F420078

General Info

Members Datasets Scaffolds Average Seq Length
355 233 351 299

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10183906|Ga0075370_101839062
Length 333
Sequence VAIQYNRLTHSSEAKHLMSAGTRLPGTPDPMHTWPGVGGVRLAGDSWGDPDGPLVLLQHGGGQTRHAWKGAGEKLGQAGYHAIAFDARGHGDSDWAPDGQYGQDVMVEDLKCVIAALGNKRPVLVGASMGGGTSLVAVGEDHVDATALVMVDIGPRIEPDGIDKIRAFMTLKPEGFTSLQEVADAIASYQPQRVRPKSLDGLAKNVRLGSDGKYHWHWDPQFRAGRFDLEKRQQRLEACSRNLTLPTLMVRGGLSDVLSEEGAQHFLKLCPHAEYVNVTGAGHMVAGDRNDVFGTSVIAFLRRAVPVGGEPVQKAHATRPHHEGPEGDVKDVP

Samples

Sample ID Description Type Environment
1 2511231008 Pseudomonas sp. GM21 Isolate Nodule
2 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
3 2547132424 Nocardia nova SH22a Isolate Unclassified
4 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
150 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
151 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
228 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
229 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
230 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
231 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
232 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.68
Nodule 0.28
Rhizoplane 1.97
Rhizosphere 78.59
Stem 0
Stem Tuber 0
Unclassified 6.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001959 3300001904 Bacteria 3658
2 JGI24740J21852_10001961 3300001979 Bacteria 9398
3 JGI24740J21852_10004632 3300001979 Bacteria 5898
4 JGI24739J22299_10001798 3300001989 Bacteria 8166
5 JGI24737J22298_10002980 3300001990 Bacteria 5997
6 JGI24735J21928_10001854 3300002067 Bacteria 7422
7 rootH1_10118232 3300003323 Bacteria 1194
8 Ga0055536_1000263 3300003781 Bacteria 40966
9 Ga0055536_1002348 3300003781 Bacteria 10714
10 Ga0070676_10020232 3300005328 Bacteria 3712
11 Ga0070676_10205343 3300005328 Bacteria 1294
12 Ga0070670_100000707 3300005331 Bacteria 25872
13 Ga0070670_100009075 3300005331 Bacteria 8498
14 Ga0070670_100376609 3300005331 Unclassified 1250
15 Ga0070677_10002187 3300005333 Bacteria 6247
16 Ga0068869_100000115 3300005334 Bacteria 38487
17 Ga0070666_10022037 3300005335 Bacteria 4134
18 Ga0070666_10152420 3300005335 Bacteria 1613
19 Ga0068868_100204745 3300005338 Bacteria 1647
20 Ga0070660_100003394 3300005339 Bacteria 10956
21 Ga0070660_100207461 3300005339 Bacteria 1590
22 Ga0070661_100008581 3300005344 Bacteria 7067
23 Ga0070668_100044795 3300005347 Bacteria 3394
24 Ga0070669_100025822 3300005353 Bacteria 4222
25 Ga0070669_100085283 3300005353 Bacteria 2358
26 Ga0070675_100024848 3300005354 Bacteria 4800
27 Ga0070671_100080744 3300005355 Bacteria 2719
28 Ga0070674_100005689 3300005356 Bacteria 7227
29 Ga0070674_100007465 3300005356 Bacteria 6449
30 Ga0070674_100223900 3300005356 Bacteria 1465
31 Ga0070673_100002189 3300005364 Bacteria 11805
32 Ga0070659_100011002 3300005366 Bacteria 6681
33 Ga0070667_100100111 3300005367 Unclassified 2502
34 Ga0070714_100297724 3300005435 Bacteria 1503
35 Ga0070713_100107608 3300005436 Bacteria 2426
36 Ga0070663_100034768 3300005455 Bacteria 3492
37 Ga0070663_100247029 3300005455 Bacteria 1411
38 Ga0070678_100051096 3300005456 Bacteria 2994
39 Ga0070662_100046264 3300005457 Bacteria 3126
40 Ga0068867_100008287 3300005459 Bacteria 7337
41 Ga0068867_100021994 3300005459 Bacteria 4555
42 Ga0068867_100208094 3300005459 Bacteria 1570
43 Ga0070706_100195281 3300005467 Bacteria 1891
44 Ga0068853_100002624 3300005539 Bacteria 13527
45 Ga0068853_100012525 3300005539 Bacteria 6899
46 Ga0070672_100008462 3300005543 Bacteria 7039
47 Ga0070672_100042163 3300005543 Bacteria 3513
48 Ga0070696_100065756 3300005546 Bacteria 2542
49 Ga0070665_100011905 3300005548 Bacteria 8782
50 Ga0070665_100249152 3300005548 Bacteria 1777
51 Ga0068855_100014903 3300005563 Bacteria 9365
52 Ga0068855_100039254 3300005563 Bacteria 5620
53 Ga0068855_100113935 3300005563 Bacteria 3101
54 Ga0068855_100235835 3300005563 Bacteria 2046
55 Ga0068855_100242588 3300005563 Bacteria 2013
56 Ga0068857_100000776 3300005577 Bacteria 23790
57 Ga0068857_100019584 3300005577 Bacteria 5944
58 Ga0068857_100064120 3300005577 Bacteria 3266
59 Ga0068854_100008661 3300005578 Bacteria 6549
60 Ga0068854_100056709 3300005578 Bacteria 2824
61 Ga0068856_100067463 3300005614 Bacteria 3535
62 Ga0068852_100000087 3300005616 Bacteria 64872
63 Ga0068852_100100415 3300005616 Bacteria 2610
64 Ga0068859_100166352 3300005617 Bacteria 2285
65 Ga0068859_100275133 3300005617 Bacteria 1776
66 Ga0068864_100000531 3300005618 Bacteria 32744
67 Ga0068864_100021424 3300005618 Bacteria 5416
68 Ga0068864_100033722 3300005618 Bacteria 4353
69 Ga0068866_10144227 3300005718 Bacteria 1371
70 Ga0068861_100001360 3300005719 Bacteria 15379
71 Ga0068851_10004068 3300005834 Bacteria 6567
72 Ga0068870_10017519 3300005840 Bacteria 3442
73 Ga0068863_100001999 3300005841 Bacteria 20229
74 Ga0068863_100116752 3300005841 Bacteria 2543
75 Ga0068858_100118197 3300005842 Bacteria 2478
76 Ga0068858_100516830 3300005842 Bacteria 1154
77 Ga0068860_100008563 3300005843 Bacteria 10195
78 Ga0068860_100624779 3300005843 Bacteria 1084
79 Ga0068862_100003479 3300005844 Bacteria 13533
80 Ga0068862_100095734 3300005844 Bacteria 2591
81 Ga0081455_10001534 3300005937 Bacteria 28453
82 Ga0081455_10036514 3300005937 Bacteria 4374
83 Ga0075365_10009706 3300006038 Bacteria 5555
84 Ga0075365_10021863 3300006038 Bacteria 3997
85 Ga0075365_10090906 3300006038 Bacteria 2079
86 Ga0075368_10009126 3300006042 Bacteria 3562
87 Ga0075363_100009509 3300006048 Bacteria 4570
88 Ga0075363_100011304 3300006048 Bacteria 4270
89 Ga0075363_100026009 3300006048 Bacteria 2991
90 Ga0075363_100133352 3300006048 Bacteria 1394
91 Ga0075364_10012323 3300006051 Bacteria 5226
