Bacteria 6500351
304 2644525375 2643221694 Bacteria 4392972
305 2644669459 2643221722 Bacteria 4247614
306 2691514656 2690315906 Bacteria 4517044
307 2738888078 2738541308 Bacteria 7020677
308 2739238544 2738543011 Bacteria 5731169
309 2744954667 2744054611 Bacteria 5611514
310 2775655006 2775506735 Bacteria 4556596
311 2784471593 2784132109 Bacteria 3141763
312 2808827769 2808606357 Bacteria 4466944
313 2808853123 2808606360 Bacteria 4404006
314 2808878375 2808606366 Bacteria 4415912
315 2808892014 2808606370 Bacteria 4942454
316 2808897106 2808606371 Bacteria 4251511
317 2810364266 2808606700 Bacteria 3482157
318 2812320468 2811994871 Bacteria 4497550
319 2842892140 2842888712 Bacteria 4279094
320 2844849620 2844849076 Bacteria 4091819
321 2857741255 2857740372 Bacteria 4782044
322 2889302978 2889300758 Bacteria 5690814
323 2904499728 2904497146 Bacteria 4731781
324 2904538292 2904535858 Bacteria 6308016
325 2904776714 2904776348 Bacteria 4658726
326 2905927801 2905926851 Bacteria 4423176
327 2910813321 2910809715 Bacteria 4982797
328 2919036262 2919034639 Bacteria 4763403
329 2919061625 2919059106 Bacteria 4991624
330 2919391520 2919391150 Bacteria 4884741
331 2919542238 2919538618 Bacteria 4677069
332 2922557484 2922554459 Bacteria 6683962
333 2928145638 2928142448 Bacteria 5288925
334 2932429306 2932426870 Bacteria 4547726
335 2933420788 2933418574 Bacteria 4476724
336 2939598743 2939598168 Bacteria 4687164
337 2939648792 2939647034 Bacteria 4681660
338 2939675997 2939674588 Bacteria 4844420
339 2939746144 2939743619 Bacteria 5762299
340 2945918227 2945916053 Bacteria 4555517
341 2945921487 2945920336 Bacteria 4501603
342 2945942327 2945941187 Bacteria 4682474
343 2945959916 2945956166 Bacteria 5110334
344 2946038272 2946037020 Bacteria 4900426
345 2946062076 2946059875 Bacteria 4386623
346 2953999547 2953998280 Bacteria 4812144
347 2956941294 2956939328 Bacteria 3474458
348 2974306258 2974302888 Bacteria 4369871
349 2974318205 2974315732 Bacteria 4602776
350 2984526417 2984523437 Bacteria 4508481
351 3001120278 3001119090 Bacteria 3449530
352 8004023151 8004021418 Bacteria 4313954
353 8004026251 8004025490 Bacteria 4327753
354 8054110966 8054107350 Bacteria 5022511
355 8057575173 8057568493 Bacteria 7221719
356 Ga0207677_10004154
357 LJQas_1000396
358 LJQas_1005357
359 JGI25152J39213_1000687
360 Ga0065714_10009923
361 Ga0070683_100202372
362 Ga0070670_100024161
363 Ga0068869_100037147
364 Ga0070680_100066610
365 Ga0070682_100045674
366 Ga0068868_100010506
367 Ga0070660_100094244
368 Ga0070689_100125802
369 Ga0070691_10003926
370 Ga0070669_100047416
371 Ga0070671_100000423
372 Ga0070671_100038229
373 Ga0070674_100237643
374 Ga0070659_100056659
375 Ga0070667_100039624
376 Ga0070709_10089825
377 Ga0070714_100027706
378 Ga0070713_100056883
379 Ga0070711_100005145
380 Ga0070663_100004764
381 Ga0070678_100001811
382 Ga0070678_100050161
383 Ga0070681_10120531
384 Ga0070664_100162881
385 Ga0068854_100094297
386 Ga0068856_100061096
387 Ga0070702_100017023
388 Ga0068852_100003907
389 Ga0068852_100237055
390 Ga0068859_100018104
391 Ga0068864_100020358
392 Ga0068864_100148966
393 Ga0068851_10104885
394 Ga0068870_10000378
395 Ga0068863_100003154
396 Ga0075432_10002093
397 Ga0097621_100133051
398 Ga0068871_100021222
399 Ga0075431_100115517
