F419827

General Info

Members Datasets Scaffolds Average Seq Length
354 188 708 225

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0625576|Ga0373925_0625576_66_821
Length 251
Sequence MKKPLQKPSARSHQPLAISHDAKPSTLSAEGYGKARRYLMRRDPVLGTAIKTIGACGMADRQRKDHLSALVGAIVSQQLSTKAAATIFGRFVALFPGNHIPDAAAIAAHSDEVLRSVGLSGQKVSYLRDLSARLLDGRLQLDELETLPDEAVIERLVAVKGFGRWTAEMFLMFRLHRPDVLPAGDLGVVVAIQRLYRLRKRPDARRVLKIGEAWRPYRSVASWYLWQTLRNEPLSKAASSPKPSPRKSRAR

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.37
Rhizosphere 94.63
Stem 0
Stem Tuber 0
Unclassified 9.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0625576 3300037068 Bacteria 887
2 Ga0065704_10204731 3300005289 Bacteria 1132
3 Ga0065712_10077689 3300005290 Bacteria 3407
4 Ga0065715_10113987 3300005293 Bacteria 2467
5 Ga0070658_10034818 3300005327 Bacteria 4053
6 Ga0070683_100077436 3300005329 Bacteria 3110
7 Ga0070690_100063597 3300005330 Bacteria 2382
8 Ga0070670_100387910 3300005331 Bacteria 1231
9 Ga0070689_100404472 3300005340 Bacteria 1154
10 Ga0070661_100010982 3300005344 Bacteria 6312
11 Ga0070668_100651322 3300005347 Bacteria 926
12 Ga0070669_100058612 3300005353 Bacteria 2826
13 Ga0070669_100085210 3300005353 Bacteria 2359
14 Ga0070675_100030106 3300005354 Bacteria 4379
15 Ga0070675_100133652 3300005354 Bacteria 2116
16 Ga0070709_10106144 3300005434 Bacteria 1880
17 Ga0070709_10240839 3300005434 Bacteria 1299
18 Ga0070714_100001083 3300005435 Bacteria 19485
19 Ga0070701_10001654 3300005438 Bacteria 8337
20 Ga0070700_100036906 3300005441 Bacteria 2968
21 Ga0070700_100318634 3300005441 Bacteria 1141
22 Ga0070708_100017168 3300005445 Bacteria 6028
23 Ga0070662_100104242 3300005457 Bacteria 2152
24 Ga0070681_10025553 3300005458 Bacteria 5941
25 Ga0070681_10181521 3300005458 Bacteria 2026
26 Ga0070681_10225078 3300005458 Bacteria 1791
27 Ga0068867_100014892 3300005459 Bacteria 5512
28 Ga0068867_100050010 3300005459 Bacteria 3079
29 Ga0070685_10174921 3300005466 Unclassified 1378
30 Ga0070706_100431779 3300005467 Unclassified 1226
31 Ga0070706_100589862 3300005467 Bacteria 1033
32 Ga0070707_100463769 3300005468 Bacteria 1228
33 Ga0070698_100061895 3300005471 Bacteria 3777
34 Ga0070698_100201862 3300005471 Bacteria 1924
35 Ga0070698_100294426 3300005471 Bacteria 1554
36 Ga0070699_100021600 3300005518 Bacteria 5550
37 Ga0070684_100040030 3300005535 Bacteria 4033
38 Ga0070697_100424968 3300005536 Bacteria 1155
39 Ga0068853_100235602 3300005539 Bacteria 1676
40 Ga0070686_100038777 3300005544 Bacteria 2964
41 Ga0070686_100427392 3300005544 Unclassified 1013
42 Ga0070695_100005595 3300005545 Bacteria 7399
43 Ga0070696_100003693 3300005546 Bacteria 10207
44 Ga0070696_100067661 3300005546 Bacteria 2507
45 Ga0070693_100055571 3300005547 Unclassified 2281
46 Ga0070665_100031055 3300005548 Bacteria 5376
47 Ga0070704_100032966 3300005549 Bacteria 3499
48 Ga0070704_100841199 3300005549 Bacteria 822
49 Ga0068855_100017318 3300005563 Bacteria 8669
50 Ga0070664_100071286 3300005564 Bacteria 2977
51 Ga0068857_100342591 3300005577 Bacteria 1383
52 Ga0068857_100441566 3300005577 Bacteria 1216
53 Ga0068856_100021485 3300005614 Bacteria 6273
54 Ga0068856_100104459 3300005614 Bacteria 2827
55 Ga0070702_100017778 3300005615 Bacteria 3675
56 Ga0068859_100028916 3300005617 Bacteria 5560
57 Ga0068859_100031429 3300005617 Bacteria 5332
58 Ga0068859_100075393 3300005617 Bacteria 3414
59 Ga0068859_101261470 3300005617 Unclassified 814
60 Ga0068864_100037523 3300005618 Bacteria 4135
