F420168
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 355 | 258 | 710 | 378 |
Family's Representative Sequence
| Representative Sequence | 3300026023|Ga0207677_10004154|Ga0207677_100041544 |
| Length | 467 |
| Sequence | MVGPWANSCPAYAGSVVTPEQVTAALASVRDPEIRRPITELNMVKDVRVDPNGTVTVGVYLTVAGCPLRDTITRDVTAAVSPLDGVSSVRVDLDVMSPEQRKALQEQLRGPGRVENEIPFAKPGSLTRVYAVASGKGGVGKSSLTVNLAVALADRGRTVGVVDADIYGHSVPRMLGVTGQPTQVEQMILPPQANGVRVISIGMFTPGNSPVVWRGPMLHRALQQFLADVYWGDLDVLLLDLPPGTGDIAISVAQLVPSAELLVVTTPQVAAQEVAERAGAIALQTHQQIVGVVENMSWWEQPDGSRVELFGSGGGAAVAASLSRLTGASVPLLGQVPIDQRLREGGDAGVPIVASAPDSPAAIALGEIADRLAARQRGLAGLQLGLSPATPLTPPHRPAGRAPTGLATSLGGRPARAGEAVLSGYVSAPPGEQRHSRRVCDGQPLPGPPLPRPVGAAGVPVGTAPVC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 107 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 109 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 110 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 115 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 119 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 120 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 121 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 122 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 123 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 124 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 125 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 126 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 127 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 128 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 129 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 130 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 131 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 132 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 133 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 134 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 135 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 136 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 137 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 138 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 139 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 140 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 141 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 142 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 143 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 144 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 145 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 176 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 177 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 178 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 179 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 180 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 184 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 185 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 186 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 187 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 188 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 189 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 190 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 197 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 203 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 204 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 205 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 206 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 207 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 208 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 209 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 210 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 211 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 212 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 213 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 214 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 215 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 216 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 217 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 218 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 219 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 220 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 221 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 222 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 223 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 224 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 225 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 226 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 227 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 228 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 229 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 230 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 231 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 232 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 233 