400 Ga0075433_10020121
401 Ga0075434_100039067
402 Ga0075436_100021210
403 Ga0097620_100018103
404 Ga0075435_100049543
405 Ga0105244_10038017
406 Ga0105240_10092708
407 Ga0111539_10254395
408 Ga0105245_10009937
409 Ga0105247_10004708
410 Ga0105243_10000243
411 Ga0105243_10010786
412 Ga0105242_10172897
413 Ga0105248_10001229
414 Ga0105248_10139088
415 Ga0105237_10185905
416 Ga0105246_10001005
417 Ga0105246_10001940
418 Ga0105246_10002771
419 Ga0105246_10029956
420 Ga0105246_10071429
421 Ga0105246_10249921
422 Ga0157371_10017375
423 Ga0157370_10008743
424 Ga0157370_10065726
425 Ga0157369_10042050
426 Ga0157369_10060252
427 Ga0157369_10092208
428 Ga0157369_10136512
429 Ga0157369_10142766
430 Ga0163162_10506917
431 Ga0157375_10023281
432 Ga0157375_10159333
433 Ga0157377_10027395
434 Ga0157379_10000003
435 Ga0206354_11468621
436 Ga0207425_1006465
437 Ga0209148_1001977
438 Ga0209129_1000176
439 Ga0209025_1001775
440 Ga0207697_10002874
441 Ga0207655_1008493
442 Ga0207655_1011392
443 Ga0207713_1029996
444 Ga0207710_10031473
445 Ga0207647_10051010
446 Ga0207699_10070888
447 Ga0207645_10019761
448 Ga0207643_10000027
449 Ga0207654_10016078
450 Ga0207707_10029975
451 Ga0207695_10140608
452 Ga0207693_10158115
453 Ga0207660_10008258
454 Ga0207657_10162962
455 Ga0207652_10046574
456 Ga0207681_10020789
457 Ga0207650_10008952
458 Ga0207659_10032483
459 Ga0207687_10004998
460 Ga0207700_10009354
461 Ga0207664_10111246
462 Ga0207644_10003193
463 Ga0207709_10002398
464 Ga0207670_10016896
465 Ga0207691_10003245
466 Ga0207691_10212475
467 Ga0207711_10162692
468 Ga0207689_10000694
469 Ga0207661_10004797
470 Ga0207661_10262780
471 Ga0207679_10006279
472 Ga0207658_10134788
473 Ga0207703_10000001
474 Ga0207678_10000488
475 Ga0207702_10001529
476 Ga0207702_10023136
477 Ga0207641_10007723
478 Ga0207676_10000549
479 Ga0207683_10001061
480 Ga0207698_10233068
481 Ga0207428_10026079
482 Ga0268266_10076666
483 Ga0307408_100000956
484 Ga0307408_100025575
485 Ga0307408_100128333
486 Ga0307408_100153924
487 Ga0307408_100170001
488 Ga0307405_10036257
489 Ga0307405_10091855
490 Ga0307405_10109226
491 Ga0307405_10121778
492 Ga0307413_10006432
493 Ga0307413_10022087
494 Ga0307413_10038152
495 Ga0307413_10055313
496 Ga0307413_10061658
497 Ga0307413_10211631
498 Ga0307410_10013576
499 Ga0307410_10022134
500 Ga0307410_10032039
501 Ga0307410_10114518
502 Ga0307407_10007474
503 Ga0307407_10020894
504 Ga0307412_10002704
505 Ga0307412_10006120
506 Ga0307412_10052198
507 Ga0307412_10053564
508 Ga0307412_10093975
509 Ga0307412_10102872
510 Ga0307412_10151324
511 Ga0307409_100049723
512 Ga0307409_100056031
513 Ga0307409_100107027
514 Ga0307409_100259223
515 Ga0307409_100364911
516 Ga0307416_100038773
517 Ga0307416_100103652
518 Ga0307416_100148954
519 Ga0307416_100268506
520 Ga0307414_10116136
521 Ga0307415_100011180
522 Ga0307415_100022823
523 Ga0307415_100169004
524 Ga0395900_0056619
525 Ga0395898_0036370
526 Ga0436364_0086996
527 Ga0436365_0844488
528 Ga0439436_0011123
529 Ga0439438_012213
530 Ga0439439_0001834
531 Ga0439461_0000848
532 Ga0439466_0022841
533 Ga0439465_0007384
534 Ga0439433_0000660
535 Ga0439433_0007319
536 Ga0439442_000104
537 Ga0439442_000863
538 Ga0439442_001194
539 Ga0439442_001822
540 Ga0439448_0034454
541 Ga0439432_003360
542 Ga0439449_0001244
543 Ga0439449_0021277