61 Ga0068864_100129743 3300005618 Bacteria 2263
62 Ga0068866_10019778 3300005718 Bacteria 3073
63 Ga0068861_100010459 3300005719 Bacteria 6439
64 Ga0068861_100243861 3300005719 Bacteria 1530
65 Ga0068861_100416349 3300005719 Unclassified 1196
66 Ga0068851_10123379 3300005834 Bacteria 1394
67 Ga0068863_100059276 3300005841 Bacteria 3622
68 Ga0068863_100060272 3300005841 Bacteria 3589
69 Ga0068858_100003439 3300005842 Bacteria 15721
70 Ga0068858_100012089 3300005842 Bacteria 8137
71 Ga0068858_100032643 3300005842 Bacteria 4834
72 Ga0068858_100207239 3300005842 Bacteria 1855
73 Ga0068858_100418211 3300005842 Bacteria 1289
74 Ga0068860_100087217 3300005843 Bacteria 2971
75 Ga0068860_100621425 3300005843 Bacteria 1087
76 Ga0068862_100039725 3300005844 Bacteria 3997
77 Ga0068862_100088214 3300005844 Bacteria 2699
78 Ga0068862_100275138 3300005844 Bacteria 1541
79 Ga0068862_100309039 3300005844 Bacteria 1456
80 Ga0097621_100000820 3300006237 Bacteria 21967
81 Ga0097621_100029899 3300006237 Bacteria 4307
82 Ga0068871_100000748 3300006358 Bacteria 22005
83 Ga0068871_100014691 3300006358 Bacteria 5843
84 Ga0068871_100124803 3300006358 Bacteria 2178
85 Ga0075428_100098115 3300006844 Bacteria 3194
86 Ga0075428_100217608 3300006844 Bacteria 2063
87 Ga0075431_100244180 3300006847 Bacteria 1826
88 Ga0075433_10173049 3300006852 Unclassified 1921
89 Ga0075433_10451006 3300006852 Bacteria 1134
90 Ga0075434_100000100 3300006871 Bacteria 48123
91 Ga0075434_100024505 3300006871 Bacteria 5898
92 Ga0075434_100208640 3300006871 Bacteria 1974
93 Ga0075429_100502282 3300006880 Bacteria 1063
94 Ga0075436_100000583 3300006914 Bacteria 23900
95 Ga0075436_100026588 3300006914 Bacteria 3984
96 Ga0075436_100102426 3300006914 Bacteria 1994
97 Ga0075436_100349207 3300006914 Bacteria 1066
98 Ga0097620_100028917 3300006931 Bacteria 5560
99 Ga0097620_100031429 3300006931 Bacteria 5332
100 Ga0097620_100075392 3300006931 Bacteria 3414
101 Ga0097620_101261283 3300006931 Unclassified 814
102 Ga0075435_100000192 3300007076 Bacteria 36826
103 Ga0075435_100003636 3300007076 Bacteria 10496
104 Ga0075435_100109164 3300007076 Unclassified 2299
105 Ga0075435_100187488 3300007076 Bacteria 1750
106 Ga0075435_100190808 3300007076 Unclassified 1734
107 Ga0075435_100264124 3300007076 Bacteria 1467
108 Ga0105240_10064661 3300009093 Bacteria 4545
109 Ga0105240_10182128 3300009093 Bacteria 2478
110 Ga0105240_10557369 3300009093 Bacteria 1267
111 Ga0111539_10002576 3300009094 Bacteria 24001
112 Ga0111539_10003965 3300009094 Bacteria 19451
113 Ga0111539_10012733 3300009094 Bacteria 10533
114 Ga0111539_10222846 3300009094 Bacteria 2196
115 Ga0105245_10020103 3300009098 Bacteria 5853
116 Ga0105245_10119698 3300009098 Bacteria 2458
117 Ga0105245_10439523 3300009098 Bacteria 1311
118 Ga0105245_10696176 3300009098 Unclassified 1049
119 Ga0105247_10004860 3300009101 Bacteria 8548
120 Ga0105247_10006654 3300009101 Bacteria 7134
121 Ga0105247_10024870 3300009101 Bacteria 3610
122 Ga0114129_10013888 3300009147 Bacteria 11476
123 Ga0114129_10014154 3300009147 Bacteria 11366
124 Ga0114129_10025515 3300009147 Bacteria 8375
125 Ga0114129_10048658 3300009147 Bacteria 5957
126 Ga0114129_10049148 3300009147 Bacteria 5928
127 Ga0114129_10361559 3300009147 Bacteria 1920
128 Ga0114129_10387379 3300009147 Bacteria 1845
129 Ga0114129_11142096 3300009147 Bacteria 973
130 Ga0114129_11164208 3300009147 Bacteria 962
131 Ga0105243_10006011 3300009148 Bacteria 9396