92 Ga0075364_10064832 3300006051 Bacteria 2398
93 Ga0075362_10024449 3300006177 Bacteria 2562
94 Ga0075367_10008302 3300006178 Bacteria 5378
95 Ga0075367_10009626 3300006178 Bacteria 5059
96 Ga0075367_10038982 3300006178 Bacteria 2769
97 Ga0075369_10058825 3300006186 Bacteria 1674
98 Ga0075366_10020722 3300006195 Bacteria 3817
99 Ga0075366_10030628 3300006195 Bacteria 3164
100 Ga0075370_10098629 3300006353 Bacteria 1690
101 Ga0075370_10183906 3300006353 Bacteria 1230
102 Ga0075428_100004255 3300006844 Bacteria 15748
103 Ga0075429_100121325 3300006880 Bacteria 2285
104 Ga0097620_100166341 3300006931 Bacteria 2285
105 Ga0097620_100275141 3300006931 Bacteria 1776
106 Ga0105240_10023149 3300009093 Bacteria 8224
107 Ga0105240_10027674 3300009093 Bacteria 7420
108 Ga0105245_10328059 3300009098 Bacteria 1510
109 Ga0105247_10011566 3300009101 Bacteria 5316
110 Ga0105241_10000181 3300009174 Bacteria 47075
111 Ga0105241_10161502 3300009174 Bacteria 1842
112 Ga0105248_10004295 3300009177 Bacteria 15767
113 Ga0105237_10035614 3300009545 Bacteria 5036
114 Ga0105237_10039707 3300009545 Bacteria 4750
115 Ga0105237_10065839 3300009545 Bacteria 3618
116 Ga0105238_10000902 3300009551 Bacteria 30562
117 Ga0105238_10129805 3300009551 Bacteria 2498
118 Ga0105238_10402249 3300009551 Bacteria 1363
119 Ga0105239_10008872 3300010375 Bacteria 11379
120 Ga0157369_10005596 3300013105 Bacteria 14589
121 Ga0163162_10052277 3300013306 Bacteria 4103
122 Ga0163162_10289112 3300013306 Bacteria 1771
123 Ga0157375_10032463 3300013308 Bacteria 4953
124 Ga0163163_10001859 3300014325 Bacteria 17822
125 Ga0163163_10048434 3300014325 Bacteria 4179
126 Ga0163163_10476238 3300014325 Bacteria 1309
127 Ga0157380_10084915 3300014326 Bacteria 2597
128 Ga0157380_10296459 3300014326 Bacteria 1487
129 Ga0157380_10350732 3300014326 Bacteria 1381
130 Ga0157377_10173260 3300014745 Bacteria 1351
131 Ga0157379_10005572 3300014968 Bacteria 10822
132 Ga0157379_10096875 3300014968 Bacteria 2648
133 Ga0157379_10255608 3300014968 Bacteria 1591
134 Ga0163161_10087712 3300017792 Bacteria 2299
135 Ga0213876_10001915 3300021384 Bacteria 12500
136 Ga0213875_10000174 3300021388 Bacteria 67979
137 Ga0209676_1000060 3300025292 Bacteria 338238
138 Ga0209676_1000084 3300025292 Bacteria 274330
139 Ga0209050_1006725 3300025298 Bacteria 6717
140 Ga0209050_1020325 3300025298 Bacteria 2474
141 Ga0207656_10004439 3300025321 Bacteria 4901
142 Ga0207682_10008698 3300025893 Bacteria 4015
143 Ga0207688_10021626 3300025901 Bacteria 3517
144 Ga0207680_10073979 3300025903 Bacteria 2120
145 Ga0207680_10303495 3300025903 Bacteria 1113
146 Ga0207647_10000033 3300025904 Bacteria 100573
147 Ga0207647_10206417 3300025904 Bacteria 1136
148 Ga0207645_10070717 3300025907 Bacteria 2232
149 Ga0207643_10025170 3300025908 Bacteria 3288
150 Ga0207705_10309929 3300025909 Bacteria 1212
151 Ga0207684_10159121 3300025910 Bacteria 1944
152 Ga0207695_10000455 3300025913 Bacteria 89158
153 Ga0207671_10127299 3300025914 Bacteria 1952
154 Ga0207657_10006183 3300025919 Bacteria 12449
155 Ga0207649_10100306 3300025920 Bacteria 1915
156 Ga0207681_10052996 3300025923 Bacteria 2753
157 Ga0207681_10055668 3300025923 Bacteria 2695
158 Ga0207694_10001295 3300025924 Bacteria 21568
159 Ga0207694_10089132 3300025924 Bacteria 2433
160 Ga0207650_10019686 3300025925 Bacteria 4746
161 Ga0207650_10111911 3300025925 Bacteria 2115
162 Ga0207659_10038297 3300025926 Bacteria 3334
163 Ga0207700_10411843 3300025928 Bacteria 1186
164 Ga0207664_10226426 3300025929 Bacteria 1624
165 Ga0207706_10038771 3300025933 Bacteria 4226
166 Ga0207669_10031903 3300025937 Bacteria 2950
167 Ga0207669_10053439 3300025937 Bacteria 2433
168 Ga0207669_10189222 3300025937 Bacteria 1483
169 Ga0207704_10441935 3300025938 Bacteria 1036
170 Ga0207691_10024183 3300025940 Bacteria 5712
171 Ga0207691_10042988 3300025940 Bacteria 4165
172 Ga0207689_10000065 3300025942 Bacteria 84074
173 Ga0207667_10001361 3300025949 Bacteria 30701
174 Ga0207667_10015997 3300025949 Bacteria 8495
175 Ga0207667_10129713 3300025949 Bacteria 2597
176 Ga0207667_10139403 3300025949 Bacteria 2497
177 Ga0207667_10185622 3300025949 Bacteria 2135
178 Ga0207667_10322208 3300025949 Bacteria 1578
179 Ga0207651_10077483 3300025960 Bacteria 2380
180 Ga0207712_10070115 3300025961 Bacteria 2517
181 Ga0207668_10000125 3300025972 Bacteria 54353
182 Ga0207668_10042357 3300025972 Bacteria 3083
183 Ga0207640_10000499 3300025981 Bacteria 23728
184 Ga0207640_10051495 3300025981 Bacteria 2677
185 Ga0207640_10243110 3300025981 Bacteria 1392
186 Ga0207658_10067450 3300025986 Bacteria 2695
187 Ga0207658_10139966 3300025986 Bacteria 1957
188 Ga0207677_10135036 3300026023 Bacteria 1879
189 Ga0207703_10021438 3300026035 Bacteria 5058
190 Ga0207703_10027051 3300026035 Bacteria 4518
191 Ga0207639_10003150 3300026041 Bacteria 11090
192 Ga0207639_10137153 3300026041 Bacteria 2034
193 Ga0207639_10173379 3300026041 Bacteria 1829
194 Ga0207678_10168347 3300026067 Bacteria 1871
195 Ga0207702_10011978 3300026078 Bacteria 7212
196 Ga0207641_10000091 3300026088 Bacteria 127567
197 Ga0207641_10021154 3300026088 Bacteria 5347
198 Ga0207641_10123579 3300026088 Bacteria 2313
199 Ga0207648_10013797 3300026089 Bacteria 7495
200 Ga0207648_10013963 3300026089 Bacteria 7446
201 Ga0207648_10026395 3300026089 Bacteria 5161
202 Ga0207676_10019562 3300026095 Bacteria 4942
203 Ga0207674_10006475 3300026116 Bacteria 13764
204 Ga0207674_10010624 3300026116 Bacteria 10412
205 Ga0207674_10013191 3300026116 Bacteria 9190
206 Ga0207675_100003166 3300026118 Bacteria 16155
207 Ga0207675_100219946 3300026118 Bacteria 1830
208 Ga0207683_10108990 3300026121 Bacteria 2478
209 Ga0207683_10144006 3300026121 Bacteria 2148