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 234 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 235 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 236 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 237 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 238 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 239 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 240 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 241 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 242 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 243 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 244 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 245 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 246 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 247 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 248 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 249 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 250 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 251 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 252 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 253 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 254 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 255 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 256 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 257 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 258 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.94 |
| Metatranscriptomes | 0.28 |
| Isolates | 15.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 1.97 |
| Nodule | 0 |
| Rhizoplane | 10.99 |
| Rhizosphere | 78.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207677_10004154 | 3300026023 | Bacteria | 7749 |
| 2 | LJQas_1000396 | 3300000549 | Bacteria | 7341 |
| 3 | LJQas_1005357 | 3300000549 | Bacteria | 1633 |
| 4 | JGI25152J39213_1000687 | 3300002773 | Bacteria | 17647 |
| 5 | Ga0065714_10009923 | 3300005288 | Bacteria | 5333 |
| 6 | Ga0070683_100202372 | 3300005329 | Bacteria | 1886 |
| 7 | Ga0070670_100024161 | 3300005331 | Bacteria | 5229 |
| 8 | Ga0068869_100037147 | 3300005334 | Bacteria | 3462 |
| 9 | Ga0070680_100066610 | 3300005336 | Bacteria | 2953 |
| 10 | Ga0070682_100045674 | 3300005337 | Bacteria | 2716 |
| 11 | Ga0068868_100010506 | 3300005338 | Bacteria | 6708 |
| 12 | Ga0070660_100094244 | 3300005339 | Bacteria | 2365 |
| 13 | Ga0070689_100125802 | 3300005340 | Bacteria | 2051 |
| 14 | Ga0070691_10003926 | 3300005341 | Bacteria | 6728 |
| 15 | Ga0070669_100047416 | 3300005353 | Bacteria | 3134 |
| 16 | Ga0070671_100000423 | 3300005355 | Bacteria | 29409 |
| 17 | Ga0070671_100038229 | 3300005355 | Bacteria | 3984 |
| 18 | Ga0070674_100237643 | 3300005356 | Bacteria | 1425 |
| 19 | Ga0070659_100056659 | 3300005366 | Bacteria | 3090 |
| 20 | Ga0070667_100039624 | 3300005367 | Bacteria | 3950 |
| 21 | Ga0070709_10089825 | 3300005434 | Bacteria | 2024 |
| 22 | Ga0070714_100027706 | 3300005435 | Bacteria | 4695 |
| 23 | Ga0070713_100056883 | 3300005436 | Bacteria | 3254 |
| 24 | Ga0070711_100005145 | 3300005439 | Bacteria | 7793 |
| 25 | Ga0070663_100004764 | 3300005455 | Bacteria | 8004 |
| 26 | Ga0070678_100001811 | 3300005456 | Bacteria | 11520 |
| 27 | Ga0070678_100050161 | 3300005456 | Bacteria | 3017 |
| 28 | Ga0070681_10120531 | 3300005458 | Bacteria | 2558 |
| 29 | Ga0070664_100162881 | 3300005564 | Bacteria | 1974 |
| 30 | Ga0068854_100094297 | 3300005578 | Bacteria | 2232 |
| 31 | Ga0068856_100061096 | 3300005614 | Bacteria | 3722 |
| 32 | Ga0070702_100017023 | 3300005615 | Bacteria | 3742 |
| 33 | Ga0068852_100003907 | 3300005616 | Bacteria | 10471 |
| 34 | Ga0068852_100237055 | 3300005616 | Bacteria | 1742 |
| 35 | Ga0068859_100018104 | 3300005617 | Bacteria | 7081 |
| 36 | Ga0068864_100020358 | 3300005618 | Bacteria | 5550 |
| 37 | Ga0068864_100148966 | 3300005618 | Bacteria | 2118 |
| 38 | Ga0068851_10104885 | 3300005834 | Bacteria | 1503 |
| 39 | Ga0068870_10000378 | 3300005840 | Bacteria | 16740 |
| 40 | Ga0068863_100003154 | 3300005841 | Bacteria | 16278 |
| 41 | Ga0075432_10002093 | 3300006058 | Bacteria | 6644 |
| 42 | Ga0097621_100133051 | 3300006237 | Bacteria | 2118 |
| 43 | Ga0068871_100021222 | 3300006358 | Bacteria | 4989 |
| 44 | Ga0075431_100115517 | 3300006847 | Bacteria | 2771 |
| 45 | Ga0075433_10020121 | 3300006852 | Bacteria | 5573 |
| 46 | Ga0075434_100039067 | 3300006871 | Bacteria | 4703 |
| 47 | Ga0075436_100021210 | 3300006914 | Bacteria | 4457 |
| 48 | Ga0097620_100018103 | 3300006931 | Bacteria | 7081 |
| 49 | Ga0075435_100049543 | 3300007076 | Bacteria | 3379 |
| 50 | Ga0105244_10038017 | 3300009036 | Bacteria | 2512 |
| 51 | Ga0105240_10092708 | 3300009093 | Bacteria | 3688 |
| 52 | Ga0111539_10254395 | 3300009094 | Bacteria | 2045 |
| 53 | Ga0105245_10009937 | 3300009098 | Bacteria | 8290 |
| 54 | Ga0105247_10004708 | 3300009101 | Bacteria | 8695 |
| 55 | Ga0105243_10000243 | 3300009148 | Bacteria | 62451 |
| 56 | Ga0105243_10010786 | 3300009148 | Bacteria | 6917 |
| 57 | Ga0105242_10172897 | 3300009176 | Bacteria | 1900 |