132 Ga0105243_10040643 3300009148 Bacteria 3633
133 Ga0105241_10424072 3300009174 Bacteria 1171
134 Ga0105242_10014046 3300009176 Bacteria 6197
135 Ga0105248_10001706 3300009177 Bacteria 24451
136 Ga0105248_10099950 3300009177 Bacteria 3268
137 Ga0105248_10831988 3300009177 Unclassified 1042
138 Ga0105237_10114351 3300009545 Bacteria 2691
139 Ga0105237_10882958 3300009545 Bacteria 901
140 Ga0105238_10494903 3300009551 Bacteria 1223
141 Ga0105238_10600039 3300009551 Bacteria 1109
142 Ga0105249_10225039 3300009553 Bacteria 1848
143 Ga0105249_10226767 3300009553 Bacteria 1841
144 Ga0105249_10662886 3300009553 Bacteria 1102
145 Ga0105249_10917142 3300009553 Unclassified 943
146 Ga0105249_10950487 3300009553 Bacteria 927
147 Ga0105246_10262701 3300011119 Bacteria 1376
148 Ga0157369_10344959 3300013105 Unclassified 1547
149 Ga0157374_10046922 3300013296 Bacteria 4003
150 Ga0157374_10056854 3300013296 Unclassified 3653
151 Ga0157378_10258182 3300013297 Bacteria 1671
152 Ga0163162_10082770 3300013306 Bacteria 3282
153 Ga0157372_10242589 3300013307 Bacteria 2091
154 Ga0163163_10027079 3300014325 Bacteria 5485
155 Ga0157380_10085531 3300014326 Bacteria 2588
156 Ga0157379_10003996 3300014968 Bacteria 12574
157 Ga0157379_10017728 3300014968 Bacteria 6273
158 Ga0157379_10058674 3300014968 Bacteria 3442
159 Ga0157379_10124208 3300014968 Bacteria 2322
160 Ga0157376_10003823 3300014969 Bacteria 10412
161 Ga0157376_10017013 3300014969 Bacteria 5535
162 Ga0157376_10019382 3300014969 Bacteria 5243
163 Ga0157376_10036176 3300014969 Bacteria 3998
164 Ga0157376_11043851 3300014969 Bacteria 841
165 Ga0163161_10207198 3300017792 Bacteria 1513
166 Ga0163161_10290252 3300017792 Bacteria 1285
167 Ga0207642_10005695 3300025899 Bacteria 4084
168 Ga0207710_10060726 3300025900 Bacteria 1714
169 Ga0207688_10226929 3300025901 Bacteria 1127
170 Ga0207680_10025890 3300025903 Bacteria 3242
171 Ga0207699_10579352 3300025906 Bacteria 816
172 Ga0207645_10149146 3300025907 Bacteria 1526
173 Ga0207645_10238625 3300025907 Bacteria 1201
174 Ga0207684_10142232 3300025910 Bacteria 2063
175 Ga0207707_10099744 3300025912 Bacteria 2538
176 Ga0207695_10082960 3300025913 Bacteria 3239
177 Ga0207695_10273794 3300025913 Bacteria 1583
178 Ga0207657_10000779 3300025919 Bacteria 33835
179 Ga0207652_10016687 3300025921 Bacteria 6001
180 Ga0207646_10142461 3300025922 Bacteria 2159
181 Ga0207681_10043082 3300025923 Bacteria 3019
182 Ga0207681_10124096 3300025923 Bacteria 1898
183 Ga0207694_10352467 3300025924 Bacteria 1218
184 Ga0207650_10142447 3300025925 Bacteria 1886
185 Ga0207650_10323388 3300025925 Bacteria 1264
186 Ga0207659_10144189 3300025926 Bacteria 1852
187 Ga0207659_10223676 3300025926 Unclassified 1515
188 Ga0207687_10023246 3300025927 Unclassified 4130
189 Ga0207687_10038020 3300025927 Bacteria 3287
190 Ga0207687_10038272 3300025927 Bacteria 3277
191 Ga0207700_10140331 3300025928 Bacteria 1985
192 Ga0207706_10129313 3300025933 Bacteria 2221
193 Ga0207706_10250188 3300025933 Bacteria 1548
194 Ga0207706_10778968 3300025933 Bacteria 814
195 Ga0207686_10006012 3300025934 Bacteria 6515
196 Ga0207686_10022067 3300025934 Bacteria 3662
197 Ga0207686_10388758 3300025934 Bacteria 1060
198 Ga0207709_10016454 3300025935 Bacteria 4112
199 Ga0207709_10041836 3300025935 Bacteria 2752
200 Ga0207704_10115927 3300025938 Bacteria 1822
201 Ga0207691_10370019 3300025940 Bacteria 1224
202 Ga0207711_10026786 3300025941 Bacteria 4838
203 Ga0207711_10262030 3300025941 Bacteria 1589
