F419932

General Info

Members Datasets Scaffolds Average Seq Length
354 191 708 152

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_755855_c1|nmdc:mga08y16_755855_c1_55_570
Length 171
Sequence LNIVPRLRQNRRAADALAGNFMRLLLSLTFMLLPVLVFAQVKRSNPPTLAKPTGYTHVVEVPGPAKMVFIAGQIALDKDGKVVGEGDMKAQAEQVFKNLEAALAAAGAKFTDVVKMNTYVTDMDKAPAVREVRAKYFAETTPASTLVQVVKLARPEFMLEIEVIAAVSPGR

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
122 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
123 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
124 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
125 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
128 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
129 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 3.95
Rhizosphere 95.76
Stem 0
Stem Tuber 0
Unclassified 24.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_755855_c1 3300050511 Bacteria 968
2 Ga0065715_10453514 3300005293 Bacteria 823
3 Ga0065715_10681039 3300005293 Bacteria 663
4 Ga0065715_10694466 3300005293 Unclassified 656
5 Ga0070676_10070192 3300005328 Bacteria 2101
6 Ga0070676_10116575 3300005328 Unclassified 1670
7 Ga0070690_100011550 3300005330 Bacteria 5168
8 Ga0070690_100649383 3300005330 Bacteria 806
9 Ga0070670_100777547 3300005331 Bacteria 864
10 Ga0070666_10040282 3300005335 Unclassified 3118
11 Ga0068868_100145434 3300005338 Bacteria 1949
12 Ga0070689_100726929 3300005340 Bacteria 869
13 Ga0070691_10001561 3300005341 Bacteria 9879
14 Ga0070687_100008882 3300005343 Bacteria 4275
15 Ga0070687_100326315 3300005343 Bacteria 983
16 Ga0070692_10156521 3300005345 Unclassified 1302
17 Ga0070668_100019554 3300005347 Bacteria 5097
18 Ga0070668_100092573 3300005347 Bacteria 2384
19 Ga0070669_100042003 3300005353 Bacteria 3327
20 Ga0070669_100139703 3300005353 Bacteria 1866
21 Ga0070669_100290766 3300005353 Bacteria 1312
22 Ga0070675_100000280 3300005354 Bacteria 33822
23 Ga0070675_100296996 3300005354 Unclassified 1422
24 Ga0070674_100007624 3300005356 Bacteria 6392
25 Ga0070674_102078517 3300005356 Bacteria 518
26 Ga0070673_100533005 3300005364 Bacteria 1065
27 Ga0070673_101110701 3300005364 Bacteria 739
28 Ga0070673_101289425 3300005364 Unclassified 686
29 Ga0070673_101414834 3300005364 Unclassified 655
30 Ga0070688_100038840 3300005365 Bacteria 2910
31 Ga0070659_100761105 3300005366 Bacteria 840
32 Ga0070701_10058945 3300005438 Bacteria 2017
33 Ga0070701_10797842 3300005438 Bacteria 644
34 Ga0070705_100156086 3300005440 Bacteria 1520
35 Ga0070705_101415866 3300005440 Bacteria 580
36 Ga0070700_100147679 3300005441 Bacteria 1604
37 Ga0070700_100236291 3300005441 Bacteria 1303
38 Ga0070700_100630971 3300005441 Unclassified 844
39 Ga0070694_100381714 3300005444 Unclassified 1099
40 Ga0070694_100428100 3300005444 Bacteria 1041
41 Ga0070694_101189091 3300005444 Bacteria 639
42 Ga0070694_101871702 3300005444 Bacteria 512
43 Ga0070708_100882313 3300005445 Unclassified 840
44 Ga0070708_101093046 3300005445 Bacteria 747
45 Ga0070662_100414086 3300005457 Bacteria 1114
46 Ga0070681_10210578 3300005458 Bacteria 1860
47 Ga0068867_100130471 3300005459 Bacteria 1952
48 Ga0068867_100326642 3300005459 Bacteria 1273
49 Ga0068867_100404621 3300005459 Bacteria 1152
50 Ga0070706_100399782 3300005467 Bacteria 1279
51 Ga0070706_101158798 3300005467 Unclassified 711
52 Ga0070707_100156675 3300005468 Bacteria 2219
53 Ga0070707_100330985 3300005468 Unclassified 1480
54 Ga0070707_101834314 3300005468 Bacteria 574
55 Ga0070698_100327039 3300005471 Unclassified 1464