210 Ga0207698_10000515 3300026142 Bacteria 22482
211 Ga0207698_10197579 3300026142 Bacteria 1798
212 Ga0268266_10093141 3300028379 Bacteria 2644
213 Ga0268266_10215390 3300028379 Bacteria 1763
214 Ga0268265_10047910 3300028380 Bacteria 3205
215 Ga0268264_10000535 3300028381 Bacteria 48055
216 Ga0307511_10000022 3300030521 Bacteria 116875
217 Ga0265320_10030410 3300031240 Bacteria 2784
218 Ga0265327_10000049 3300031251 Bacteria 268046
219 Ga0265327_10000255 3300031251 Bacteria 105762
220 Ga0265327_10000487 3300031251 Bacteria 69944
221 Ga0265327_10096825 3300031251 Bacteria 1430
222 Ga0307408_100295454 3300031548 Bacteria 1355
223 Ga0307405_10000346 3300031731 Bacteria 17348
224 Ga0307405_10009037 3300031731 Bacteria 5090
225 Ga0307413_10009335 3300031824 Bacteria 4690
226 Ga0307406_10009505 3300031901 Bacteria 5456
227 Ga0307412_10002448 3300031911 Bacteria 10328
228 Ga0307412_10030102 3300031911 Bacteria 3413
229 Ga0307412_10052936 3300031911 Bacteria 2689
230 Ga0307409_100047288 3300031995 Bacteria 3264
231 Ga0307416_100022782 3300032002 Bacteria 4530
232 Ga0307416_100242277 3300032002 Bacteria 1748
233 Ga0307414_10026982 3300032004 Bacteria 3704
234 Ga0307414_10170310 3300032004 Bacteria 1740
235 Ga0307411_10004188 3300032005 Bacteria 6858
236 Ga0307507_10076976 3300033179 Bacteria 2971
237 Ga0373933_0134991 3300035724 Bacteria 1554
238 Ga0373937_0039015 3300036401 Bacteria 4328
239 Ga0373937_0119529 3300036401 Bacteria 2455
240 Ga0436364_0676163 3300037853 Bacteria 64006
241 Ga0436364_0853338 3300037853 Bacteria 6304
242 Ga0436365_0192221 3300039437 Bacteria 16201
243 Ga0436365_1135069 3300039437 Bacteria 31467
244 Ga0451833_0463894 3300041491 Unclassified 2232
245 Ga0451839_0681474 3300041496 Bacteria 2146
246 Ga0451841_0821505 3300041498 Bacteria 2395
247 Ga0451849_0990480 3300041505 Bacteria 1925
248 Ga0451577_0170780 3300042876 Bacteria 1959
249 Ga0453683_0075113 3300044673 Bacteria 2116
250 Ga0466967_0335343 3300045976 Bacteria 1461
251 Ga0495629_0001293 3300046459 Bacteria 19676
252 Ga0495629_0070100 3300046459 Bacteria 2446
253 Ga0495629_0185871 3300046459 Bacteria 1439
254 Ga0495638_0000140 3300046460 Bacteria 114677
255 Ga0495651_0042538 3300046462 Bacteria 3527
256 Ga0495651_0225275 3300046462 Bacteria 1295
257 Ga0495650_0000659 3300046471 Bacteria 45157
258 Ga0495650_0002840 3300046471 Bacteria 13257
259 Ga0495650_0098571 3300046471 Bacteria 1100
260 Ga0495580_0005161 3300046472 Bacteria 10862
261 Ga0495585_0076590 3300046492 Bacteria 1817
262 Ga0495583_0000221 3300046506 Bacteria 96143
263 Ga0495583_0000255 3300046506 Bacteria 88289
264 Ga0495608_0043985 3300046511 Bacteria 2983
265 Ga0495608_0098566 3300046511 Bacteria 1886
266 Ga0495643_0061083 3300046522 Bacteria 1999
267 Ga0495644_0032302 3300046523 Bacteria 1978
268 Ga0495642_0000470 3300046528 Bacteria 20920
269 Ga0495652_0067412 3300046529 Bacteria 3001
270 Ga0495654_0007377 3300046530 Bacteria 6144
271 Ga0495654_0030833 3300046530 Bacteria 2725
272 Ga0495665_0012397 3300046531 Bacteria 4612
273 Ga0495586_0003937 3300046535 Bacteria 7970
274 Ga0495587_0138799 3300046536 Bacteria 1388
275 Ga0495645_0000345 3300046543 Bacteria 32906
276 Ga0495622_0162953 3300046557 Bacteria 1005
277 Ga0495667_0008559 3300046559 Bacteria 6946
278 Ga0495667_0160357 3300046559 Bacteria 1447
279 Ga0495588_0016554 3300046674 Bacteria 3565
280 Ga0495657_0008142 3300046675 Bacteria 8035
281 Ga0495657_0170651 3300046675 Bacteria 1340
282 Ga0495599_0009336 3300046678 Bacteria 5991
283 Ga0495623_0003095 3300046679 Bacteria 10969
284 Ga0495623_0003388 3300046679 Bacteria 10538
285 Ga0495646_0034263 3300046680 Bacteria 3154
286 Ga0495669_0012533 3300046684 Bacteria 3610
287 Ga0495613_0005942 3300046689 Bacteria 9134
288 Ga0495600_0065334 3300046809 Bacteria 2379
289 Ga0495674_0082452 3300047319 Bacteria 2757
290 Ga0495674_0109453 3300047319 Bacteria 2344
291 Ga0495673_0030444 3300047469 Bacteria 2534
292 Ga0495681_0017810 3300047470 Bacteria 3933
293 Ga0495684_0293352 3300047471 Bacteria 1170
294 Ga0495602_0070350 3300048088 Bacteria 2995
295 Ga0495614_0037471 3300048089 Bacteria 2080
296 Ga0496101_0381602 3300048904 Bacteria 1109
297 Ga0496102_0506205 3300048905 Bacteria 1130
298 Ga0496105_0125142 3300048908 Bacteria 2119
299 Ga0496106_0009648 3300048909 Bacteria 7127
300 Ga0496109_0131854 3300048912 Bacteria 2333
301 Ga0496111_0190024 3300048914 Bacteria 1527
302 Ga0496114_0000428 3300048917 Bacteria 31033
303 Ga0496117_0029831 3300048920 Bacteria 4198
304 Ga0496118_0000697 3300048921 Bacteria 54602
305 Ga0496118_0081393 3300048921 Bacteria 2274
306 Ga0496121_0000078 3300048924 Bacteria 233455
307 Ga0496122_0141622 3300048925 Bacteria 1503
308 Ga0496125_0066991 3300048928 Bacteria 2833
309 Ga0496126_0002001 3300048929 Bacteria 28829
310 Ga0501031_0277608 3300049568 Bacteria 1087
311 Ga0501033_0007569 3300049570 Bacteria 8450
312 Ga0501033_0038242 3300049570 Bacteria 3589
313 Ga0501034_0000196 3300049571 Bacteria 114161
314 Ga0501034_0002098 3300049571 Bacteria 24889
315 Ga0501036_0150696 3300049572 Bacteria 1962
316 Ga0501037_0052811 3300049573 Bacteria 2972
317 Ga0501037_0098921 3300049573 Bacteria 2107
318 Ga0501047_0273708 3300049581 Bacteria 1534
319 Ga0501068_0005660 3300049584 Bacteria 6843
320 Ga0501071_0056473 3300049587 Bacteria 2836
321 Ga0501072_0002432 3300049588 Bacteria 13945
322 Ga0501076_0289993 3300049592 Bacteria 1341
323 Ga0501080_0001877 3300049742 Bacteria 18075
324 Ga0501080_0215835 3300049742 Bacteria 1757
325 Ga0501083_0139407 3300049744 Bacteria 1588
326 Ga0501035_0031972 3300049822 Bacteria 4792
327 Ga0501044_0013666 3300049823 Bacteria 8774
328 nmdc:mga03683_45884_c1 3300050489 Bacteria 1810