| 58 | Ga0105248_10001229 | 3300009177 | Bacteria | 28583 |
| 59 | Ga0105248_10139088 | 3300009177 | Bacteria | 2739 |
| 60 | Ga0105237_10185905 | 3300009545 | Bacteria | 2078 |
| 61 | Ga0105246_10001005 | 3300011119 | Bacteria | 16194 |
| 62 | Ga0105246_10001940 | 3300011119 | Bacteria | 12488 |
| 63 | Ga0105246_10002771 | 3300011119 | Bacteria | 10610 |
| 64 | Ga0105246_10029956 | 3300011119 | Bacteria | 3589 |
| 65 | Ga0105246_10071429 | 3300011119 | Bacteria | 2444 |
| 66 | Ga0105246_10249921 | 3300011119 | Bacteria | 1407 |
| 67 | Ga0157371_10017375 | 3300013102 | Bacteria | 5346 |
| 68 | Ga0157370_10008743 | 3300013104 | Bacteria | 10889 |
| 69 | Ga0157370_10065726 | 3300013104 | Bacteria | 3431 |
| 70 | Ga0157369_10042050 | 3300013105 | Bacteria | 4986 |
| 71 | Ga0157369_10060252 | 3300013105 | Bacteria | 4093 |
| 72 | Ga0157369_10092208 | 3300013105 | Bacteria | 3233 |
| 73 | Ga0157369_10136512 | 3300013105 | Bacteria | 2596 |
| 74 | Ga0157369_10142766 | 3300013105 | Bacteria | 2533 |
| 75 | Ga0163162_10506917 | 3300013306 | Bacteria | 1337 |
| 76 | Ga0157375_10023281 | 3300013308 | Bacteria | 5713 |
| 77 | Ga0157375_10159333 | 3300013308 | Bacteria | 2398 |
| 78 | Ga0157377_10027395 | 3300014745 | Bacteria | 3059 |
| 79 | Ga0157379_10000003 | 3300014968 | Bacteria | 174612 |
| 80 | Ga0206354_11468621 | 3300020081 | Bacteria | 4736 |
| 81 | Ga0207425_1006465 | 3300025245 | Bacteria | 3202 |
| 82 | Ga0209148_1001977 | 3300025254 | Bacteria | 8168 |
| 83 | Ga0209129_1000176 | 3300025258 | Bacteria | 93584 |
| 84 | Ga0209025_1001775 | 3300025294 | Bacteria | 25678 |
| 85 | Ga0207697_10002874 | 3300025315 | Bacteria | 8722 |
| 86 | Ga0207655_1008493 | 3300025728 | Bacteria | 6503 |
| 87 | Ga0207655_1011392 | 3300025728 | Bacteria | 5299 |
| 88 | Ga0207713_1029996 | 3300025735 | Bacteria | 2426 |
| 89 | Ga0207710_10031473 | 3300025900 | Bacteria | 2320 |
| 90 | Ga0207647_10051010 | 3300025904 | Bacteria | 2559 |
| 91 | Ga0207699_10070888 | 3300025906 | Bacteria | 2129 |
| 92 | Ga0207645_10019761 | 3300025907 | Bacteria | 4413 |
| 93 | Ga0207643_10000027 | 3300025908 | Bacteria | 99423 |
| 94 | Ga0207654_10016078 | 3300025911 | Bacteria | 3892 |
| 95 | Ga0207707_10029975 | 3300025912 | Bacteria | 4757 |
| 96 | Ga0207695_10140608 | 3300025913 | Bacteria | 2363 |
| 97 | Ga0207693_10158115 | 3300025915 | Bacteria | 1783 |
| 98 | Ga0207660_10008258 | 3300025917 | Bacteria | 6730 |
| 99 | Ga0207657_10162962 | 3300025919 | Bacteria | 1810 |
| 100 | Ga0207652_10046574 | 3300025921 | Bacteria | 3700 |
| 101 | Ga0207681_10020789 | 3300025923 | Bacteria | 4165 |
| 102 | Ga0207650_10008952 | 3300025925 | Bacteria | 6843 |
| 103 | Ga0207659_10032483 | 3300025926 | Bacteria | 3583 |
| 104 | Ga0207687_10004998 | 3300025927 | Bacteria | 8784 |
| 105 | Ga0207700_10009354 | 3300025928 | Bacteria | 6116 |
| 106 | Ga0207664_10111246 | 3300025929 | Bacteria | 2278 |
| 107 | Ga0207644_10003193 | 3300025931 | Bacteria | 10555 |
| 108 | Ga0207709_10002398 | 3300025935 | Bacteria | 11800 |
| 109 | Ga0207670_10016896 | 3300025936 | Bacteria | 4398 |
| 110 | Ga0207691_10003245 | 3300025940 | Bacteria | 15843 |
| 111 | Ga0207691_10212475 | 3300025940 | Bacteria | 1680 |
| 112 | Ga0207711_10162692 | 3300025941 | Bacteria | 2021 |
| 113 | Ga0207689_10000694 | 3300025942 | Bacteria | 32241 |
| 114 | Ga0207661_10004797 | 3300025944 | Bacteria | 9468 |
| 115 | Ga0207661_10262780 | 3300025944 | Bacteria | 1538 |
| 116 | Ga0207679_10006279 | 3300025945 | Bacteria | 7499 |
| 117 | Ga0207658_10134788 | 3300025986 | Bacteria | 1989 |
| 118 | Ga0207703_10000001 | 3300026035 | Bacteria | 822925 |
| 119 | Ga0207678_10000488 | 3300026067 | Bacteria | 35948 |
| 120 | Ga0207702_10001529 | 3300026078 | Bacteria | 22893 |
| 121 | Ga0207702_10023136 | 3300026078 | Bacteria | 5153 |
| 122 | Ga0207641_10007723 | 3300026088 | Bacteria | 8939 |
| 123 | Ga0207676_10000549 | 3300026095 | Bacteria | 31348 |
| 124 | Ga0207683_10001061 | 3300026121 | Bacteria | 25052 |
| 125 | Ga0207698_10233068 | 3300026142 | Bacteria | 1673 |
| 126 | Ga0207428_10026079 | 3300027907 | Bacteria | 4883 |
| 127 | Ga0268266_10076666 | 3300028379 | Bacteria | 2906 |
| 128 | Ga0307408_100000956 | 3300031548 | Bacteria | 22410 |
| 129 | Ga0307408_100025575 | 3300031548 | Bacteria | 4044 |
| 130 | Ga0307408_100128333 | 3300031548 | Bacteria | 1975 |
| 131 | Ga0307408_100153924 | 3300031548 | Bacteria | 1818 |
| 132 | Ga0307408_100170001 | 3300031548 | Bacteria | 1740 |
| 133 | Ga0307405_10036257 | 3300031731 | Bacteria | 2953 |
| 134 | Ga0307405_10091855 | 3300031731 | Bacteria | 2012 |
| 135 | Ga0307405_10109226 | 3300031731 | Bacteria | 1870 |
| 136 | Ga0307405_10121778 | 3300031731 | Bacteria | 1786 |
| 137 | Ga0307413_10006432 | 3300031824 | Bacteria | 5364 |
| 138 | Ga0307413_10022087 | 3300031824 | Bacteria | 3421 |
| 139 | Ga0307413_10038152 | 3300031824 | Bacteria | 2782 |
| 140 | Ga0307413_10055313 | 3300031824 | Bacteria | 2414 |
| 141 | Ga0307413_10061658 | 3300031824 | Bacteria | 2315 |
| 142 | Ga0307413_10211631 | 3300031824 | Bacteria | 1408 |