56 Ga0070698_101136733 3300005471 Bacteria 730
57 Ga0070699_100258528 3300005518 Bacteria 1557
58 Ga0070699_100956546 3300005518 Bacteria 785
59 Ga0070699_101600079 3300005518 Bacteria 597
60 Ga0070684_100961956 3300005535 Unclassified 801
61 Ga0070697_100209121 3300005536 Unclassified 1661
62 Ga0068853_100484020 3300005539 Unclassified 1167
63 Ga0070686_100001936 3300005544 Bacteria 11511
64 Ga0070686_100067249 3300005544 Bacteria 2334
65 Ga0070695_100443954 3300005545 Bacteria 993
66 Ga0070695_101162270 3300005545 Bacteria 634
67 Ga0070696_100145834 3300005546 Bacteria 1734
68 Ga0070696_100299154 3300005546 Bacteria 1232
69 Ga0070696_100350070 3300005546 Bacteria 1144
70 Ga0070696_100502674 3300005546 Bacteria 965
71 Ga0070696_101005368 3300005546 Bacteria 697
72 Ga0070665_100011124 3300005548 Bacteria 9094
73 Ga0070665_100178185 3300005548 Bacteria 2126
74 Ga0070704_100004437 3300005549 Bacteria 8100
75 Ga0068855_100506605 3300005563 Bacteria 1311
76 Ga0068857_101802210 3300005577 Unclassified 599
77 Ga0068854_100023288 3300005578 Bacteria 4229
78 Ga0068854_100189494 3300005578 Bacteria 1611
79 Ga0068854_100585419 3300005578 Bacteria 951
80 Ga0070702_100008655 3300005615 Bacteria 4941
81 Ga0068859_100313416 3300005617 Bacteria 1663
82 Ga0068864_100320672 3300005618 Bacteria 1455
83 Ga0068866_10474344 3300005718 Bacteria 823
84 Ga0068861_100003827 3300005719 Bacteria 10043
85 Ga0068861_100055882 3300005719 Bacteria 3011
86 Ga0068861_100103116 3300005719 Bacteria 2273
87 Ga0068861_100551271 3300005719 Unclassified 1051
88 Ga0068861_101507870 3300005719 Bacteria 660
89 Ga0068851_10189010 3300005834 Bacteria 1144
90 Ga0068863_100004083 3300005841 Bacteria 14422
91 Ga0068863_100108809 3300005841 Bacteria 2638
92 Ga0068858_100274026 3300005842 Bacteria 1606
93 Ga0068858_101448610 3300005842 Bacteria 677
94 Ga0068860_102511779 3300005843 Bacteria 535
95 Ga0068862_100037466 3300005844 Unclassified 4111
96 Ga0068862_100437441 3300005844 Unclassified 1230
97 Ga0068862_100506597 3300005844 Unclassified 1146
98 Ga0081455_10351154 3300005937 Bacteria 1040
99 Ga0081539_10005962 3300005985 Bacteria 12013
100 Ga0075363_100730424 3300006048 Bacteria 599
101 Ga0097621_100092957 3300006237 Bacteria 2527
102 Ga0097621_101518091 3300006237 Bacteria 636
103 Ga0068871_100209237 3300006358 Bacteria 1687
104 Ga0075428_100097992 3300006844 Bacteria 3196
105 Ga0075428_100779690 3300006844 Bacteria 1016
106 Ga0075428_102552015 3300006844 Bacteria 523
107 Ga0075431_100651577 3300006847 Bacteria 1033
108 Ga0075433_10060724 3300006852 Unclassified 3311
109 Ga0075433_10322567 3300006852 Unclassified 1366
110 Ga0075434_100002826 3300006871 Bacteria 15377
111 Ga0075434_100035312 3300006871 Bacteria 4942
112 Ga0075434_100117938 3300006871 Bacteria 2667
113 Ga0075434_100132231 3300006871 Bacteria 2515
114 Ga0075434_100154841 3300006871 Unclassified 2312
115 Ga0075429_100270350 3300006880 Unclassified 1489
116 Ga0075429_100331910 3300006880 Bacteria 1331
117 Ga0068865_100201276 3300006881 Bacteria 1546
118 Ga0075436_100005544 3300006914 Bacteria 8673
119 Ga0075436_100050589 3300006914 Bacteria 2868
120 Ga0075436_100094240 3300006914 Bacteria 2082
121 Ga0075436_100123472 3300006914 Unclassified 1813
122 Ga0075436_100494843 3300006914 Bacteria 894
123 Ga0075436_101066445 3300006914 Unclassified 608
124 Ga0097620_100313412 3300006931 Bacteria 1663
125 Ga0075435_100000067 3300007076 Bacteria 53705
126 Ga0075435_100001902 3300007076 Bacteria 13589
127 Ga0075435_100004052 3300007076 Bacteria 10019