329 nmdc:mga03n38_127249_c1 3300050490 Bacteria 1259
330 nmdc:mga03n38_48177_c1 3300050490 Bacteria 1890
331 nmdc:mga03n38_6509_c1 3300050490 Bacteria 4063
332 nmdc:mga00v17_1148_c1 3300050491 Bacteria 13912
333 nmdc:mga00v17_2742_c1 3300050491 Bacteria 9040
334 nmdc:mga00v17_51137_c1 3300050491 Bacteria 2512
335 nmdc:mga0yw44_2054_c1 3300050492 Bacteria 8401
336 nmdc:mga0k408_26470_c1 3300050493 Bacteria 3289
337 nmdc:mga0k408_98783_c1 3300050493 Bacteria 1720
338 nmdc:mga06z11_9419_c1 3300050494 Bacteria 4114
339 nmdc:mga04h51_10560_c1 3300050495 Bacteria 2539
340 nmdc:mga07m45_43905_c1 3300050496 Bacteria 2507
341 nmdc:mga05p37_310860_c1 3300050507 Bacteria 1868
342 Ga0495595_0012479 3300053084 Bacteria 3573
343 Ga0495619_0240913 3300053085 Bacteria 1253
344 Ga0500592_000817 3300053116 Bacteria 5091
345 Ga0500594_0014844 3300053118 Bacteria 1871
346 Ga0500655_009276 3300053133 Bacteria 1772
347 Ga0500564_042720 3300053138 Bacteria 2084
348 Ga0500604_0000105 3300053151 Bacteria 25800
349 Ga0500627_0000002 3300053158 Bacteria 235747
350 Ga0500627_0041414 3300053158 Bacteria 1980
351 Ga0501082_0108287 3300060353 Bacteria 2405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025924 Ga0207694_10089132 Ga0207694_100891322 234
2 3300025972 Ga0207668_10000125 Ga0207668_100001252 238
3 3300026088 Ga0207641_10000091 Ga0207641_1000009136 238
4 3300005842 Ga0068858_100118197 Ga0068858_1001181972 243
5 3300026035 Ga0207703_10027051 Ga0207703_100270511 243
6 3300005355 Ga0070671_100080744 Ga0070671_1000807442 244
7 3300014325 Ga0163163_10048434 Ga0163163_100484343 248
8 3300005617 Ga0068859_100275133 Ga0068859_1002751332 250
9 3300006931 Ga0097620_100275141 Ga0097620_1002751412 250
10 3300048089 Ga0495614_0037471 Ga0495614_0037471_31_813 254
11 3300049570 Ga0501033_0038242 Ga0501033_0038242_1292_2161 255
12 3300014326 Ga0157380_10296459 Ga0157380_102964591 258
13 3300021388 Ga0213875_10000174 Ga0213875_100001749 261
14 3300037853 Ga0436364_0676163 Ga0436364_0676163_59731_60606 261
15 3300005367 Ga0070667_100100111 Ga0070667_1001001112 264
16 3300025986 Ga0207658_10067450 Ga0207658_100674502 264
17 3300028379 Ga0268266_10215390 Ga0268266_102153902 265
18 3300049571 Ga0501034_0000196 Ga0501034_0000196_930_1790 265
19 3300049573 Ga0501037_0052811 Ga0501037_0052811_1026_1886 265
20 3300049588 Ga0501072_0002432 Ga0501072_0002432_2841_3701 265
21 3300049742 Ga0501080_0001877 Ga0501080_0001877_13832_14692 265
22 3300049744 Ga0501083_0139407 Ga0501083_0139407_669_1529 265
23 3300003781 Ga0055536_1000263 Ga0055536_100026328 267
24 3300003781 Ga0055536_1002348 Ga0055536_10023486 267
25 3300025292 Ga0209676_1000060 Ga0209676_1000060139 267
26 3300025292 Ga0209676_1000084 Ga0209676_1000084233 267
27 3300025298 Ga0209050_1006725 Ga0209050_10067254 267
28 3300025298 Ga0209050_1020325 Ga0209050_10203253 267
29 3300046530 Ga0495654_0030833 Ga0495654_0030833_810_1679 267
30 3300049568 Ga0501031_0277608 Ga0501031_0277608_91_960 267
31 3300049570 Ga0501033_0007569 Ga0501033_0007569_4231_5100 267
32 3300049571 Ga0501034_0002098 Ga0501034_0002098_21563_22432 267
33 3300049572 Ga0501036_0150696 Ga0501036_0150696_662_1531 267
34 3300049573 Ga0501037_0098921 Ga0501037_0098921_689_1558 267
35 3300049581 Ga0501047_0273708 Ga0501047_0273708_29_898 267
36 3300049823 Ga0501044_0013666 Ga0501044_0013666_126_995 267
37 3300053116 Ga0500592_000817 Ga0500592_000817_4048_4917 267
38 3300053158 Ga0500627_0000002 Ga0500627_0000002_169439_170308 267
39 3300053158 Ga0500627_0041414 Ga0500627_0041414_993_1856 267
40 3300005331 Ga0070670_100376609 Ga0070670_1003766091 268
41 3300009093 Ga0105240_10027674 Ga0105240_100276744 272
42 3300009174 Ga0105241_10000181 Ga0105241_1000018126 272
43 3300009545 Ga0105237_10035614 Ga0105237_100356144 272
44 3300009551 Ga0105238_10000902 Ga0105238_1000090210 272
45 3300010375 Ga0105239_10008872 Ga0105239_1000887210 272
46 3300013105 Ga0157369_10005596 Ga0157369_100055967 272
47 3300006844 Ga0075428_100004255 Ga0075428_1000042559 273
48 3300006880 Ga0075429_100121325 Ga0075429_1001213251 273
49 3300044673 Ga0453683_0075113 Ga0453683_0075113_708_1556 273
50 3300047319 Ga0495674_0082452 Ga0495674_0082452_441_1268 273
51 3300047469 Ga0495673_0030444 Ga0495673_0030444_789_1631 273
52 3300046506 Ga0495583_0000255 Ga0495583_0000255_50103_51002 274
53 3300005331 Ga0070670_100000707 Ga0070670_10000070720 275
54 3300005334 Ga0068869_100000115 Ga0068869_10000011530 275
55 3300005335 Ga0070666_10022037 Ga0070666_100220374 275
56 3300005347 Ga0070668_100044795 Ga0070668_1000447953 275
57 3300005364 Ga0070673_100002189 Ga0070673_10000218911 275
58 3300005459 Ga0068867_100008287 Ga0068867_1000082873 275
59 3300005577 Ga0068857_100000776 Ga0068857_10000077619 275
60 3300005618 Ga0068864_100000531 Ga0068864_1000005319 275
61 3300005719 Ga0068861_100001360 Ga0068861_1000013604 275
62 3300005844 Ga0068862_100003479 Ga0068862_1000034792 275
63 3300009098 Ga0105245_10328059 Ga0105245_103280592 275
64 3300009174 Ga0105241_10161502 Ga0105241_101615022 275
65 3300009545 Ga0105237_10065839 Ga0105237_100658393 275
66 3300014326 Ga0157380_10350732 Ga0157380_103507321 275
67 3300014968 Ga0157379_10096875 Ga0157379_100968752 275
68 3300025942 Ga0207689_10000065 Ga0207689_1000006549 275
69 3300026118 Ga0207675_100003166 Ga0207675_1000031665 275
70 3300028381 Ga0268264_10000535 Ga0268264_1000053517 275
71 3300042876 Ga0451577_0170780 Ga0451577_0170780_715_1626 275
72 3300046459 Ga0495629_0185871 Ga0495629_0185871_39_881 275
73 3300046471 Ga0495650_0002840 Ga0495650_0002840_1616_2458 275
74 3300046471 Ga0495650_0098571 Ga0495650_0098571_158_1000 275
75 3300046522 Ga0495643_0061083 Ga0495643_0061083_35_946 275
76 3300046559 Ga0495667_0160357 Ga0495667_0160357_447_1358 275