| 143 | Ga0307410_10013576 | 3300031852 | Bacteria | 4758 |
| 144 | Ga0307410_10022134 | 3300031852 | Bacteria | 3923 |
| 145 | Ga0307410_10032039 | 3300031852 | Bacteria | 3378 |
| 146 | Ga0307410_10114518 | 3300031852 | Bacteria | 1956 |
| 147 | Ga0307407_10007474 | 3300031903 | Bacteria | 4951 |
| 148 | Ga0307407_10020894 | 3300031903 | Bacteria | 3364 |
| 149 | Ga0307412_10002704 | 3300031911 | Bacteria | 9848 |
| 150 | Ga0307412_10006120 | 3300031911 | Bacteria | 6781 |
| 151 | Ga0307412_10052198 | 3300031911 | Bacteria | 2706 |
| 152 | Ga0307412_10053564 | 3300031911 | Bacteria | 2675 |
| 153 | Ga0307412_10093975 | 3300031911 | Bacteria | 2105 |
| 154 | Ga0307412_10102872 | 3300031911 | Bacteria | 2023 |
| 155 | Ga0307412_10151324 | 3300031911 | Bacteria | 1712 |
| 156 | Ga0307409_100049723 | 3300031995 | Bacteria | 3198 |
| 157 | Ga0307409_100056031 | 3300031995 | Bacteria | 3047 |
| 158 | Ga0307409_100107027 | 3300031995 | Bacteria | 2335 |
| 159 | Ga0307409_100259223 | 3300031995 | Bacteria | 1594 |
| 160 | Ga0307409_100364911 | 3300031995 | Bacteria | 1367 |
| 161 | Ga0307416_100038773 | 3300032002 | Bacteria | 3679 |
| 162 | Ga0307416_100103652 | 3300032002 | Bacteria | 2484 |
| 163 | Ga0307416_100148954 | 3300032002 | Bacteria | 2142 |
| 164 | Ga0307416_100268506 | 3300032002 | Bacteria | 1673 |
| 165 | Ga0307414_10116136 | 3300032004 | Bacteria | 2048 |
| 166 | Ga0307415_100011180 | 3300032126 | Bacteria | 5122 |
| 167 | Ga0307415_100022823 | 3300032126 | Bacteria | 3871 |
| 168 | Ga0307415_100169004 | 3300032126 | Bacteria | 1703 |
| 169 | Ga0395900_0056619 | 3300037418 | Bacteria | 4035 |
| 170 | Ga0395898_0036370 | 3300037466 | Bacteria | 4888 |
| 171 | Ga0436364_0086996 | 3300037853 | Bacteria | 5122 |
| 172 | Ga0436365_0844488 | 3300039437 | Bacteria | 2230 |
| 173 | Ga0439436_0011123 | 3300041404 | Bacteria | 2735 |
| 174 | Ga0439438_012213 | 3300041405 | Bacteria | 2640 |
| 175 | Ga0439439_0001834 | 3300041406 | Bacteria | 4359 |
| 176 | Ga0439461_0000848 | 3300041410 | Bacteria | 4521 |
| 177 | Ga0439466_0022841 | 3300041411 | Bacteria | 2204 |
| 178 | Ga0439465_0007384 | 3300041413 | Bacteria | 3492 |
| 179 | Ga0439433_0000660 | 3300041999 | Bacteria | 6620 |
| 180 | Ga0439433_0007319 | 3300041999 | Bacteria | 2383 |
| 181 | Ga0439442_000104 | 3300042002 | Bacteria | 20823 |
| 182 | Ga0439442_000863 | 3300042002 | Bacteria | 6245 |
| 183 | Ga0439442_001194 | 3300042002 | Bacteria | 5170 |
| 184 | Ga0439442_001822 | 3300042002 | Bacteria | 4169 |
| 185 | Ga0439448_0034454 | 3300042005 | Bacteria | 1618 |
| 186 | Ga0439432_003360 | 3300042006 | Bacteria | 5935 |
| 187 | Ga0439449_0001244 | 3300042007 | Bacteria | 9983 |
| 188 | Ga0439449_0021277 | 3300042007 | Bacteria | 2428 |
| 189 | Ga0439452_004926 | 3300042010 | Bacteria | 4380 |
| 190 | Ga0439457_000337 | 3300042014 | Bacteria | 12991 |
| 191 | Ga0450920_000558 | 3300042122 | Bacteria | 5903 |
| 192 | Ga0450920_010549 | 3300042122 | Bacteria | 1714 |
| 193 | Ga0450907_000160 | 3300042146 | Bacteria | 25120 |
| 194 | Ga0439446_0020770 | 3300042156 | Bacteria | 1852 |
| 195 | Ga0450908_000360 | 3300042184 | Bacteria | 8790 |
| 196 | Ga0439434_0013054 | 3300042435 | Bacteria | 2463 |
| 197 | Ga0439459_0005314 | 3300042438 | Bacteria | 2112 |
| 198 | Ga0450918_001161 | 3300042531 | Bacteria | 5399 |
| 199 | Ga0450918_001338 | 3300042531 | Bacteria | 4943 |
| 200 | Ga0466965_0102255 | 3300044683 | Bacteria | 1466 |
| 201 | Ga0466963_0015935 | 3300044694 | Bacteria | 4667 |
| 202 | Ga0466964_0086814 | 3300044706 | Bacteria | 1354 |
| 203 | Ga0466958_0112540 | 3300045836 | Bacteria | 1700 |
| 204 | Ga0466967_0011802 | 3300045976 | Bacteria | 6643 |
| 205 | Ga0466967_0494395 | 3300045976 | Bacteria | 1200 |
| 206 | Ga0495653_0004024 | 3300046463 | Bacteria | 11869 |
| 207 | Ga0495580_0004638 | 3300046472 | Bacteria | 11545 |
| 208 | Ga0495580_0022228 | 3300046472 | Bacteria | 4670 |
| 209 | Ga0495582_0100471 | 3300046473 | Bacteria | 1619 |
| 210 | Ga0495639_0004095 | 3300046475 | Bacteria | 6246 |
| 211 | Ga0495639_0020935 | 3300046475 | Bacteria | 2861 |
| 212 | Ga0495662_0040212 | 3300046476 | Bacteria | 2258 |
| 213 | Ga0495664_0002097 | 3300046477 | Bacteria | 10661 |
| 214 | Ga0495607_0012565 | 3300046501 | Bacteria | 5583 |
| 215 | Ga0495631_0032348 | 3300046518 | Bacteria | 2360 |
| 216 | Ga0495642_0019116 | 3300046528 | Bacteria | 2683 |
| 217 | Ga0495665_0005559 | 3300046531 | Bacteria | 6793 |
| 218 | Ga0495665_0038213 | 3300046531 | Bacteria | 2560 |
| 219 | Ga0495586_0009788 | 3300046535 | Bacteria | 5102 |
| 220 | Ga0495586_0084014 | 3300046535 | Bacteria | 1752 |
| 221 | Ga0495586_0085619 | 3300046535 | Bacteria | 1736 |
| 222 | Ga0495645_0000895 | 3300046543 | Bacteria | 20304 |
| 223 | Ga0495622_0012575 | 3300046557 | Bacteria | 3922 |
| 224 | Ga0495667_0001640 | 3300046559 | Bacteria | 14816 |
| 225 | Ga0495656_0006135 | 3300046615 | Bacteria | 4197 |
| 226 | Ga0495668_0000704 | 3300046616 | Bacteria | 40286 |
| 227 | Ga0495635_0127664 | 3300046663 | Bacteria | 1734 |