128 Ga0075435_100019488 3300007076 Bacteria 5184
129 Ga0075435_100029272 3300007076 Bacteria 4322
130 Ga0075435_100145732 3300007076 Bacteria 1989
131 Ga0075435_101320119 3300007076 Bacteria 632
132 Ga0105240_10348191 3300009093 Unclassified 1681
133 Ga0105240_10489045 3300009093 Bacteria 1370
134 Ga0111539_10526914 3300009094 Bacteria 1376
135 Ga0111539_10546179 3300009094 Bacteria 1350
136 Ga0105245_10584410 3300009098 Bacteria 1142
137 Ga0105247_10708961 3300009101 Bacteria 758
138 Ga0114129_10001252 3300009147 Bacteria 33867
139 Ga0114129_10010233 3300009147 Bacteria 13379
140 Ga0114129_10019500 3300009147 Bacteria 9657
141 Ga0114129_10046975 3300009147 Bacteria 6067
142 Ga0114129_10054319 3300009147 Bacteria 5615
143 Ga0114129_10116468 3300009147 Bacteria 3682
144 Ga0114129_10275753 3300009147 Bacteria 2248
145 Ga0114129_10448339 3300009147 Bacteria 1693
146 Ga0114129_10746137 3300009147 Bacteria 1254
147 Ga0105243_10049419 3300009148 Bacteria 3318
148 Ga0105243_11450937 3300009148 Bacteria 708
149 Ga0105242_10007644 3300009176 Bacteria 8319
150 Ga0105242_10328929 3300009176 Bacteria 1404
151 Ga0105248_10018349 3300009177 Bacteria 7728
152 Ga0105248_10093766 3300009177 Bacteria 3381
153 Ga0105248_10739376 3300009177 Unclassified 1110
154 Ga0105237_11279368 3300009545 Unclassified 740
155 Ga0105249_10116283 3300009553 Bacteria 2535
156 Ga0105249_10810381 3300009553 Bacteria 1001
157 Ga0105249_11664558 3300009553 Unclassified 711
158 Ga0157374_11666685 3300013296 Unclassified 662
159 Ga0163162_10458945 3300013306 Bacteria 1406
160 Ga0163163_10442178 3300014325 Bacteria 1360
161 Ga0163163_10522791 3300014325 Bacteria 1249
162 Ga0157380_10065619 3300014326 Bacteria 2918
163 Ga0157380_10602755 3300014326 Bacteria 1087
164 Ga0157379_10226650 3300014968 Bacteria 1694
165 Ga0157376_10008962 3300014969 Bacteria 7246
166 Ga0207656_10181087 3300025321 Bacteria 1011
167 Ga0207642_10283922 3300025899 Unclassified 953
168 Ga0207642_10538820 3300025899 Bacteria 719
169 Ga0207680_10103616 3300025903 Unclassified 1833
170 Ga0207645_10016425 3300025907 Bacteria 4901
171 Ga0207645_10120978 3300025907 Unclassified 1699
172 Ga0207645_10249645 3300025907 Unclassified 1174
173 Ga0207643_10237249 3300025908 Bacteria 1120
174 Ga0207684_10493286 3300025910 Bacteria 1050
175 Ga0207707_10088244 3300025912 Bacteria 2709
176 Ga0207695_10261156 3300025913 Bacteria 1629
177 Ga0207695_10545648 3300025913 Unclassified 1041
178 Ga0207662_10340392 3300025918 Bacteria 1005
179 Ga0207662_10390390 3300025918 Unclassified 942
180 Ga0207646_10258790 3300025922 Bacteria 1573
181 Ga0207646_10381376 3300025922 Unclassified 1273
182 Ga0207646_11443164 3300025922 Bacteria 597
183 Ga0207681_10136112 3300025923 Bacteria 1823
184 Ga0207681_10254196 3300025923 Bacteria 1373
185 Ga0207659_10009049 3300025926 Bacteria 6211
186 Ga0207659_10020892 3300025926 Bacteria 4336
187 Ga0207659_10863257 3300025926 Unclassified 778
188 Ga0207706_10325207 3300025933 Unclassified 1338
189 Ga0207706_10789249 3300025933 Unclassified 807
190 Ga0207686_10434857 3300025934 Unclassified 1006
191 Ga0207709_10126099 3300025935 Unclassified 1737
192 Ga0207670_10450788 3300025936 Bacteria 1037
193 Ga0207670_10838140 3300025936 Bacteria 768
194 Ga0207669_10013160 3300025937 Bacteria 4098
195 Ga0207669_10123667 3300025937 Bacteria 1762
196 Ga0207704_10079102 3300025938 Unclassified 2117
197 Ga0207691_10250402 3300025940 Bacteria 1529
198 Ga0207691_10370856 3300025940 Unclassified 1223