77 3300048904 Ga0496101_0381602 Ga0496101_0381602_194_1039 275
78 3300048905 Ga0496102_0506205 Ga0496102_0506205_57_968 275
79 3300048914 Ga0496111_0190024 Ga0496111_0190024_470_1327 275
80 3300049592 Ga0501076_0289993 Ga0501076_0289993_362_1273 275
81 3300049742 Ga0501080_0215835 Ga0501080_0215835_369_1214 275
82 3300050489 nmdc:mga03683_45884_c1 nmdc:mga03683_45884_c1_563_1474 275
83 3300050490 nmdc:mga03n38_48177_c1 nmdc:mga03n38_48177_c1_266_1177 275
84 3300050490 nmdc:mga03n38_6509_c1 nmdc:mga03n38_6509_c1_2635_3546 275
85 3300050491 nmdc:mga00v17_2742_c1 nmdc:mga00v17_2742_c1_995_1906 275
86 3300050493 nmdc:mga0k408_26470_c1 nmdc:mga0k408_26470_c1_74_985 275
87 3300050493 nmdc:mga0k408_98783_c1 nmdc:mga0k408_98783_c1_790_1701 275
88 3300050495 nmdc:mga04h51_10560_c1 nmdc:mga04h51_10560_c1_1264_2175 275
89 3300050496 nmdc:mga07m45_43905_c1 nmdc:mga07m45_43905_c1_357_1268 275
90 3300060353 Ga0501082_0108287 Ga0501082_0108287_1338_2183 275
91 iso_pu_bacteria 2511231008 2511275701 275
92 iso_pu_bacteria 3007619802 3007625581 275
93 3300005563 Ga0068855_100039254 Ga0068855_1000392543 276
94 3300006048 Ga0075363_100133352 Ga0075363_1001333522 276
95 3300006051 Ga0075364_10012323 Ga0075364_100123234 276
96 3300025949 Ga0207667_10139403 Ga0207667_101394032 276
97 3300049584 Ga0501068_0005660 Ga0501068_0005660_439_1296 276
98 3300053138 Ga0500564_042720 Ga0500564_042720_292_1128 276
99 3300003323 rootH1_10118232 rootH1_101182321 277
100 3300005328 Ga0070676_10020232 Ga0070676_100202322 277
101 3300005328 Ga0070676_10205343 Ga0070676_102053431 277
102 3300005331 Ga0070670_100009075 Ga0070670_1000090755 277
103 3300005333 Ga0070677_10002187 Ga0070677_100021873 277
104 3300005338 Ga0068868_100204745 Ga0068868_1002047452 277
105 3300005339 Ga0070660_100207461 Ga0070660_1002074612 277
106 3300005353 Ga0070669_100025822 Ga0070669_1000258223 277
107 3300005353 Ga0070669_100085283 Ga0070669_1000852832 277
108 3300005354 Ga0070675_100024848 Ga0070675_1000248482 277
109 3300005356 Ga0070674_100005689 Ga0070674_1000056893 277
110 3300005356 Ga0070674_100007465 Ga0070674_1000074654 277
111 3300005356 Ga0070674_100223900 Ga0070674_1002239002 277
112 3300005435 Ga0070714_100297724 Ga0070714_1002977242 277
113 3300005436 Ga0070713_100107608 Ga0070713_1001076082 277
114 3300005455 Ga0070663_100247029 Ga0070663_1002470291 277
115 3300005456 Ga0070678_100051096 Ga0070678_1000510962 277
116 3300005459 Ga0068867_100021994 Ga0068867_1000219944 277
117 3300005459 Ga0068867_100208094 Ga0068867_1002080942 277
118 3300005543 Ga0070672_100008462 Ga0070672_1000084625 277
119 3300005543 Ga0070672_100042163 Ga0070672_1000421633 277
120 3300005546 Ga0070696_100065756 Ga0070696_1000657562 277
121 3300005548 Ga0070665_100011905 Ga0070665_1000119059 277
122 3300005548 Ga0070665_100249152 Ga0070665_1002491522 277
123 3300005563 Ga0068855_100113935 Ga0068855_1001139352 277
124 3300005617 Ga0068859_100166352 Ga0068859_1001663522 277
125 3300005618 Ga0068864_100021424 Ga0068864_1000214244 277
126 3300005618 Ga0068864_100033722 Ga0068864_1000337222 277
127 3300005718 Ga0068866_10144227 Ga0068866_101442271 277
128 3300005840 Ga0068870_10017519 Ga0068870_100175193 277
129 3300005841 Ga0068863_100001999 Ga0068863_10000199912 277
130 3300005841 Ga0068863_100116752 Ga0068863_1001167522 277
131 3300005842 Ga0068858_100516830 Ga0068858_1005168302 277
132 3300005843 Ga0068860_100008563 Ga0068860_1000085632 277
133 3300005844 Ga0068862_100095734 Ga0068862_1000957343 277
134 3300006038 Ga0075365_10090906 Ga0075365_100909062 277
135 3300006042 Ga0075368_10009126 Ga0075368_100091263 277
136 3300006048 Ga0075363_100011304 Ga0075363_1000113041 277
137 3300006048 Ga0075363_100026009 Ga0075363_1000260094 277
138 3300006051 Ga0075364_10064832 Ga0075364_100648322 277
139 3300006177 Ga0075362_10024449 Ga0075362_100244492 277
140 3300006178 Ga0075367_10009626 Ga0075367_100096266 277
141 3300006178 Ga0075367_10038982 Ga0075367_100389822 277
142 3300006186 Ga0075369_10058825 Ga0075369_100588252 277
143 3300006195 Ga0075366_10020722 Ga0075366_100207222 277
144 3300006195 Ga0075366_10030628 Ga0075366_100306283 277
145 3300006353 Ga0075370_10183906 Ga0075370_101839062 277
146 3300006931 Ga0097620_100166341 Ga0097620_1001663413 277
147 3300009093 Ga0105240_10023149 Ga0105240_100231493 277
148 3300009101 Ga0105247_10011566 Ga0105247_100115666 277
149 3300009177 Ga0105248_10004295 Ga0105248_100042956 277
150 3300009545 Ga0105237_10039707 Ga0105237_100397074 277
151 3300013306 Ga0163162_10052277 Ga0163162_100522773 277
152 3300013306 Ga0163162_10289112 Ga0163162_102891121 277
153 3300013308 Ga0157375_10032463 Ga0157375_100324635 277
154 3300014325 Ga0163163_10001859 Ga0163163_100018592 277
155 3300014325 Ga0163163_10476238 Ga0163163_104762382 277
156 3300014326 Ga0157380_10084915 Ga0157380_100849152 277
157 3300014745 Ga0157377_10173260 Ga0157377_101732601 277
158 3300014968 Ga0157379_10005572 Ga0157379_1000557211 277
159 3300017792 Ga0163161_10087712 Ga0163161_100877122 277
160 3300025893 Ga0207682_10008698 Ga0207682_100086983 277
161 3300025901 Ga0207688_10021626 Ga0207688_100216263 277
162 3300025903 Ga0207680_10073979 Ga0207680_100739792 277
163 3300025907 Ga0207645_10070717 Ga0207645_100707172 277
164 3300025908 Ga0207643_10025170 Ga0207643_100251703 277
165 3300025909 Ga0207705_10309929 Ga0207705_103099291 277
166 3300025923 Ga0207681_10052996 Ga0207681_100529962 277
167 3300025923 Ga0207681_10055668 Ga0207681_100556683 277
168 3300025925 Ga0207650_10019686 Ga0207650_100196864 277
169 3300025925 Ga0207650_10111911 Ga0207650_101119112 277
170 3300025926 Ga0207659_10038297 Ga0207659_100382973 277