204 Ga0207711_10364020 3300025941 Bacteria 1340
205 Ga0207711_10463753 3300025941 Bacteria 1180
206 Ga0207711_10896445 3300025941 Unclassified 824
207 Ga0207689_10053383 3300025942 Bacteria 3330
208 Ga0207689_10174019 3300025942 Bacteria 1775
209 Ga0207661_10593536 3300025944 Unclassified 1016
210 Ga0207679_10044391 3300025945 Bacteria 3207
211 Ga0207667_10130607 3300025949 Bacteria 2587
212 Ga0207651_10008138 3300025960 Bacteria 5641
213 Ga0207651_10162520 3300025960 Bacteria 1752
214 Ga0207712_10110884 3300025961 Bacteria 2058
215 Ga0207712_10274234 3300025961 Bacteria 1374
216 Ga0207668_10285069 3300025972 Bacteria 1356
217 Ga0207640_10013791 3300025981 Bacteria 4640
218 Ga0207658_10588492 3300025986 Bacteria 999
219 Ga0207677_10025662 3300026023 Bacteria 3681
220 Ga0207677_10380950 3300026023 Bacteria 1191
221 Ga0207703_10013711 3300026035 Bacteria 6317
222 Ga0207703_10094884 3300026035 Bacteria 2516
223 Ga0207703_10198534 3300026035 Bacteria 1781
224 Ga0207703_10436674 3300026035 Unclassified 1221
225 Ga0207703_10472308 3300026035 Bacteria 1174
226 Ga0207708_10005444 3300026075 Bacteria 9390
227 Ga0207702_10017677 3300026078 Bacteria 5901
228 Ga0207641_10082726 3300026088 Bacteria 2790
229 Ga0207641_10118536 3300026088 Bacteria 2358
230 Ga0207648_10011824 3300026089 Bacteria 8203
231 Ga0207648_10060833 3300026089 Bacteria 3293
232 Ga0207648_10151653 3300026089 Bacteria 2045
233 Ga0207676_10009941 3300026095 Bacteria 6766
234 Ga0207676_10010449 3300026095 Bacteria 6611
235 Ga0207676_10080690 3300026095 Bacteria 2641
236 Ga0207676_10132613 3300026095 Bacteria 2121
237 Ga0207676_10443556 3300026095 Archaea 1222
238 Ga0207674_10119110 3300026116 Bacteria 2609
239 Ga0207675_100000451 3300026118 Bacteria 39879
240 Ga0207675_100016506 3300026118 Bacteria 6894
241 Ga0207675_100037755 3300026118 Bacteria 4506
242 Ga0207428_10028372 3300027907 Bacteria 4650
243 Ga0207428_10224857 3300027907 Bacteria 1405
244 Ga0268266_10007237 3300028379 Bacteria 10034
245 Ga0268265_10008553 3300028380 Bacteria 6918
246 Ga0268265_10222277 3300028380 Bacteria 1653
247 Ga0268265_10270750 3300028380 Bacteria 1515
248 Ga0268264_10130998 3300028381 Bacteria 2223
249 Ga0268264_10144521 3300028381 Bacteria 2125
250 Ga0268264_10490639 3300028381 Bacteria 1196
251 Ga0268264_10752380 3300028381 Bacteria 971
252 Ga0268264_10966088 3300028381 Unclassified 857
253 Ga0268264_11016452 3300028381 Bacteria 836
254 Ga0307416_100141277 3300032002 Unclassified 2189
255 Ga0307416_100978017 3300032002 Bacteria 949
256 Ga0307415_100128061 3300032126 Unclassified 1917
257 Ga0373932_0093669 3300035112 Bacteria 968
258 Ga0373939_0013444 3300035114 Bacteria 2107
259 Ga0373942_0070825 3300035207 Unclassified 1018
260 Ga0373924_0146251 3300035410 Bacteria 1033
261 Ga0373927_0168675 3300035695 Unclassified 1435
262 Ga0373933_0185524 3300035724 Unclassified 1328
263 Ga0373937_0214745 3300036401 Bacteria 1810
264 Ga0373937_0320788 3300036401 Bacteria 1466
265 Ga0373937_0663683 3300036401 Bacteria 988
266 Ga0373937_0952118 3300036401 Unclassified 807
267 Ga0373925_0400206 3300037068 Bacteria 1120
268 Ga0395899_0413650 3300037312 Bacteria 890
269 Ga0466963_0102635 3300044694 Bacteria 1958
270 Ga0451576_0195620 3300045051 Bacteria 2112
271 Ga0451576_0300939 3300045051 Bacteria 1678
272 Ga0466958_0126944 3300045836 Bacteria 1600
273 Ga0466967_0907733 3300045976 Bacteria 876
274 Ga0495580_0230337 3300046472 Bacteria 1272
275 Ga0495628_0119876 3300046516 Bacteria 2019