199 Ga0207711_10484215 3300025941 Unclassified 1153
200 Ga0207661_11591737 3300025944 Bacteria 598
201 Ga0207679_11472073 3300025945 Unclassified 625
202 Ga0207651_10497660 3300025960 Bacteria 1053
203 Ga0207712_10521183 3300025961 Bacteria 1019
204 Ga0207712_10666493 3300025961 Bacteria 905
205 Ga0207712_10931135 3300025961 Unclassified 769
206 Ga0207668_10065726 3300025972 Unclassified 2568
207 Ga0207668_10243894 3300025972 Unclassified 1455
208 Ga0207640_10031425 3300025981 Unclassified 3280
209 Ga0207640_10323050 3300025981 Bacteria 1229
210 Ga0207658_10843382 3300025986 Bacteria 833
211 Ga0207677_10120586 3300026023 Bacteria 1972
212 Ga0207703_10111242 3300026035 Bacteria 2338
213 Ga0207703_11496565 3300026035 Bacteria 649
214 Ga0207708_10013415 3300026075 Bacteria 6125
215 Ga0207708_10209970 3300026075 Bacteria 1556
216 Ga0207708_10491146 3300026075 Unclassified 1028
217 Ga0207641_10000885 3300026088 Bacteria 31246
218 Ga0207641_10226726 3300026088 Bacteria 1735
219 Ga0207648_10026255 3300026089 Bacteria 5177
220 Ga0207648_10124966 3300026089 Bacteria 2262
221 Ga0207648_10286267 3300026089 Unclassified 1474
222 Ga0207676_10322166 3300026095 Bacteria 1419
223 Ga0207675_100015748 3300026118 Bacteria 7051
224 Ga0207675_100187408 3300026118 Bacteria 1983
225 Ga0207675_100227727 3300026118 Unclassified 1798
226 Ga0207675_100824602 3300026118 Bacteria 942
227 Ga0207675_100929024 3300026118 Bacteria 887
228 Ga0207675_102035808 3300026118 Bacteria 591
229 Ga0207428_10135787 3300027907 Bacteria 1880
230 Ga0207428_10251896 3300027907 Bacteria 1317
231 Ga0268266_10009548 3300028379 Bacteria 8537
232 Ga0268266_10084329 3300028379 Bacteria 2775
233 Ga0268265_10145038 3300028380 Unclassified 1993
234 Ga0268265_10895426 3300028380 Unclassified 871
235 Ga0268264_10302012 3300028381 Bacteria 1507
236 Ga0268264_11590403 3300028381 Unclassified 664
237 Ga0307408_100336458 3300031548 Bacteria 1276
238 Ga0373948_0101725 3300034817 Bacteria 677
239 Ga0373950_0001044 3300034818 Bacteria 3532
240 Ga0373958_0007620 3300034819 Bacteria 1732
241 Ga0373959_0003382 3300034820 Bacteria 2537
242 Ga0373938_0003823 3300034957 Bacteria 2486
243 Ga0373929_0001226 3300035085 Bacteria 4959
244 Ga0373940_0008587 3300035088 Bacteria 2349
245 Ga0373949_0001332 3300035090 Bacteria 7106
246 Ga0373951_0004210 3300035091 Bacteria 3429
247 Ga0373952_0002140 3300035092 Bacteria 3551
248 Ga0373932_0000571 3300035112 Bacteria 11316
249 Ga0373932_0105687 3300035112 Bacteria 922
250 Ga0373939_0002833 3300035114 Bacteria 4071
251 Ga0373939_0235003 3300035114 Bacteria 707
252 Ga0373941_0000139 3300035115 Bacteria 12841
253 Ga0373945_0122520 3300035116 Bacteria 1035
254 Ga0373957_0371111 3300035120 Bacteria 613
255 Ga0373960_0000342 3300035121 Bacteria 8968
256 Ga0373960_0066541 3300035121 Bacteria 1105
257 Ga0373946_0076167 3300035171 Unclassified 1460
258 Ga0373955_0244388 3300035172 Unclassified 1075
259 Ga0373942_0002407 3300035207 Bacteria 4541
260 Ga0373961_0003605 3300035241 Bacteria 3811
261 Ga0373962_0015842 3300035242 Bacteria 1937
262 Ga0373962_0111622 3300035242 Bacteria 863
263 Ga0373962_0139205 3300035242 Bacteria 787
264 Ga0373931_0187496 3300035691 Bacteria 1228
265 Ga0373933_0309506 3300035724 Bacteria 1023
266 Ga0373937_0019538 3300036401 Bacteria 6063
267 Ga0373937_0823555 3300036401 Unclassified 876
268 Ga0451576_0084357 3300045051 Bacteria 3304
269 Ga0466967_0745847 3300045976 Unclassified 971
270 Ga0466967_0765260 3300045976 Unclassified 958
271 Ga0495592_0147059 3300046454 Unclassified 1633