171 3300025928 Ga0207700_10411843 Ga0207700_104118431 277
172 3300025929 Ga0207664_10226426 Ga0207664_102264261 277
173 3300025937 Ga0207669_10031903 Ga0207669_100319033 277
174 3300025937 Ga0207669_10053439 Ga0207669_100534391 277
175 3300025937 Ga0207669_10189222 Ga0207669_101892222 277
176 3300025938 Ga0207704_10441935 Ga0207704_104419351 277
177 3300025940 Ga0207691_10024183 Ga0207691_100241834 277
178 3300025940 Ga0207691_10042988 Ga0207691_100429883 277
179 3300025949 Ga0207667_10322208 Ga0207667_103222081 277
180 3300025960 Ga0207651_10077483 Ga0207651_100774832 277
181 3300025961 Ga0207712_10070115 Ga0207712_100701152 277
182 3300025972 Ga0207668_10042357 Ga0207668_100423574 277
183 3300025981 Ga0207640_10243110 Ga0207640_102431101 277
184 3300025986 Ga0207658_10139966 Ga0207658_101399661 277
185 3300026023 Ga0207677_10135036 Ga0207677_101350363 277
186 3300026035 Ga0207703_10021438 Ga0207703_100214385 277
187 3300026041 Ga0207639_10173379 Ga0207639_101733791 277
188 3300026088 Ga0207641_10021154 Ga0207641_100211545 277
189 3300026088 Ga0207641_10123579 Ga0207641_101235791 277
190 3300026089 Ga0207648_10013797 Ga0207648_100137973 277
191 3300026089 Ga0207648_10013963 Ga0207648_100139633 277
192 3300026089 Ga0207648_10026395 Ga0207648_100263953 277
193 3300026095 Ga0207676_10019562 Ga0207676_100195623 277
194 3300026116 Ga0207674_10010624 Ga0207674_100106246 277
195 3300026118 Ga0207675_100219946 Ga0207675_1002199462 277
196 3300026121 Ga0207683_10108990 Ga0207683_101089901 277
197 3300026121 Ga0207683_10144006 Ga0207683_101440063 277
198 3300026142 Ga0207698_10197579 Ga0207698_101975792 277
199 3300028379 Ga0268266_10093141 Ga0268266_100931412 277
200 3300028380 Ga0268265_10047910 Ga0268265_100479104 277
201 3300030521 Ga0307511_10000022 Ga0307511_1000002262 277
202 3300031251 Ga0265327_10000049 Ga0265327_1000004976 277
203 3300031251 Ga0265327_10000487 Ga0265327_1000048756 277
204 3300031251 Ga0265327_10096825 Ga0265327_100968252 277
205 3300031731 Ga0307405_10009037 Ga0307405_100090374 277
206 3300031824 Ga0307413_10009335 Ga0307413_100093353 277
207 3300031901 Ga0307406_10009505 Ga0307406_100095052 277
208 3300031911 Ga0307412_10052936 Ga0307412_100529363 277
209 3300031995 Ga0307409_100047288 Ga0307409_1000472883 277
210 3300032002 Ga0307416_100022782 Ga0307416_1000227822 277
211 3300032004 Ga0307414_10026982 Ga0307414_100269822 277
212 3300032004 Ga0307414_10170310 Ga0307414_101703102 277
213 3300032005 Ga0307411_10004188 Ga0307411_100041884 277
214 3300036401 Ga0373937_0039015 Ga0373937_0039015_965_1924 277
215 3300046460 Ga0495638_0000140 Ga0495638_0000140_37855_38700 277
216 3300048909 Ga0496106_0009648 Ga0496106_0009648_3898_4863 277
217 3300048912 Ga0496109_0131854 Ga0496109_0131854_15_980 277
218 3300048920 Ga0496117_0029831 Ga0496117_0029831_2401_3273 277
219 3300048921 Ga0496118_0000697 Ga0496118_0000697_48425_49297 277
220 3300050491 nmdc:mga00v17_51137_c1 nmdc:mga00v17_51137_c1_266_1246 277
221 3300050494 nmdc:mga06z11_9419_c1 nmdc:mga06z11_9419_c1_832_1812 277
222 3300053118 Ga0500594_0014844 Ga0500594_0014844_397_1374 277
223 3300053133 Ga0500655_009276 Ga0500655_009276_442_1392 277
224 3300053151 Ga0500604_0000105 Ga0500604_0000105_19302_20252 277
225 iso_pu_bacteria 2515154189 2516020593 277
226 iso_pu_bacteria 2547132424 2548695878 277
227 3300005335 Ga0070666_10152420 Ga0070666_101524202 278
228 3300005539 Ga0068853_100012525 Ga0068853_1000125255 278
229 3300005577 Ga0068857_100019584 Ga0068857_1000195842 278
230 3300005616 Ga0068852_100100415 Ga0068852_1001004153 278
231 3300005843 Ga0068860_100624779 Ga0068860_1006247792 278
232 3300006038 Ga0075365_10009706 Ga0075365_100097062 278
233 3300006038 Ga0075365_10021863 Ga0075365_100218631 278
234 3300006048 Ga0075363_100009509 Ga0075363_1000095092 278
235 3300006178 Ga0075367_10008302 Ga0075367_100083023 278
236 3300006353 Ga0075370_10098629 Ga0075370_100986292 278
237 3300014968 Ga0157379_10255608 Ga0157379_102556082 278
238 3300021384 Ga0213876_10001915 Ga0213876_1000191511 278
239 3300025903 Ga0207680_10303495 Ga0207680_103034951 278
240 3300026041 Ga0207639_10137153 Ga0207639_101371532 278
241 3300026116 Ga0207674_10006475 Ga0207674_100064753 278
242 3300031251 Ga0265327_10000255 Ga0265327_100002553 278
243 3300033179 Ga0307507_10076976 Ga0307507_100769762 278
244 3300035724 Ga0373933_0134991 Ga0373933_0134991_410_1312 278
245 3300036401 Ga0373937_0119529 Ga0373937_0119529_767_1669 278
246 3300039437 Ga0436365_0192221 Ga0436365_0192221_5883_6737 278
247 3300039437 Ga0436365_1135069 Ga0436365_1135069_22459_23358 278
248 3300045976 Ga0466967_0335343 Ga0466967_0335343_480_1370 278
249 3300046459 Ga0495629_0070100 Ga0495629_0070100_762_1637 278
250 3300046462 Ga0495651_0042538 Ga0495651_0042538_1174_2076 278
251 3300046511 Ga0495608_0043985 Ga0495608_0043985_1568_2470 278
252 3300046675 Ga0495657_0008142 Ga0495657_0008142_7016_7918 278
253 3300046679 Ga0495623_0003388 Ga0495623_0003388_671_1573 278
254 3300046809 Ga0495600_0065334 Ga0495600_0065334_1380_2282 278
255 3300047471 Ga0495684_0293352 Ga0495684_0293352_40_942 278
256 3300048088 Ga0495602_0070350 Ga0495602_0070350_1284_2186 278
257 3300048921 Ga0496118_0081393 Ga0496118_0081393_63_917 278
258 3300048924 Ga0496121_0000078 Ga0496121_0000078_164614_165468 278
259 3300048929 Ga0496126_0002001 Ga0496126_0002001_24089_24943 278
260 3300050490 nmdc:mga03n38_127249_c1 nmdc:mga03n38_127249_c1_233_1132 278
261 3300050491 nmdc:mga00v17_1148_c1 nmdc:mga00v17_1148_c1_10173_11072 278
262 3300050492 nmdc:mga0yw44_2054_c1 nmdc:mga0yw44_2054_c1_4221_5120 278
263 3300053084 Ga0495595_0012479 Ga0495595_0012479_1531_2433 278
264 3300053085 Ga0495619_0240913 Ga0495619_0240913_328_1230 278