276 Ga0495630_0151270 3300046517 Bacteria 1766
277 Ga0495630_0340338 3300046517 Bacteria 1148
278 Ga0495640_0156400 3300046533 Unclassified 1463
279 Ga0495621_0082406 3300046539 Bacteria 1201
280 Ga0495645_0001334 3300046543 Bacteria 16733
281 Ga0495634_0108412 3300046642 Bacteria 1788
282 Ga0495647_0087965 3300046681 Bacteria 1269
283 Ga0495658_0022270 3300046683 Bacteria 3348
284 Ga0495658_0065879 3300046683 Bacteria 2091
285 Ga0495600_0033752 3300046809 Bacteria 3322
286 Ga0495674_0094712 3300047319 Bacteria 2547
287 Ga0495602_0409847 3300048088 Unclassified 965
288 Ga0496101_0799279 3300048904 Bacteria 744
289 Ga0496102_1020632 3300048905 Bacteria 748
290 Ga0496104_0061033 3300048907 Bacteria 3573
291 Ga0496104_0140873 3300048907 Bacteria 2316
292 Ga0496105_0511054 3300048908 Bacteria 942
293 Ga0496107_0221695 3300048910 Bacteria 1407
294 Ga0496108_0132867 3300048911 Bacteria 2139
295 Ga0496108_0216183 3300048911 Bacteria 1665
296 Ga0496109_0400803 3300048912 Bacteria 1296
297 Ga0496110_0200576 3300048913 Bacteria 1813
298 Ga0496111_0245686 3300048914 Bacteria 1329
299 Ga0496111_0352879 3300048914 Bacteria 1089
300 Ga0496112_0030338 3300048915 Bacteria 5232
301 Ga0496112_0068212 3300048915 Bacteria 3512
302 Ga0496112_0300190 3300048915 Bacteria 1551
303 Ga0496113_0033064 3300048916 Bacteria 3763
304 Ga0496114_0085458 3300048917 Bacteria 2672
305 Ga0496114_0179920 3300048917 Bacteria 1846
306 Ga0496115_0175834 3300048918 Bacteria 1770
307 Ga0501031_0122501 3300049568 Bacteria 1698
308 Ga0501032_0063884 3300049569 Bacteria 2464
309 Ga0501034_0032220 3300049571 Bacteria 5324
310 Ga0501034_0039317 3300049571 Bacteria 4791
311 Ga0501043_0042781 3300049579 Bacteria 3560
312 Ga0501046_0333026 3300049580 Unclassified 1104
313 Ga0501047_0003294 3300049581 Bacteria 15296
314 Ga0501047_0076529 3300049581 Bacteria 3220
315 Ga0501069_0246044 3300049585 Bacteria 1043
316 Ga0501073_0149846 3300049589 Bacteria 1616
317 Ga0501080_0385930 3300049742 Unclassified 1261
318 Ga0501083_0144754 3300049744 Bacteria 1556
319 Ga0501044_0001109 3300049823 Bacteria 32036
320 Ga0501044_0215392 3300049823 Bacteria 1873
321 nmdc:mga05p37_125867_c1 3300050507 Bacteria 3147
322 nmdc:mga05p37_152743_c1 3300050507 Bacteria 2823
323 nmdc:mga05p37_200236_c1 3300050507 Bacteria 2419
324 nmdc:mga05p37_24608_c1 3300050507 Bacteria 7319
325 nmdc:mga05p37_47299_c1 3300050507 Bacteria 5291
326 nmdc:mga05p37_512159_c1 3300050507 Bacteria 1374
327 nmdc:mga05p37_52464_c1 3300050507 Bacteria 5014
328 nmdc:mga06r32_72698_c1 3300050510 Bacteria 3329
329 nmdc:mga08y16_103558_c1 3300050511 Bacteria 2963
330 nmdc:mga08y16_258998_c1 3300050511 Bacteria 1797
331 nmdc:mga08y16_306828_c1 3300050511 Unclassified 1635
332 nmdc:mga08y16_34056_c1 3300050511 Bacteria 5350
333 nmdc:mga08y16_8901_c1 3300050511 Bacteria 10540
334 nmdc:mga0n895_111_c1 3300050512 Bacteria 48235
335 nmdc:mga0n895_165568_c1 3300050512 Bacteria 2243
336 nmdc:mga0n895_36571_c1 3300050512 Bacteria 4742
337 nmdc:mga0n895_6455_c1 3300050512 Bacteria 9957
338 nmdc:mga0rr50_149250_c1 3300050513 Bacteria 1887
339 nmdc:mga0rr50_255353_c1 3300050513 Bacteria 1457
340 nmdc:mga0rr50_44238_c1 3300050513 Bacteria 3265
341 nmdc:mga0rr50_45818_c1 3300050513 Bacteria 3217
342 nmdc:mga0rr50_57_c1 3300050513 Bacteria 67718
343 nmdc:mga0rr50_90039_c1 3300050513 Bacteria 2387
344 nmdc:mga08x19_146843_c1 3300050514 Bacteria 1595
345 nmdc:mga08x19_328076_c1 3300050514 Bacteria 1066