272 Ga0495653_0738711 3300046463 Unclassified 595
273 Ga0495582_0160859 3300046473 Bacteria 1277
274 Ga0495662_0250739 3300046476 Bacteria 872
275 Ga0495608_0215776 3300046511 Bacteria 1205
276 Ga0495628_0126046 3300046516 Unclassified 1962
277 Ga0495586_0286592 3300046535 Bacteria 943
278 Ga0495586_0466759 3300046535 Bacteria 728
279 Ga0495587_0090938 3300046536 Unclassified 1763
280 Ga0495645_0003500 3300046543 Bacteria 10636
281 Ga0495667_0057504 3300046559 Unclassified 2556
282 Ga0495656_0082087 3300046615 Bacteria 1457
283 Ga0495611_0071168 3300046648 Bacteria 1590
284 Ga0495635_0281690 3300046663 Bacteria 1117
285 Ga0495599_0428628 3300046678 Bacteria 785
286 Ga0495647_0140184 3300046681 Bacteria 1031
287 Ga0495658_0040147 3300046683 Unclassified 2601
288 Ga0495658_0300131 3300046683 Bacteria 1016
289 Ga0495669_0679919 3300046684 Bacteria 500
290 Ga0495600_0056748 3300046809 Unclassified 2559
291 Ga0495604_0180154 3300047317 Unclassified 1479
292 Ga0495674_0099645 3300047319 Unclassified 2473
293 Ga0495677_0147473 3300047445 Bacteria 905
294 Ga0495684_0153124 3300047471 Bacteria 1723
295 Ga0496102_0578678 3300048905 Bacteria 1046
296 Ga0496103_0680512 3300048906 Bacteria 653
297 Ga0496104_0055555 3300048907 Bacteria 3744
298 Ga0496105_1397951 3300048908 Bacteria 507
299 Ga0496106_0161385 3300048909 Bacteria 1773
300 Ga0496106_0197148 3300048909 Unclassified 1602
301 Ga0496107_0995976 3300048910 Unclassified 608
302 Ga0496108_0111102 3300048911 Bacteria 2344
303 Ga0496110_1318147 3300048913 Unclassified 631
304 Ga0496111_1005043 3300048914 Unclassified 597
305 Ga0496112_0671120 3300048915 Bacteria 965
306 Ga0496113_0705397 3300048916 Bacteria 805
307 Ga0496114_0166638 3300048917 Unclassified 1918
308 Ga0496115_0108517 3300048918 Bacteria 2279
309 nmdc:mga05p37_11742_c1 3300050507 Bacteria 10442
310 nmdc:mga05p37_12713_c1 3300050507 Bacteria 8883
311 nmdc:mga05p37_177646_c1 3300050507 Bacteria 2593
312 nmdc:mga05p37_2569_c1 3300050507 Bacteria 21101
313 nmdc:mga05p37_364796_c1 3300050507 Bacteria 1697
314 nmdc:mga05p37_51532_c1 3300050507 Bacteria 5061
315 nmdc:mga05p37_56133_c1 3300050507 Bacteria 4848
316 nmdc:mga05p37_5618_c1 3300050507 Bacteria 14740
317 nmdc:mga05p37_763108_c1 3300050507 Bacteria 1064
318 nmdc:mga05p37_825913_c1 3300050507 Bacteria 1010
319 nmdc:mga09592_454875_c1 3300050508 Bacteria 1104
320 nmdc:mga06r32_590379_c1 3300050510 Unclassified 1082
321 nmdc:mga08y16_107010_c1 3300050511 Bacteria 2911
322 nmdc:mga08y16_200156_c1 3300050511 Bacteria 2070
323 nmdc:mga08y16_247427_c1 3300050511 Bacteria 1842
324 nmdc:mga08y16_767836_c1 3300050511 Unclassified 959
325 nmdc:mga0n895_108459_c1 3300050512 Bacteria 2791
326 nmdc:mga0n895_1140486_c1 3300050512 Unclassified 755
327 nmdc:mga0n895_22379_c1 3300050512 Bacteria 5926
328 nmdc:mga0n895_385639_c1 3300050512 Unclassified 1418
329 nmdc:mga0n895_56730_c1 3300050512 Bacteria 3859
330 nmdc:mga0n895_619149_c1 3300050512 Unclassified 1084
331 nmdc:mga0n895_817310_c1 3300050512 Bacteria 922
332 nmdc:mga0n895_89546_c1 3300050512 Bacteria 3078
333 nmdc:mga0rr50_109502_c1 3300050513 Bacteria 2184
334 nmdc:mga0rr50_1294943_c1 3300050513 Unclassified 618
335 nmdc:mga0rr50_13799_c1 3300050513 Bacteria 5275
336 nmdc:mga0rr50_13_c1 3300050513 Bacteria 213605
337 nmdc:mga0rr50_19166_c1 3300050513 Bacteria 4612
338 nmdc:mga0rr50_27311_c1 3300050513 Bacteria 3994
339 nmdc:mga0rr50_287872_c1 3300050513 Bacteria 1372
340 nmdc:mga08x19_14578_c1 3300050514 Bacteria 4769
341 nmdc:mga08x19_193391_c1 3300050514 Bacteria 1392