265 3300005563 Ga0068855_100235835 Ga0068855_1002358352 279
266 3300005937 Ga0081455_10001534 Ga0081455_1000153417 279
267 3300005937 Ga0081455_10036514 Ga0081455_100365144 279
268 3300009551 Ga0105238_10402249 Ga0105238_104022491 279
269 3300025949 Ga0207667_10129713 Ga0207667_101297133 279
270 3300031240 Ga0265320_10030410 Ga0265320_100304102 279
271 3300037853 Ga0436364_0853338 Ga0436364_0853338_2753_3673 279
272 3300047319 Ga0495674_0109453 Ga0495674_0109453_1065_1934 279
273 3300048925 Ga0496122_0141622 Ga0496122_0141622_580_1449 279
274 3300048928 Ga0496125_0066991 Ga0496125_0066991_595_1464 279
275 3300049587 Ga0501071_0056473 Ga0501071_0056473_146_1021 279
276 3300001904 JGI24736J21556_1001959 JGI24736J21556_10019593 280
277 3300001979 JGI24740J21852_10001961 JGI24740J21852_100019616 280
278 3300001979 JGI24740J21852_10004632 JGI24740J21852_100046322 280
279 3300001989 JGI24739J22299_10001798 JGI24739J22299_1000179810 280
280 3300001990 JGI24737J22298_10002980 JGI24737J22298_100029806 280
281 3300002067 JGI24735J21928_10001854 JGI24735J21928_100018549 280
282 3300005339 Ga0070660_100003394 Ga0070660_1000033944 280
283 3300005344 Ga0070661_100008581 Ga0070661_1000085817 280
284 3300005366 Ga0070659_100011002 Ga0070659_1000110021 280
285 3300005455 Ga0070663_100034768 Ga0070663_1000347684 280
286 3300005457 Ga0070662_100046264 Ga0070662_1000462641 280
287 3300005467 Ga0070706_100195281 Ga0070706_1001952813 280
288 3300005539 Ga0068853_100002624 Ga0068853_10000262410 280
289 3300005563 Ga0068855_100014903 Ga0068855_1000149035 280
290 3300005563 Ga0068855_100242588 Ga0068855_1002425882 280
291 3300005577 Ga0068857_100064120 Ga0068857_1000641201 280
292 3300005578 Ga0068854_100008661 Ga0068854_1000086616 280
293 3300005578 Ga0068854_100056709 Ga0068854_1000567093 280
294 3300005614 Ga0068856_100067463 Ga0068856_1000674633 280
295 3300005616 Ga0068852_100000087 Ga0068852_10000008725 280
296 3300005834 Ga0068851_10004068 Ga0068851_100040689 280
297 3300009551 Ga0105238_10129805 Ga0105238_101298052 280
298 3300025321 Ga0207656_10004439 Ga0207656_100044394 280
299 3300025904 Ga0207647_10000033 Ga0207647_1000003372 280
300 3300025904 Ga0207647_10206417 Ga0207647_102064171 280
301 3300025910 Ga0207684_10159121 Ga0207684_101591212 280
302 3300025913 Ga0207695_10000455 Ga0207695_1000045559 280
303 3300025914 Ga0207671_10127299 Ga0207671_101272993 280
304 3300025919 Ga0207657_10006183 Ga0207657_100061831 280
305 3300025920 Ga0207649_10100306 Ga0207649_101003062 280
306 3300025924 Ga0207694_10001295 Ga0207694_100012954 280
307 3300025933 Ga0207706_10038771 Ga0207706_100387711 280
308 3300025949 Ga0207667_10001361 Ga0207667_1000136125 280
309 3300025949 Ga0207667_10015997 Ga0207667_100159975 280
310 3300025949 Ga0207667_10185622 Ga0207667_101856221 280
311 3300025981 Ga0207640_10000499 Ga0207640_1000049918 280
312 3300025981 Ga0207640_10051495 Ga0207640_100514953 280
313 3300026041 Ga0207639_10003150 Ga0207639_100031506 280
314 3300026067 Ga0207678_10168347 Ga0207678_101683472 280
315 3300026078 Ga0207702_10011978 Ga0207702_100119787 280
316 3300026116 Ga0207674_10013191 Ga0207674_100131915 280
317 3300026142 Ga0207698_10000515 Ga0207698_1000051523 280
318 3300031548 Ga0307408_100295454 Ga0307408_1002954541 280
319 3300031731 Ga0307405_10000346 Ga0307405_100003462 280
320 3300031911 Ga0307412_10002448 Ga0307412_100024489 280
321 3300031911 Ga0307412_10030102 Ga0307412_100301024 280
322 3300032002 Ga0307416_100242277 Ga0307416_1002422773 280
323 3300041491 Ga0451833_0463894 Ga0451833_0463894_479_1351 280
324 3300041496 Ga0451839_0681474 Ga0451839_0681474_557_1429 280
325 3300041498 Ga0451841_0821505 Ga0451841_0821505_1288_2160 280
326 3300041505 Ga0451849_0990480 Ga0451849_0990480_405_1277 280
327 3300046459 Ga0495629_0001293 Ga0495629_0001293_7859_8749 280
328 3300046462 Ga0495651_0225275 Ga0495651_0225275_42_932 280
329 3300046471 Ga0495650_0000659 Ga0495650_0000659_7860_8750 280
330 3300046472 Ga0495580_0005161 Ga0495580_0005161_4120_5010 280
331 3300046492 Ga0495585_0076590 Ga0495585_0076590_507_1406 280
332 3300046506 Ga0495583_0000221 Ga0495583_0000221_83466_84404 280
333 3300046511 Ga0495608_0098566 Ga0495608_0098566_378_1268 280
334 3300046523 Ga0495644_0032302 Ga0495644_0032302_702_1592 280
335 3300046528 Ga0495642_0000470 Ga0495642_0000470_10177_11067 280
336 3300046529 Ga0495652_0067412 Ga0495652_0067412_1392_2282 280
337 3300046530 Ga0495654_0007377 Ga0495654_0007377_800_1690 280
338 3300046531 Ga0495665_0012397 Ga0495665_0012397_649_1539 280
339 3300046535 Ga0495586_0003937 Ga0495586_0003937_2202_3092 280
340 3300046536 Ga0495587_0138799 Ga0495587_0138799_162_1058 280
341 3300046543 Ga0495645_0000345 Ga0495645_0000345_31360_32250 280
342 3300046557 Ga0495622_0162953 Ga0495622_0162953_82_960 280
343 3300046559 Ga0495667_0008559 Ga0495667_0008559_2835_3725 280
344 3300046674 Ga0495588_0016554 Ga0495588_0016554_214_1104 280
345 3300046675 Ga0495657_0170651 Ga0495657_0170651_71_961 280
346 3300046678 Ga0495599_0009336 Ga0495599_0009336_2024_2917 280
347 3300046679 Ga0495623_0003095 Ga0495623_0003095_5167_6060 280
348 3300046680 Ga0495646_0034263 Ga0495646_0034263_2005_2895 280
349 3300046684 Ga0495669_0012533 Ga0495669_0012533_754_1644 280
350 3300046689 Ga0495613_0005942 Ga0495613_0005942_5093_5983 280
351 3300047470 Ga0495681_0017810 Ga0495681_0017810_315_1205 280
352 3300048908 Ga0496105_0125142 Ga0496105_0125142_905_1795 280
353 3300048917 Ga0496114_0000428 Ga0496114_0000428_24388_25278 280
354 3300049822 Ga0501035_0031972 Ga0501035_0031972_3439_4302 280
355 3300050507 nmdc:mga05p37_310860_c1 nmdc:mga05p37_310860_c1_91_963 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