| 228 | Ga0495588_0001696 | 3300046674 | Bacteria | 9373 |
| 229 | Ga0495588_0034652 | 3300046674 | Bacteria | 2555 |
| 230 | Ga0495588_0075799 | 3300046674 | Bacteria | 1752 |
| 231 | Ga0495670_0005577 | 3300046691 | Bacteria | 6176 |
| 232 | Ga0495670_0087533 | 3300046691 | Bacteria | 1591 |
| 233 | Ga0495600_0057040 | 3300046809 | Bacteria | 2551 |
| 234 | Ga0495581_0002121 | 3300047315 | Bacteria | 11181 |
| 235 | Ga0495581_0003523 | 3300047315 | Bacteria | 8978 |
| 236 | Ga0495581_0026722 | 3300047315 | Bacteria | 3346 |
| 237 | Ga0495636_0010341 | 3300047318 | Bacteria | 3684 |
| 238 | Ga0495676_0134068 | 3300047321 | Bacteria | 1784 |
| 239 | Ga0495680_0019919 | 3300047322 | Bacteria | 5655 |
| 240 | Ga0495683_0000380 | 3300047323 | Bacteria | 36306 |
| 241 | Ga0495675_0006657 | 3300047444 | Bacteria | 7076 |
| 242 | Ga0495685_050198 | 3300047447 | Bacteria | 1416 |
| 243 | Ga0495684_0149240 | 3300047471 | Bacteria | 1749 |
| 244 | Ga0496100_0022093 | 3300048903 | Bacteria | 3844 |
| 245 | Ga0496100_0224054 | 3300048903 | Bacteria | 1381 |
| 246 | Ga0496101_0003224 | 3300048904 | Bacteria | 10118 |
| 247 | Ga0496101_0104600 | 3300048904 | Bacteria | 2123 |
| 248 | Ga0496101_0161438 | 3300048904 | Bacteria | 1719 |
| 249 | Ga0496102_0020005 | 3300048905 | Bacteria | 5905 |
| 250 | Ga0496102_0048417 | 3300048905 | Bacteria | 3865 |
| 251 | Ga0496102_0074208 | 3300048905 | Bacteria | 3127 |
| 252 | Ga0496103_0015142 | 3300048906 | Bacteria | 4586 |
| 253 | Ga0496104_0015402 | 3300048907 | Bacteria | 6925 |
| 254 | Ga0496104_0098941 | 3300048907 | Bacteria | 2792 |
| 255 | Ga0496105_0011935 | 3300048908 | Bacteria | 6879 |
| 256 | Ga0496105_0055039 | 3300048908 | Bacteria | 3285 |
| 257 | Ga0496105_0121273 | 3300048908 | Bacteria | 2155 |
| 258 | Ga0496106_0004227 | 3300048909 | Bacteria | 10690 |
| 259 | Ga0496106_0017614 | 3300048909 | Bacteria | 5284 |
| 260 | Ga0496106_0045892 | 3300048909 | Bacteria | 3283 |
| 261 | Ga0496107_0021891 | 3300048910 | Bacteria | 4516 |
| 262 | Ga0496107_0043823 | 3300048910 | Bacteria | 3215 |
| 263 | Ga0496107_0084797 | 3300048910 | Bacteria | 2311 |
| 264 | Ga0496108_0044545 | 3300048911 | Bacteria | 3703 |
| 265 | Ga0496108_0053626 | 3300048911 | Bacteria | 3381 |
| 266 | Ga0496108_0236050 | 3300048911 | Bacteria | 1590 |
| 267 | Ga0496109_0027713 | 3300048912 | Bacteria | 5061 |
| 268 | Ga0496110_0065405 | 3300048913 | Bacteria | 3214 |
| 269 | Ga0496110_0152680 | 3300048913 | Bacteria | 2091 |
| 270 | Ga0496110_0215820 | 3300048913 | Bacteria | 1744 |
| 271 | Ga0496110_0335866 | 3300048913 | Bacteria | 1376 |
| 272 | Ga0496110_0388700 | 3300048913 | Bacteria | 1272 |
| 273 | Ga0496111_0008600 | 3300048914 | Bacteria | 6767 |
| 274 | Ga0496111_0105297 | 3300048914 | Bacteria | 2075 |
| 275 | Ga0496112_0006573 | 3300048915 | Bacteria | 10232 |
| 276 | Ga0496112_0426554 | 3300048915 | Bacteria | 1264 |
| 277 | Ga0496113_0011899 | 3300048916 | Bacteria | 5831 |
| 278 | Ga0496113_0094361 | 3300048916 | Bacteria | 2311 |
| 279 | Ga0496113_0198961 | 3300048916 | Bacteria | 1592 |
| 280 | Ga0496114_0004897 | 3300048917 | Bacteria | 10429 |
| 281 | Ga0496114_0060524 | 3300048917 | Bacteria | 3165 |
| 282 | Ga0496115_0137502 | 3300048918 | Bacteria | 2015 |
| 283 | Ga0496125_0053062 | 3300048928 | Bacteria | 3327 |
| 284 | Ga0501032_0000135 | 3300049569 | Bacteria | 60174 |
| 285 | Ga0501032_0008860 | 3300049569 | Bacteria | 7314 |
| 286 | Ga0501034_0000505 | 3300049571 | Bacteria | 62933 |
| 287 | Ga0501036_0136563 | 3300049572 | Bacteria | 2070 |
| 288 | Ga0501037_0006975 | 3300049573 | Bacteria | 8250 |
| 289 | Ga0501037_0114830 | 3300049573 | Bacteria | 1938 |
| 290 | Ga0501039_0014706 | 3300049575 | Bacteria | 5986 |
| 291 | Ga0501039_0225613 | 3300049575 | Bacteria | 1472 |
| 292 | Ga0501043_0062112 | 3300049579 | Bacteria | 2933 |
| 293 | nmdc:mga00v17_58689_c1 | 3300050491 | Bacteria | 2358 |
| 294 | nmdc:mga05p37_94840_c1 | 3300050507 | Bacteria | 2708 |
| 295 | nmdc:mga08y16_238829_c1 | 3300050511 | Bacteria | 1879 |
| 296 | nmdc:mga0n895_62754_c1 | 3300050512 | Bacteria | 3674 |
| 297 | nmdc:mga0rr50_5371_c1 | 3300050513 | Bacteria | 7636 |
| 298 | nmdc:mga0a205_6270_c1 | 3300050515 | Bacteria | 10733 |
| 299 | Ga0500568_0001142 | 3300053139 | Bacteria | 17813 |
| 300 | 2566997363 | 2565956761 | Bacteria | 6601618 |
| 301 | 2643851071 | 2643221567 | Bacteria | 4163945 |
| 302 | 2644134824 | 2643221624 | Bacteria | 4384879 |
| 303 | 2644491023 | 2643221687 | Bacteria | 6500351 |
| 304 | 2644525375 | 2643221694 | Bacteria | 4392972 |
| 305 | 2644669459 | 2643221722 | Bacteria | 4247614 |
| 306 | 2691514656 | 2690315906 | Bacteria | 4517044 |
| 307 | 2738888078 | 2738541308 | Bacteria | 7020677 |
| 308 | 2739238544 | 2738543011 | Bacteria | 5731169 |
| 309 | 2744954667 | 2744054611 | Bacteria | 5611514 |
| 310 | 2775655006 | 2775506735 | Bacteria | 4556596 |
| 311 | 2784471593 | 2784132109 | Bacteria | 3141763 |
| 312 | 2808827769 | 2808606357 | Bacteria | 4466944 |
| 313 | 2808853123 | 2808606360 | Bacteria | 4404006 |