544 Ga0439452_004926
545 Ga0439457_000337
546 Ga0450920_000558
547 Ga0450920_010549
548 Ga0450907_000160
549 Ga0439446_0020770
550 Ga0450908_000360
551 Ga0439434_0013054
552 Ga0439459_0005314
553 Ga0450918_001161
554 Ga0450918_001338
555 Ga0466965_0102255
556 Ga0466963_0015935
557 Ga0466964_0086814
558 Ga0466958_0112540
559 Ga0466967_0011802
560 Ga0466967_0494395
561 Ga0495653_0004024
562 Ga0495580_0004638
563 Ga0495580_0022228
564 Ga0495582_0100471
565 Ga0495639_0004095
566 Ga0495639_0020935
567 Ga0495662_0040212
568 Ga0495664_0002097
569 Ga0495607_0012565
570 Ga0495631_0032348
571 Ga0495642_0019116
572 Ga0495665_0005559
573 Ga0495665_0038213
574 Ga0495586_0009788
575 Ga0495586_0084014
576 Ga0495586_0085619
577 Ga0495645_0000895
578 Ga0495622_0012575
579 Ga0495667_0001640
580 Ga0495656_0006135
581 Ga0495668_0000704
582 Ga0495635_0127664
583 Ga0495588_0001696
584 Ga0495588_0034652
585 Ga0495588_0075799
586 Ga0495670_0005577
587 Ga0495670_0087533
588 Ga0495600_0057040
589 Ga0495581_0002121
590 Ga0495581_0003523
591 Ga0495581_0026722
592 Ga0495636_0010341
593 Ga0495676_0134068
594 Ga0495680_0019919
595 Ga0495683_0000380
596 Ga0495675_0006657
597 Ga0495685_050198
598 Ga0495684_0149240
599 Ga0496100_0022093
600 Ga0496100_0224054
601 Ga0496101_0003224
602 Ga0496101_0104600
603 Ga0496101_0161438
604 Ga0496102_0020005
605 Ga0496102_0048417
606 Ga0496102_0074208
607 Ga0496103_0015142
608 Ga0496104_0015402
609 Ga0496104_0098941
610 Ga0496105_0011935
611 Ga0496105_0055039
612 Ga0496105_0121273
613 Ga0496106_0004227
614 Ga0496106_0017614
615 Ga0496106_0045892
616 Ga0496107_0021891
617 Ga0496107_0043823
618 Ga0496107_0084797
619 Ga0496108_0044545
620 Ga0496108_0053626
621 Ga0496108_0236050
622 Ga0496109_0027713
623 Ga0496110_0065405
624 Ga0496110_0152680
625 Ga0496110_0215820
626 Ga0496110_0335866
627 Ga0496110_0388700
628 Ga0496111_0008600
629 Ga0496111_0105297
630 Ga0496112_0006573
631 Ga0496112_0426554
632 Ga0496113_0011899
633 Ga0496113_0094361
634 Ga0496113_0198961
635 Ga0496114_0004897
636 Ga0496114_0060524
637 Ga0496115_0137502
638 Ga0496125_0053062
639 Ga0501032_0000135
640 Ga0501032_0008860
641 Ga0501034_0000505
642 Ga0501036_0136563
643 Ga0501037_0006975
644 Ga0501037_0114830
645 Ga0501039_0014706
646 Ga0501039_0225613
647 Ga0501043_0062112
648 nmdc:mga00v17_58689_c1
649 nmdc:mga05p37_94840_c1
650 nmdc:mga08y16_238829_c1
651 nmdc:mga0n895_62754_c1
652 nmdc:mga0rr50_5371_c1
653 nmdc:mga0a205_6270_c1
654 Ga0500568_0001142
655 2566997363
656 2643851071
657 2644134824
658 2644491023
659 2644525375
660 2644669459
661 2691514656
662 2738888078
663 2739238544
664 2744954667
665 2775655006
666 2784471593
667 2808827769
668 2808853123
669 2808878375
670 2808892014
671 2808897106
672 2810364266
673 2812320468
674 2842892140
675 2844849620
676 2857741255
677 2889302978
678 2904499728
679 2904538292
680 2904776714
681 2905927801
682 2910813321
683 2919036262
684 2919061625
685 2919391520
686 2919542238
687 2922557484
688 2928145638
689 2932429306
690 2933420788
691 2939598743
692 2939648792
693 2939675997
694 2939746144
695 2945918227
696 2945921487
697 2945942327
698 2945959916
699 2946038272
700 2946062076
701 2953999547
702 2956941294
703 2974306258
704 2974318205
705 2984526417
706 3001120278
707 8004023151
708 8004026251
709 8054110966
710 8057575173