49

290

0.85

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

53

289

0.71

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

54

294

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u2m-assembly2.cif.gz_C crystal structure of a halotag-based calcium indicator, halocamp v2, bound to jf635 0.8833 2 105
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8781 2 105
3kxp-assembly1.cif.gz_A crystal structure of e-2-(acetamidomethylene)succinate hydrolase 0.872 2 273
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8665 2 105
3kxp-assembly1.cif.gz_A crystal structure of e-2-(acetamidomethylene)succinate hydrolase 0.8569 2 273
ID Description Score Start End Superfamily
af_O06338_1_258_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9356 28 275 3.40.50.1820
af_O06575_15_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9344 2 273 3.40.50.1820
af_O06575_15_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9054 2 273 3.40.50.1820
af_O06338_1_258_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8971 28 275 3.40.50.1820
af_F4JRA6_1_133_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8855 25 105 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A257GAT7-F1-model_v4 Alpha/beta hydrolase 0.9874 1 276 GO:0016787
AF-A0A257GAT7-F1-model_v4 Alpha/beta hydrolase 0.9803 1 276 GO:0016787
AF-A0A2E4H5J3-F1-model_v4 Alpha/beta hydrolase 0.9795 2 125 GO:0016787
AF-A0A2S9FH41-F1-model_v4 Alpha/beta hydrolase 0.9664 8 233 GO:0016787
AF-A0A329P6A9-F1-model_v4 deleted 0.9654 2 87

Feature Viewer

pLDDT pTM Quality
92.58 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map