342 nmdc:mga08x19_279957_c1 3300050514 Bacteria 1156
343 nmdc:mga08x19_370859_c1 3300050514 Unclassified 1002
344 nmdc:mga08x19_424346_c1 3300050514 Bacteria 934
345 nmdc:mga08x19_673680_c1 3300050514 Bacteria 734
346 nmdc:mga0a205_142244_c1 3300050515 Unclassified 2299
347 nmdc:mga0a205_22173_c1 3300050515 Bacteria 6011
348 nmdc:mga0a205_439947_c1 3300050515 Unclassified 1165
349 nmdc:mga0a205_619915_c1 3300050515 Bacteria 934
350 nmdc:mga0a205_678493_c1 3300050515 Bacteria 881
351 nmdc:mga0a205_697823_c1 3300050515 Bacteria 865
352 Ga0495601_0051426 3300053077 Unclassified 2600
353 Ga0495595_0197331 3300053084 Bacteria 1001
354 Ga0495619_0011939 3300053085 Bacteria 5472
355 nmdc:mga08y16_755855_c1
356 Ga0065715_10453514
357 Ga0065715_10681039
358 Ga0065715_10694466
359 Ga0070676_10070192
360 Ga0070676_10116575
361 Ga0070690_100011550
362 Ga0070690_100649383
363 Ga0070670_100777547
364 Ga0070666_10040282
365 Ga0068868_100145434
366 Ga0070689_100726929
367 Ga0070691_10001561
368 Ga0070687_100008882
369 Ga0070687_100326315
370 Ga0070692_10156521
371 Ga0070668_100019554
372 Ga0070668_100092573
373 Ga0070669_100042003
374 Ga0070669_100139703
375 Ga0070669_100290766
376 Ga0070675_100000280
377 Ga0070675_100296996
378 Ga0070674_100007624
379 Ga0070674_102078517
380 Ga0070673_100533005
381 Ga0070673_101110701
382 Ga0070673_101289425
383 Ga0070673_101414834
384 Ga0070688_100038840
385 Ga0070659_100761105
386 Ga0070701_10058945
387 Ga0070701_10797842
388 Ga0070705_100156086
389 Ga0070705_101415866
390 Ga0070700_100147679
391 Ga0070700_100236291
392 Ga0070700_100630971
393 Ga0070694_100381714
394 Ga0070694_100428100
395 Ga0070694_101189091
396 Ga0070694_101871702
397 Ga0070708_100882313
398 Ga0070708_101093046
399 Ga0070662_100414086
400 Ga0070681_10210578
401 Ga0068867_100130471
402 Ga0068867_100326642
403 Ga0068867_100404621
404 Ga0070706_100399782
405 Ga0070706_101158798
406 Ga0070707_100156675
407 Ga0070707_100330985
408 Ga0070707_101834314
409 Ga0070698_100327039
410 Ga0070698_101136733
411 Ga0070699_100258528
412 Ga0070699_100956546
413 Ga0070699_101600079
414 Ga0070684_100961956
415 Ga0070697_100209121
416 Ga0068853_100484020
417 Ga0070686_100001936
418 Ga0070686_100067249
419 Ga0070695_100443954
420 Ga0070695_101162270
421 Ga0070696_100145834
422 Ga0070696_100299154
423 Ga0070696_100350070
424 Ga0070696_100502674
425 Ga0070696_101005368
426 Ga0070665_100011124
427 Ga0070665_100178185
428 Ga0070704_100004437
429 Ga0068855_100506605
430 Ga0068857_101802210
431 Ga0068854_100023288
432 Ga0068854_100189494
433 Ga0068854_100585419
434 Ga0070702_100008655
435 Ga0068859_100313416
436 Ga0068864_100320672
437 Ga0068866_10474344
438 Ga0068861_100003827
439 Ga0068861_100055882
440 Ga0068861_100103116
441 Ga0068861_100551271
442 Ga0068861_101507870
443 Ga0068851_10189010
444 Ga0068863_100004083
445 Ga0068863_100108809
446 Ga0068858_100274026
447 Ga0068858_101448610
448 Ga0068860_102511779
449 Ga0068862_100037466
450 Ga0068862_100437441
451 Ga0068862_100506597
452 Ga0081455_10351154
453 Ga0081539_10005962
454 Ga0075363_100730424
455 Ga0097621_100092957
456 Ga0097621_101518091
457 Ga0068871_100209237
458 Ga0075428_100097992
459 Ga0075428_100779690
460 Ga0075428_102552015
461 Ga0075431_100651577
462 Ga0075433_10060724
463 Ga0075433_10322567
464 Ga0075434_100002826
465 Ga0075434_100035312
466 Ga0075434_100117938
467 Ga0075434_100132231
468 Ga0075434_100154841
469 Ga0075429_100270350
470 Ga0075429_100331910
471 Ga0068865_100201276
472 Ga0075436_100005544
473 Ga0075436_100050589