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

125

373

0.95

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

19

93

0.94

PF13614

AAA_31

AAA domain

127

201

0.89

PF09140

MipZ

ATPase MipZ

128

266

0.79

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

130

352

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5auq-assembly1.cif.gz_A crystal structure of atpase-type hypb in the nucleotide free state 0.8737 113 357
5auq-assembly4.cif.gz_F crystal structure of atpase-type hypb in the nucleotide free state 0.8709 113 357
5auq-assembly3.cif.gz_C crystal structure of atpase-type hypb in the nucleotide free state 0.8705 113 357
5auq-assembly4.cif.gz_D crystal structure of atpase-type hypb in the nucleotide free state 0.8686 113 357
5auq-assembly2.cif.gz_B crystal structure of atpase-type hypb in the nucleotide free state 0.8634 113 357
ID Description Score Start End Superfamily
af_P9WJN7_3_100_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9934 2 96 3.30.300.130
af_P9WJN7_114_362_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9786 111 357 3.40.50.300
af_P9WJN7_114_362_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.967 111 357 3.40.50.300
af_P9WJN7_3_100_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9535 2 96 3.30.300.130
af_Q2FW86_86_295_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9426 110 323 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6J6K2Y0-F1-model_v4 Unannotated protein 0.9776 166 360 GO:0005524
GO:0016226
GO:0051539
AF-A0A2U2AWS9-F1-model_v4 deleted 0.9758 7 329
AF-A0A6F8YH02-F1-model_v4 MIP18 family-like domain-containing protein 0.967 5 231 GO:0005524
GO:0016226
GO:0051539
AF-A0A068NFQ4-F1-model_v4 deleted 0.9641 7 363
AF-A0A0U0W7D1-F1-model_v4 Iron-sulfur cluster carrier protein 0.9632 1 374 GO:0005524
GO:0016226
GO:0016887
GO:0046872
GO:0051539
GO:0140663

Map