346 nmdc:mga08x19_426_c1 3300050514 Bacteria 28960
347 nmdc:mga08x19_516681_c1 3300050514 Bacteria 844
348 nmdc:mga0a205_250111_c2 3300050515 Bacteria 1164
349 nmdc:mga0a205_84800_c1 3300050515 Unclassified 3060
350 Ga0495601_0216260 3300053077 Bacteria 1252
351 Ga0495619_0062502 3300053085 Bacteria 2479
352 Ga0495619_0142080 3300053085 Bacteria 1654
353 Ga0495619_0285091 3300053085 Bacteria 1144
354 Ga0501082_0234633 3300060353 Bacteria 1596
355 Ga0373925_0625576
356 Ga0065704_10204731
357 Ga0065712_10077689
358 Ga0065715_10113987
359 Ga0070658_10034818
360 Ga0070683_100077436
361 Ga0070690_100063597
362 Ga0070670_100387910
363 Ga0070689_100404472
364 Ga0070661_100010982
365 Ga0070668_100651322
366 Ga0070669_100058612
367 Ga0070669_100085210
368 Ga0070675_100030106
369 Ga0070675_100133652
370 Ga0070709_10106144
371 Ga0070709_10240839
372 Ga0070714_100001083
373 Ga0070701_10001654
374 Ga0070700_100036906
375 Ga0070700_100318634
376 Ga0070708_100017168
377 Ga0070662_100104242
378 Ga0070681_10025553
379 Ga0070681_10181521
380 Ga0070681_10225078
381 Ga0068867_100014892
382 Ga0068867_100050010
383 Ga0070685_10174921
384 Ga0070706_100431779
385 Ga0070706_100589862
386 Ga0070707_100463769
387 Ga0070698_100061895
388 Ga0070698_100201862
389 Ga0070698_100294426
390 Ga0070699_100021600
391 Ga0070684_100040030
392 Ga0070697_100424968
393 Ga0068853_100235602
394 Ga0070686_100038777
395 Ga0070686_100427392
396 Ga0070695_100005595
397 Ga0070696_100003693
398 Ga0070696_100067661
399 Ga0070693_100055571
400 Ga0070665_100031055
401 Ga0070704_100032966
402 Ga0070704_100841199
403 Ga0068855_100017318
404 Ga0070664_100071286
405 Ga0068857_100342591
406 Ga0068857_100441566
407 Ga0068856_100021485
408 Ga0068856_100104459
409 Ga0070702_100017778
410 Ga0068859_100028916
411 Ga0068859_100031429
412 Ga0068859_100075393
413 Ga0068859_101261470
414 Ga0068864_100037523
415 Ga0068864_100129743
416 Ga0068866_10019778
417 Ga0068861_100010459
418 Ga0068861_100243861
419 Ga0068861_100416349
420 Ga0068851_10123379
421 Ga0068863_100059276
422 Ga0068863_100060272
423 Ga0068858_100003439
424 Ga0068858_100012089
425 Ga0068858_100032643
426 Ga0068858_100207239
427 Ga0068858_100418211
428 Ga0068860_100087217
429 Ga0068860_100621425
430 Ga0068862_100039725
431 Ga0068862_100088214
432 Ga0068862_100275138
433 Ga0068862_100309039
434 Ga0097621_100000820
435 Ga0097621_100029899
436 Ga0068871_100000748
437 Ga0068871_100014691
438 Ga0068871_100124803
439 Ga0075428_100098115
440 Ga0075428_100217608
441 Ga0075431_100244180
442 Ga0075433_10173049
443 Ga0075433_10451006
444 Ga0075434_100000100
445 Ga0075434_100024505
446 Ga0075434_100208640
447 Ga0075429_100502282
448 Ga0075436_100000583
449 Ga0075436_100026588
450 Ga0075436_100102426
451 Ga0075436_100349207
452 Ga0097620_100028917
453 Ga0097620_100031429
454 Ga0097620_100075392
455 Ga0097620_101261283
456 Ga0075435_100000192
457 Ga0075435_100003636
458 Ga0075435_100109164
459 Ga0075435_100187488
460 Ga0075435_100190808
461 Ga0075435_100264124
462 Ga0105240_10064661
463 Ga0105240_10182128
464 Ga0105240_10557369
465 Ga0111539_10002576
466 Ga0111539_10003965
467 Ga0111539_10012733
468 Ga0111539_10222846
469 Ga0105245_10020103
470 Ga0105245_10119698
471 Ga0105245_10439523
472 Ga0105245_10696176
473 Ga0105247_10004860
474 Ga0105247_10006654
475 Ga0105247_10024870
476 Ga0114129_10013888
477 Ga0114129_10014154
478 Ga0114129_10025515
479 Ga0114129_10048658
480 Ga0114129_10049148
481 Ga0114129_10361559
482 Ga0114129_10387379