| 314 | 2808878375 | 2808606366 | Bacteria | 4415912 |
| 315 | 2808892014 | 2808606370 | Bacteria | 4942454 |
| 316 | 2808897106 | 2808606371 | Bacteria | 4251511 |
| 317 | 2810364266 | 2808606700 | Bacteria | 3482157 |
| 318 | 2812320468 | 2811994871 | Bacteria | 4497550 |
| 319 | 2842892140 | 2842888712 | Bacteria | 4279094 |
| 320 | 2844849620 | 2844849076 | Bacteria | 4091819 |
| 321 | 2857741255 | 2857740372 | Bacteria | 4782044 |
| 322 | 2889302978 | 2889300758 | Bacteria | 5690814 |
| 323 | 2904499728 | 2904497146 | Bacteria | 4731781 |
| 324 | 2904538292 | 2904535858 | Bacteria | 6308016 |
| 325 | 2904776714 | 2904776348 | Bacteria | 4658726 |
| 326 | 2905927801 | 2905926851 | Bacteria | 4423176 |
| 327 | 2910813321 | 2910809715 | Bacteria | 4982797 |
| 328 | 2919036262 | 2919034639 | Bacteria | 4763403 |
| 329 | 2919061625 | 2919059106 | Bacteria | 4991624 |
| 330 | 2919391520 | 2919391150 | Bacteria | 4884741 |
| 331 | 2919542238 | 2919538618 | Bacteria | 4677069 |
| 332 | 2922557484 | 2922554459 | Bacteria | 6683962 |
| 333 | 2928145638 | 2928142448 | Bacteria | 5288925 |
| 334 | 2932429306 | 2932426870 | Bacteria | 4547726 |
| 335 | 2933420788 | 2933418574 | Bacteria | 4476724 |
| 336 | 2939598743 | 2939598168 | Bacteria | 4687164 |
| 337 | 2939648792 | 2939647034 | Bacteria | 4681660 |
| 338 | 2939675997 | 2939674588 | Bacteria | 4844420 |
| 339 | 2939746144 | 2939743619 | Bacteria | 5762299 |
| 340 | 2945918227 | 2945916053 | Bacteria | 4555517 |
| 341 | 2945921487 | 2945920336 | Bacteria | 4501603 |
| 342 | 2945942327 | 2945941187 | Bacteria | 4682474 |
| 343 | 2945959916 | 2945956166 | Bacteria | 5110334 |
| 344 | 2946038272 | 2946037020 | Bacteria | 4900426 |
| 345 | 2946062076 | 2946059875 | Bacteria | 4386623 |
| 346 | 2953999547 | 2953998280 | Bacteria | 4812144 |
| 347 | 2956941294 | 2956939328 | Bacteria | 3474458 |
| 348 | 2974306258 | 2974302888 | Bacteria | 4369871 |
| 349 | 2974318205 | 2974315732 | Bacteria | 4602776 |
| 350 | 2984526417 | 2984523437 | Bacteria | 4508481 |
| 351 | 3001120278 | 3001119090 | Bacteria | 3449530 |
| 352 | 8004023151 | 8004021418 | Bacteria | 4313954 |
| 353 | 8004026251 | 8004025490 | Bacteria | 4327753 |
| 354 | 8054110966 | 8054107350 | Bacteria | 5022511 |
| 355 | 8057575173 | 8057568493 | Bacteria | 7221719 |
| 356 | Ga0207677_10004154 | |||
| 357 | LJQas_1000396 | |||
| 358 | LJQas_1005357 | |||
| 359 | JGI25152J39213_1000687 | |||
| 360 | Ga0065714_10009923 | |||
| 361 | Ga0070683_100202372 | |||
| 362 | Ga0070670_100024161 | |||
| 363 | Ga0068869_100037147 | |||
| 364 | Ga0070680_100066610 | |||
| 365 | Ga0070682_100045674 | |||
| 366 | Ga0068868_100010506 | |||
| 367 | Ga0070660_100094244 | |||
| 368 | Ga0070689_100125802 | |||
| 369 | Ga0070691_10003926 | |||
| 370 | Ga0070669_100047416 | |||
| 371 | Ga0070671_100000423 | |||
| 372 | Ga0070671_100038229 | |||
| 373 | Ga0070674_100237643 | |||
| 374 | Ga0070659_100056659 | |||
| 375 | Ga0070667_100039624 | |||
| 376 | Ga0070709_10089825 | |||
| 377 | Ga0070714_100027706 | |||
| 378 | Ga0070713_100056883 | |||
| 379 | Ga0070711_100005145 | |||
| 380 | Ga0070663_100004764 | |||
| 381 | Ga0070678_100001811 | |||
| 382 | Ga0070678_100050161 | |||
| 383 | Ga0070681_10120531 | |||
| 384 | Ga0070664_100162881 | |||
| 385 | Ga0068854_100094297 | |||
| 386 | Ga0068856_100061096 | |||
| 387 | Ga0070702_100017023 | |||
| 388 | Ga0068852_100003907 | |||
| 389 | Ga0068852_100237055 | |||
| 390 | Ga0068859_100018104 | |||
| 391 | Ga0068864_100020358 | |||
| 392 | Ga0068864_100148966 | |||
| 393 | Ga0068851_10104885 | |||
| 394 | Ga0068870_10000378 | |||
| 395 | Ga0068863_100003154 | |||
| 396 | Ga0075432_10002093 | |||
| 397 | Ga0097621_100133051 | |||
| 398 | Ga0068871_100021222 | |||
| 399 | Ga0075431_100115517 | |||
| 400 | Ga0075433_10020121 | |||
| 401 | Ga0075434_100039067 | |||
| 402 | Ga0075436_100021210 | |||
| 403 | Ga0097620_100018103 | |||
| 404 | Ga0075435_100049543 | |||
| 405 | Ga0105244_10038017 | |||
| 406 | Ga0105240_10092708 | |||
| 407 | Ga0111539_10254395 | |||
| 408 | Ga0105245_10009937 | |||
| 409 | Ga0105247_10004708 | |||
| 410 | Ga0105243_10000243 | |||
| 411 | Ga0105243_10010786 | |||
| 412 | Ga0105242_10172897 | |||
| 413 | Ga0105248_10001229 | |||
| 414 | Ga0105248_10139088 | |||
| 415 | Ga0105237_10185905 | |||
| 416 | Ga0105246_10001005 | |||
| 417 | Ga0105246_10001940 | |||
| 418 | Ga0105246_10002771 | |||
| 419 | Ga0105246_10029956 | |||
| 420 | Ga0105246_10071429 | |||
| 421 | Ga0105246_10249921 | |||
| 422 | Ga0157371_10017375 | |||
| 423 | Ga0157370_10008743 | |||
| 424 | Ga0157370_10065726 | |||
| 425 | Ga0157369_10042050 | |||
| 426 | Ga0157369_10060252 | |||
| 427 | Ga0157369_10092208 | |||
| 428 | Ga0157369_10136512 | |||
| 429 | Ga0157369_10142766 | |||
| 430 | Ga0163162_10506917 | |||
| 431 | Ga0157375_10023281 | |||
| 432 | Ga0157375_10159333 | |||
| 433 | Ga0157377_10027395 | |||
| 434 | Ga0157379_10000003 | |||
| 435 | Ga0206354_11468621 | |||
| 436 | Ga0207425_1006465 | |||
| 437 | Ga0209148_1001977 | |||
| 438 | Ga0209129_1000176 | |||
| 439 | Ga0209025_1001775 | |||