474 Ga0075436_100094240
475 Ga0075436_100123472
476 Ga0075436_100494843
477 Ga0075436_101066445
478 Ga0097620_100313412
479 Ga0075435_100000067
480 Ga0075435_100001902
481 Ga0075435_100004052
482 Ga0075435_100019488
483 Ga0075435_100029272
484 Ga0075435_100145732
485 Ga0075435_101320119
486 Ga0105240_10348191
487 Ga0105240_10489045
488 Ga0111539_10526914
489 Ga0111539_10546179
490 Ga0105245_10584410
491 Ga0105247_10708961
492 Ga0114129_10001252
493 Ga0114129_10010233
494 Ga0114129_10019500
495 Ga0114129_10046975
496 Ga0114129_10054319
497 Ga0114129_10116468
498 Ga0114129_10275753
499 Ga0114129_10448339
500 Ga0114129_10746137
501 Ga0105243_10049419
502 Ga0105243_11450937
503 Ga0105242_10007644
504 Ga0105242_10328929
505 Ga0105248_10018349
506 Ga0105248_10093766
507 Ga0105248_10739376
508 Ga0105237_11279368
509 Ga0105249_10116283
510 Ga0105249_10810381
511 Ga0105249_11664558
512 Ga0157374_11666685
513 Ga0163162_10458945
514 Ga0163163_10442178
515 Ga0163163_10522791
516 Ga0157380_10065619
517 Ga0157380_10602755
518 Ga0157379_10226650
519 Ga0157376_10008962
520 Ga0207656_10181087
521 Ga0207642_10283922
522 Ga0207642_10538820
523 Ga0207680_10103616
524 Ga0207645_10016425
525 Ga0207645_10120978
526 Ga0207645_10249645
527 Ga0207643_10237249
528 Ga0207684_10493286
529 Ga0207707_10088244
530 Ga0207695_10261156
531 Ga0207695_10545648
532 Ga0207662_10340392
533 Ga0207662_10390390
534 Ga0207646_10258790
535 Ga0207646_10381376
536 Ga0207646_11443164
537 Ga0207681_10136112
538 Ga0207681_10254196
539 Ga0207659_10009049
540 Ga0207659_10020892
541 Ga0207659_10863257
542 Ga0207706_10325207
543 Ga0207706_10789249
544 Ga0207686_10434857
545 Ga0207709_10126099
546 Ga0207670_10450788
547 Ga0207670_10838140
548 Ga0207669_10013160
549 Ga0207669_10123667
550 Ga0207704_10079102
551 Ga0207691_10250402
552 Ga0207691_10370856
553 Ga0207711_10484215
554 Ga0207661_11591737
555 Ga0207679_11472073
556 Ga0207651_10497660
557 Ga0207712_10521183
558 Ga0207712_10666493
559 Ga0207712_10931135
560 Ga0207668_10065726
561 Ga0207668_10243894
562 Ga0207640_10031425
563 Ga0207640_10323050
564 Ga0207658_10843382
565 Ga0207677_10120586
566 Ga0207703_10111242
567 Ga0207703_11496565
568 Ga0207708_10013415
569 Ga0207708_10209970
570 Ga0207708_10491146
571 Ga0207641_10000885
572 Ga0207641_10226726
573 Ga0207648_10026255
574 Ga0207648_10124966
575 Ga0207648_10286267
576 Ga0207676_10322166
577 Ga0207675_100015748
578 Ga0207675_100187408
579 Ga0207675_100227727
580 Ga0207675_100824602
581 Ga0207675_100929024
582 Ga0207675_102035808
583 Ga0207428_10135787
584 Ga0207428_10251896
585 Ga0268266_10009548
586 Ga0268266_10084329
587 Ga0268265_10145038
588 Ga0268265_10895426
589 Ga0268264_10302012
590 Ga0268264_11590403
591 Ga0307408_100336458
592 Ga0373948_0101725
593 Ga0373950_0001044
594 Ga0373958_0007620
595 Ga0373959_0003382
596 Ga0373938_0003823
597 Ga0373929_0001226
598 Ga0373940_0008587
599 Ga0373949_0001332
600 Ga0373951_0004210
601 Ga0373952_0002140
602 Ga0373932_0000571
603 Ga0373932_0105687
604 Ga0373939_0002833
605 Ga0373939_0235003
606 Ga0373941_0000139
607 Ga0373945_0122520
608 Ga0373957_0371111
609 Ga0373960_0000342
610 Ga0373960_0066541
611 Ga0373946_0076167
612 Ga0373955_0244388
613 Ga0373942_0002407
614 Ga0373961_0003605
615 Ga0373962_0015842
616 Ga0373962_0111622
617 Ga0373962_0139205
618 Ga0373931_0187496
619 Ga0373933_0309506
620 Ga0373937_0019538
621 Ga0373937_0823555
622 Ga0451576_0084357
623 Ga0466967_0745847
624 Ga0466967_0765260
625 Ga0495592_0147059
626 Ga0495653_0738711