483 Ga0114129_11142096
484 Ga0114129_11164208
485 Ga0105243_10006011
486 Ga0105243_10040643
487 Ga0105241_10424072
488 Ga0105242_10014046
489 Ga0105248_10001706
490 Ga0105248_10099950
491 Ga0105248_10831988
492 Ga0105237_10114351
493 Ga0105237_10882958
494 Ga0105238_10494903
495 Ga0105238_10600039
496 Ga0105249_10225039
497 Ga0105249_10226767
498 Ga0105249_10662886
499 Ga0105249_10917142
500 Ga0105249_10950487
501 Ga0105246_10262701
502 Ga0157369_10344959
503 Ga0157374_10046922
504 Ga0157374_10056854
505 Ga0157378_10258182
506 Ga0163162_10082770
507 Ga0157372_10242589
508 Ga0163163_10027079
509 Ga0157380_10085531
510 Ga0157379_10003996
511 Ga0157379_10017728
512 Ga0157379_10058674
513 Ga0157379_10124208
514 Ga0157376_10003823
515 Ga0157376_10017013
516 Ga0157376_10019382
517 Ga0157376_10036176
518 Ga0157376_11043851
519 Ga0163161_10207198
520 Ga0163161_10290252
521 Ga0207642_10005695
522 Ga0207710_10060726
523 Ga0207688_10226929
524 Ga0207680_10025890
525 Ga0207699_10579352
526 Ga0207645_10149146
527 Ga0207645_10238625
528 Ga0207684_10142232
529 Ga0207707_10099744
530 Ga0207695_10082960
531 Ga0207695_10273794
532 Ga0207657_10000779
533 Ga0207652_10016687
534 Ga0207646_10142461
535 Ga0207681_10043082
536 Ga0207681_10124096
537 Ga0207694_10352467
538 Ga0207650_10142447
539 Ga0207650_10323388
540 Ga0207659_10144189
541 Ga0207659_10223676
542 Ga0207687_10023246
543 Ga0207687_10038020
544 Ga0207687_10038272
545 Ga0207700_10140331
546 Ga0207706_10129313
547 Ga0207706_10250188
548 Ga0207706_10778968
549 Ga0207686_10006012
550 Ga0207686_10022067
551 Ga0207686_10388758
552 Ga0207709_10016454
553 Ga0207709_10041836
554 Ga0207704_10115927
555 Ga0207691_10370019
556 Ga0207711_10026786
557 Ga0207711_10262030
558 Ga0207711_10364020
559 Ga0207711_10463753
560 Ga0207711_10896445
561 Ga0207689_10053383
562 Ga0207689_10174019
563 Ga0207661_10593536
564 Ga0207679_10044391
565 Ga0207667_10130607
566 Ga0207651_10008138
567 Ga0207651_10162520
568 Ga0207712_10110884
569 Ga0207712_10274234
570 Ga0207668_10285069
571 Ga0207640_10013791
572 Ga0207658_10588492
573 Ga0207677_10025662
574 Ga0207677_10380950
575 Ga0207703_10013711
576 Ga0207703_10094884
577 Ga0207703_10198534
578 Ga0207703_10436674
579 Ga0207703_10472308
580 Ga0207708_10005444
581 Ga0207702_10017677
582 Ga0207641_10082726
583 Ga0207641_10118536
584 Ga0207648_10011824
585 Ga0207648_10060833
586 Ga0207648_10151653
587 Ga0207676_10009941
588 Ga0207676_10010449
589 Ga0207676_10080690
590 Ga0207676_10132613
591 Ga0207676_10443556
592 Ga0207674_10119110
593 Ga0207675_100000451
594 Ga0207675_100016506
595 Ga0207675_100037755
596 Ga0207428_10028372
597 Ga0207428_10224857
598 Ga0268266_10007237
599 Ga0268265_10008553
600 Ga0268265_10222277
601 Ga0268265_10270750
602 Ga0268264_10130998
603 Ga0268264_10144521
604 Ga0268264_10490639
605 Ga0268264_10752380
606 Ga0268264_10966088
607 Ga0268264_11016452
608 Ga0307416_100141277
609 Ga0307416_100978017
610 Ga0307415_100128061
611 Ga0373932_0093669
612 Ga0373939_0013444
613 Ga0373942_0070825
614 Ga0373924_0146251
615 Ga0373927_0168675
616 Ga0373933_0185524
617 Ga0373937_0214745
618 Ga0373937_0320788
619 Ga0373937_0663683
620 Ga0373937_0952118
621 Ga0373925_0400206
622 Ga0395899_0413650
623 Ga0466963_0102635
624 Ga0451576_0195620
625 Ga0451576_0300939
626 Ga0466958_0126944
627 Ga0466967_0907733
628 Ga0495580_0230337
629 Ga0495628_0119876
630 Ga0495630_0151270
631 Ga0495630_0340338
632 Ga0495640_0156400
633 Ga0495621_0082406