| 440 | Ga0207697_10002874 | |||
| 441 | Ga0207655_1008493 | |||
| 442 | Ga0207655_1011392 | |||
| 443 | Ga0207713_1029996 | |||
| 444 | Ga0207710_10031473 | |||
| 445 | Ga0207647_10051010 | |||
| 446 | Ga0207699_10070888 | |||
| 447 | Ga0207645_10019761 | |||
| 448 | Ga0207643_10000027 | |||
| 449 | Ga0207654_10016078 | |||
| 450 | Ga0207707_10029975 | |||
| 451 | Ga0207695_10140608 | |||
| 452 | Ga0207693_10158115 | |||
| 453 | Ga0207660_10008258 | |||
| 454 | Ga0207657_10162962 | |||
| 455 | Ga0207652_10046574 | |||
| 456 | Ga0207681_10020789 | |||
| 457 | Ga0207650_10008952 | |||
| 458 | Ga0207659_10032483 | |||
| 459 | Ga0207687_10004998 | |||
| 460 | Ga0207700_10009354 | |||
| 461 | Ga0207664_10111246 | |||
| 462 | Ga0207644_10003193 | |||
| 463 | Ga0207709_10002398 | |||
| 464 | Ga0207670_10016896 | |||
| 465 | Ga0207691_10003245 | |||
| 466 | Ga0207691_10212475 | |||
| 467 | Ga0207711_10162692 | |||
| 468 | Ga0207689_10000694 | |||
| 469 | Ga0207661_10004797 | |||
| 470 | Ga0207661_10262780 | |||
| 471 | Ga0207679_10006279 | |||
| 472 | Ga0207658_10134788 | |||
| 473 | Ga0207703_10000001 | |||
| 474 | Ga0207678_10000488 | |||
| 475 | Ga0207702_10001529 | |||
| 476 | Ga0207702_10023136 | |||
| 477 | Ga0207641_10007723 | |||
| 478 | Ga0207676_10000549 | |||
| 479 | Ga0207683_10001061 | |||
| 480 | Ga0207698_10233068 | |||
| 481 | Ga0207428_10026079 | |||
| 482 | Ga0268266_10076666 | |||
| 483 | Ga0307408_100000956 | |||
| 484 | Ga0307408_100025575 | |||
| 485 | Ga0307408_100128333 | |||
| 486 | Ga0307408_100153924 | |||
| 487 | Ga0307408_100170001 | |||
| 488 | Ga0307405_10036257 | |||
| 489 | Ga0307405_10091855 | |||
| 490 | Ga0307405_10109226 | |||
| 491 | Ga0307405_10121778 | |||
| 492 | Ga0307413_10006432 | |||
| 493 | Ga0307413_10022087 | |||
| 494 | Ga0307413_10038152 | |||
| 495 | Ga0307413_10055313 | |||
| 496 | Ga0307413_10061658 | |||
| 497 | Ga0307413_10211631 | |||
| 498 | Ga0307410_10013576 | |||
| 499 | Ga0307410_10022134 | |||
| 500 | Ga0307410_10032039 | |||
| 501 | Ga0307410_10114518 | |||
| 502 | Ga0307407_10007474 | |||
| 503 | Ga0307407_10020894 | |||
| 504 | Ga0307412_10002704 | |||
| 505 | Ga0307412_10006120 | |||
| 506 | Ga0307412_10052198 | |||
| 507 | Ga0307412_10053564 | |||
| 508 | Ga0307412_10093975 | |||
| 509 | Ga0307412_10102872 | |||
| 510 | Ga0307412_10151324 | |||
| 511 | Ga0307409_100049723 | |||
| 512 | Ga0307409_100056031 | |||
| 513 | Ga0307409_100107027 | |||
| 514 | Ga0307409_100259223 | |||
| 515 | Ga0307409_100364911 | |||
| 516 | Ga0307416_100038773 | |||
| 517 | Ga0307416_100103652 | |||
| 518 | Ga0307416_100148954 | |||
| 519 | Ga0307416_100268506 | |||
| 520 | Ga0307414_10116136 | |||
| 521 | Ga0307415_100011180 | |||
| 522 | Ga0307415_100022823 | |||
| 523 | Ga0307415_100169004 | |||
| 524 | Ga0395900_0056619 | |||
| 525 | Ga0395898_0036370 | |||
| 526 | Ga0436364_0086996 | |||
| 527 | Ga0436365_0844488 | |||
| 528 | Ga0439436_0011123 | |||
| 529 | Ga0439438_012213 | |||
| 530 | Ga0439439_0001834 | |||
| 531 | Ga0439461_0000848 | |||
| 532 | Ga0439466_0022841 | |||
| 533 | Ga0439465_0007384 | |||
| 534 | Ga0439433_0000660 | |||
| 535 | Ga0439433_0007319 | |||
| 536 | Ga0439442_000104 | |||
| 537 | Ga0439442_000863 | |||
| 538 | Ga0439442_001194 | |||
| 539 | Ga0439442_001822 | |||
| 540 | Ga0439448_0034454 | |||
| 541 | Ga0439432_003360 | |||
| 542 | Ga0439449_0001244 | |||
| 543 | Ga0439449_0021277 | |||
| 544 | Ga0439452_004926 | |||
| 545 | Ga0439457_000337 | |||
| 546 | Ga0450920_000558 | |||
| 547 | Ga0450920_010549 | |||
| 548 | Ga0450907_000160 | |||
| 549 | Ga0439446_0020770 | |||
| 550 | Ga0450908_000360 | |||
| 551 | Ga0439434_0013054 | |||
| 552 | Ga0439459_0005314 | |||
| 553 | Ga0450918_001161 | |||
| 554 | Ga0450918_001338 | |||
| 555 | Ga0466965_0102255 | |||
| 556 | Ga0466963_0015935 | |||
| 557 | Ga0466964_0086814 | |||
| 558 | Ga0466958_0112540 | |||
| 559 | Ga0466967_0011802 | |||
| 560 | Ga0466967_0494395 | |||
| 561 | Ga0495653_0004024 | |||
| 562 | Ga0495580_0004638 | |||
| 563 | Ga0495580_0022228 | |||
| 564 | Ga0495582_0100471 | |||
| 565 | Ga0495639_0004095 | |||
| 566 | Ga0495639_0020935 | |||
| 567 | Ga0495662_0040212 | |||
| 568 | Ga0495664_0002097 | |||
| 569 | Ga0495607_0012565 | |||
| 570 | Ga0495631_0032348 | |||
| 571 | Ga0495642_0019116 | |||
| 572 | Ga0495665_0005559 | |||
| 573 | Ga0495665_0038213 | |||
| 574 | Ga0495586_0009788 | |||
| 575 | Ga0495586_0084014 | |||
| 576 | Ga0495586_0085619 | |||
| 577 | Ga0495645_0000895 | |||
| 578 | Ga0495622_0012575 | |||
| 579 | Ga0495667_0001640 | |||
| 580 | Ga0495656_0006135 | |||
| 581 | Ga0495668_0000704 | |||
| 582 | Ga0495635_0127664 | |||
| 583 | Ga0495588_0001696 | |||
| 584 | Ga0495588_0034652 | |||
| 585 | Ga0495588_0075799 | |||
| 586 | Ga0495670_0005577 | |||
| 587 | Ga0495670_0087533 | |||
| 588 | Ga0495600_0057040 | |||
| 589 | Ga0495581_0002121 | |||
| 590 | Ga0495581_0003523 | |||
| 591 | Ga0495581_0026722 | |||
| 592 | Ga0495636_0010341 | |||
| 593 | Ga0495676_0134068 | |||
| 594 | Ga0495680_0019919 | |||