627 Ga0495582_0160859
628 Ga0495662_0250739
629 Ga0495608_0215776
630 Ga0495628_0126046
631 Ga0495586_0286592
632 Ga0495586_0466759
633 Ga0495587_0090938
634 Ga0495645_0003500
635 Ga0495667_0057504
636 Ga0495656_0082087
637 Ga0495611_0071168
638 Ga0495635_0281690
639 Ga0495599_0428628
640 Ga0495647_0140184
641 Ga0495658_0040147
642 Ga0495658_0300131
643 Ga0495669_0679919
644 Ga0495600_0056748
645 Ga0495604_0180154
646 Ga0495674_0099645
647 Ga0495677_0147473
648 Ga0495684_0153124
649 Ga0496102_0578678
650 Ga0496103_0680512
651 Ga0496104_0055555
652 Ga0496105_1397951
653 Ga0496106_0161385
654 Ga0496106_0197148
655 Ga0496107_0995976
656 Ga0496108_0111102
657 Ga0496110_1318147
658 Ga0496111_1005043
659 Ga0496112_0671120
660 Ga0496113_0705397
661 Ga0496114_0166638
662 Ga0496115_0108517
663 nmdc:mga05p37_11742_c1
664 nmdc:mga05p37_12713_c1
665 nmdc:mga05p37_177646_c1
666 nmdc:mga05p37_2569_c1
667 nmdc:mga05p37_364796_c1
668 nmdc:mga05p37_51532_c1
669 nmdc:mga05p37_56133_c1
670 nmdc:mga05p37_5618_c1
671 nmdc:mga05p37_763108_c1
672 nmdc:mga05p37_825913_c1
673 nmdc:mga09592_454875_c1
674 nmdc:mga06r32_590379_c1
675 nmdc:mga08y16_107010_c1
676 nmdc:mga08y16_200156_c1
677 nmdc:mga08y16_247427_c1
678 nmdc:mga08y16_767836_c1
679 nmdc:mga0n895_108459_c1
680 nmdc:mga0n895_1140486_c1
681 nmdc:mga0n895_22379_c1
682 nmdc:mga0n895_385639_c1
683 nmdc:mga0n895_56730_c1
684 nmdc:mga0n895_619149_c1
685 nmdc:mga0n895_817310_c1
686 nmdc:mga0n895_89546_c1
687 nmdc:mga0rr50_109502_c1
688 nmdc:mga0rr50_1294943_c1
689 nmdc:mga0rr50_13799_c1
690 nmdc:mga0rr50_13_c1
691 nmdc:mga0rr50_19166_c1
692 nmdc:mga0rr50_27311_c1
693 nmdc:mga0rr50_287872_c1
694 nmdc:mga08x19_14578_c1
695 nmdc:mga08x19_193391_c1
696 nmdc:mga08x19_279957_c1
697 nmdc:mga08x19_370859_c1
698 nmdc:mga08x19_424346_c1
699 nmdc:mga08x19_673680_c1
700 nmdc:mga0a205_142244_c1
701 nmdc:mga0a205_22173_c1
702 nmdc:mga0a205_439947_c1
703 nmdc:mga0a205_619915_c1
704 nmdc:mga0a205_678493_c1
705 nmdc:mga0a205_697823_c1
706 Ga0495601_0051426
707 Ga0495595_0197331
708 Ga0495619_0011939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

47

167

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.9606 46 144
3k0t-assembly1.cif.gz_B crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. tomato str. dc3000 0.9601 46 146
5y6u-assembly1.cif.gz_C crystal structure of wild-type yabj protein from bacillus subtilis (natto). 0.9596 46 146
2dyy-assembly3.cif.gz_G crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9538 46 144
3v4d-assembly2.cif.gz_B crystal structure of rutc protein a member of the yjgf family from e.coli 0.9506 46 144
ID Description Score Start End Superfamily
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9579 46 146 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9538 46 144 3.30.1330.40
3k0tB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9526 46 146 3.30.1330.40
6izhH00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9507 46 144 3.30.1330.40
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9293 37 144 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A535L3E5-F1-model_v4 RidA family protein 0.9899 46 144 GO:0005829
GO:0019239
AF-A0A1G3LTS7-F1-model_v4 Enamine deaminase RidA 0.9854 46 146 GO:0005829
GO:0019239
AF-A0A7C3K5P9-F1-model_v4 RidA family protein 0.9851 46 146 GO:0005829
GO:0019239
AF-A0A839XSV1-F1-model_v4 Enamine deaminase RidA (YjgF/YER057c/UK114 family) 0.9841 53 144 GO:0003824
GO:0044281
AF-A0A1Q7UK20-F1-model_v4 Enamine deaminase RidA 0.9823 46 146 GO:0005829
GO:0019239

Map