634 Ga0495645_0001334
635 Ga0495634_0108412
636 Ga0495647_0087965
637 Ga0495658_0022270
638 Ga0495658_0065879
639 Ga0495600_0033752
640 Ga0495674_0094712
641 Ga0495602_0409847
642 Ga0496101_0799279
643 Ga0496102_1020632
644 Ga0496104_0061033
645 Ga0496104_0140873
646 Ga0496105_0511054
647 Ga0496107_0221695
648 Ga0496108_0132867
649 Ga0496108_0216183
650 Ga0496109_0400803
651 Ga0496110_0200576
652 Ga0496111_0245686
653 Ga0496111_0352879
654 Ga0496112_0030338
655 Ga0496112_0068212
656 Ga0496112_0300190
657 Ga0496113_0033064
658 Ga0496114_0085458
659 Ga0496114_0179920
660 Ga0496115_0175834
661 Ga0501031_0122501
662 Ga0501032_0063884
663 Ga0501034_0032220
664 Ga0501034_0039317
665 Ga0501043_0042781
666 Ga0501046_0333026
667 Ga0501047_0003294
668 Ga0501047_0076529
669 Ga0501069_0246044
670 Ga0501073_0149846
671 Ga0501080_0385930
672 Ga0501083_0144754
673 Ga0501044_0001109
674 Ga0501044_0215392
675 nmdc:mga05p37_125867_c1
676 nmdc:mga05p37_152743_c1
677 nmdc:mga05p37_200236_c1
678 nmdc:mga05p37_24608_c1
679 nmdc:mga05p37_47299_c1
680 nmdc:mga05p37_512159_c1
681 nmdc:mga05p37_52464_c1
682 nmdc:mga06r32_72698_c1
683 nmdc:mga08y16_103558_c1
684 nmdc:mga08y16_258998_c1
685 nmdc:mga08y16_306828_c1
686 nmdc:mga08y16_34056_c1
687 nmdc:mga08y16_8901_c1
688 nmdc:mga0n895_111_c1
689 nmdc:mga0n895_165568_c1
690 nmdc:mga0n895_36571_c1
691 nmdc:mga0n895_6455_c1
692 nmdc:mga0rr50_149250_c1
693 nmdc:mga0rr50_255353_c1
694 nmdc:mga0rr50_44238_c1
695 nmdc:mga0rr50_45818_c1
696 nmdc:mga0rr50_57_c1
697 nmdc:mga0rr50_90039_c1
698 nmdc:mga08x19_146843_c1
699 nmdc:mga08x19_328076_c1
700 nmdc:mga08x19_426_c1
701 nmdc:mga08x19_516681_c1
702 nmdc:mga0a205_250111_c2
703 nmdc:mga0a205_84800_c1
704 Ga0495601_0216260
705 Ga0495619_0062502
706 Ga0495619_0142080
707 Ga0495619_0285091
708 Ga0501082_0234633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

71

216

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b21-assembly1.cif.gz_A unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2 0.8976 20 221
2h56-assembly2.cif.gz_B crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution 0.882 26 219
3s6i-assembly1.cif.gz_A schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna. 0.8752 25 223
4b21-assembly1.cif.gz_A unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2 0.8735 20 221
3s6i-assembly1.cif.gz_A schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna. 0.8444 25 223
ID Description Score Start End Superfamily
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9596 59 168 1.10.340.30
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9349 59 168 1.10.340.30
af_Q92383_49_162_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9248 59 168 1.10.340.30
2yg8A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9165 54 162 1.10.340.30
2h56B02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9062 54 165 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A2V8DRZ9-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.986 32 221 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A842Q5L8-F1-model_v4 DNA-3-methyladenine glycosylase 2 family protein 0.9723 26 219 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A1J3CXP9-F1-model_v4 DNA-3-methyladenine glycosylase 1 0.971 65 221 GO:0005634
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A3L7V3Z4-F1-model_v4 deleted 0.9708 23 220
AF-A0A2V8DRZ9-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9707 32 221 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916

Map