| 595 | Ga0495683_0000380 | |||
| 596 | Ga0495675_0006657 | |||
| 597 | Ga0495685_050198 | |||
| 598 | Ga0495684_0149240 | |||
| 599 | Ga0496100_0022093 | |||
| 600 | Ga0496100_0224054 | |||
| 601 | Ga0496101_0003224 | |||
| 602 | Ga0496101_0104600 | |||
| 603 | Ga0496101_0161438 | |||
| 604 | Ga0496102_0020005 | |||
| 605 | Ga0496102_0048417 | |||
| 606 | Ga0496102_0074208 | |||
| 607 | Ga0496103_0015142 | |||
| 608 | Ga0496104_0015402 | |||
| 609 | Ga0496104_0098941 | |||
| 610 | Ga0496105_0011935 | |||
| 611 | Ga0496105_0055039 | |||
| 612 | Ga0496105_0121273 | |||
| 613 | Ga0496106_0004227 | |||
| 614 | Ga0496106_0017614 | |||
| 615 | Ga0496106_0045892 | |||
| 616 | Ga0496107_0021891 | |||
| 617 | Ga0496107_0043823 | |||
| 618 | Ga0496107_0084797 | |||
| 619 | Ga0496108_0044545 | |||
| 620 | Ga0496108_0053626 | |||
| 621 | Ga0496108_0236050 | |||
| 622 | Ga0496109_0027713 | |||
| 623 | Ga0496110_0065405 | |||
| 624 | Ga0496110_0152680 | |||
| 625 | Ga0496110_0215820 | |||
| 626 | Ga0496110_0335866 | |||
| 627 | Ga0496110_0388700 | |||
| 628 | Ga0496111_0008600 | |||
| 629 | Ga0496111_0105297 | |||
| 630 | Ga0496112_0006573 | |||
| 631 | Ga0496112_0426554 | |||
| 632 | Ga0496113_0011899 | |||
| 633 | Ga0496113_0094361 | |||
| 634 | Ga0496113_0198961 | |||
| 635 | Ga0496114_0004897 | |||
| 636 | Ga0496114_0060524 | |||
| 637 | Ga0496115_0137502 | |||
| 638 | Ga0496125_0053062 | |||
| 639 | Ga0501032_0000135 | |||
| 640 | Ga0501032_0008860 | |||
| 641 | Ga0501034_0000505 | |||
| 642 | Ga0501036_0136563 | |||
| 643 | Ga0501037_0006975 | |||
| 644 | Ga0501037_0114830 | |||
| 645 | Ga0501039_0014706 | |||
| 646 | Ga0501039_0225613 | |||
| 647 | Ga0501043_0062112 | |||
| 648 | nmdc:mga00v17_58689_c1 | |||
| 649 | nmdc:mga05p37_94840_c1 | |||
| 650 | nmdc:mga08y16_238829_c1 | |||
| 651 | nmdc:mga0n895_62754_c1 | |||
| 652 | nmdc:mga0rr50_5371_c1 | |||
| 653 | nmdc:mga0a205_6270_c1 | |||
| 654 | Ga0500568_0001142 | |||
| 655 | 2566997363 | |||
| 656 | 2643851071 | |||
| 657 | 2644134824 | |||
| 658 | 2644491023 | |||
| 659 | 2644525375 | |||
| 660 | 2644669459 | |||
| 661 | 2691514656 | |||
| 662 | 2738888078 | |||
| 663 | 2739238544 | |||
| 664 | 2744954667 | |||
| 665 | 2775655006 | |||
| 666 | 2784471593 | |||
| 667 | 2808827769 | |||
| 668 | 2808853123 | |||
| 669 | 2808878375 | |||
| 670 | 2808892014 | |||
| 671 | 2808897106 | |||
| 672 | 2810364266 | |||
| 673 | 2812320468 | |||
| 674 | 2842892140 | |||
| 675 | 2844849620 | |||
| 676 | 2857741255 | |||
| 677 | 2889302978 | |||
| 678 | 2904499728 | |||
| 679 | 2904538292 | |||
| 680 | 2904776714 | |||
| 681 | 2905927801 | |||
| 682 | 2910813321 | |||
| 683 | 2919036262 | |||
| 684 | 2919061625 | |||
| 685 | 2919391520 | |||
| 686 | 2919542238 | |||
| 687 | 2922557484 | |||
| 688 | 2928145638 | |||
| 689 | 2932429306 | |||
| 690 | 2933420788 | |||
| 691 | 2939598743 | |||
| 692 | 2939648792 | |||
| 693 | 2939675997 | |||
| 694 | 2939746144 | |||
| 695 | 2945918227 | |||
| 696 | 2945921487 | |||
| 697 | 2945942327 | |||
| 698 | 2945959916 | |||
| 699 | 2946038272 | |||
| 700 | 2946062076 | |||
| 701 | 2953999547 | |||
| 702 | 2956941294 | |||
| 703 | 2974306258 | |||
| 704 | 2974318205 | |||
| 705 | 2984526417 | |||
| 706 | 3001120278 | |||
| 707 | 8004023151 | |||
| 708 | 8004026251 | |||
| 709 | 8054110966 | |||
| 710 | 8057575173 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5auq-assembly1.cif.gz_A | crystal structure of atpase-type hypb in the nucleotide free state | 0.8737 | 113 | 357 |
| 5auq-assembly4.cif.gz_F | crystal structure of atpase-type hypb in the nucleotide free state | 0.8709 | 113 | 357 |
| 5auq-assembly3.cif.gz_C | crystal structure of atpase-type hypb in the nucleotide free state | 0.8705 | 113 | 357 |
| 5auq-assembly4.cif.gz_D | crystal structure of atpase-type hypb in the nucleotide free state | 0.8686 | 113 | 357 |
| 5auq-assembly2.cif.gz_B | crystal structure of atpase-type hypb in the nucleotide free state | 0.8634 | 113 | 357 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJN7_3_100_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9934 | 2 | 96 | 3.30.300.130 |
| af_P9WJN7_114_362_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9786 | 111 | 357 | 3.40.50.300 |
| af_P9WJN7_114_362_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.967 | 111 | 357 | 3.40.50.300 |
| af_P9WJN7_3_100_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9535 | 2 | 96 | 3.30.300.130 |
| af_Q2FW86_86_295_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9426 | 110 | 323 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J6K2Y0-F1-model_v4 | Unannotated protein | 0.9776 | 166 | 360 |
GO:0005524
GO:0016226 GO:0051539 |
| AF-A0A2U2AWS9-F1-model_v4 | deleted | 0.9758 | 7 | 329 |
|
| AF-A0A6F8YH02-F1-model_v4 | MIP18 family-like domain-containing protein | 0.967 | 5 | 231 |
GO:0005524
GO:0016226 GO:0051539 |
| AF-A0A068NFQ4-F1-model_v4 | deleted | 0.9641 | 7 | 363 |
|
| AF-A0A0U0W7D1-F1-model_v4 | Iron-sulfur cluster carrier protein | 0.9632 | 1 | 374 |
GO:0005524
GO:0016226 GO:0016887 GO:0046872 GO:0051539 GO:0140663 |