F419781
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 354 | 230 | 329 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300025297|Ga0209758_1021235|Ga0209758_10212352 |
| Length | 271 |
| Sequence | VTTPRAASSPSSASRLGLAFGLLSGALLALAPQAASAQGRLDAQYEATLAGIPVGKGAWTIEIGDDTFAASAQGGTAGLLKAFSGGSGSGASVGRVVGSETIRMSLANGNVKEFSFDPVPPVDPDRIPVLEAHRKGVLDPMTGSMLRVAGNGELLSPDSCRTGTGVFDGRLRYDLKLDYKRMEMVKAERGYHGPALVCAIYFTPVAGYIPDRPVIKYLAAERRIEIAFVPIAGTRILVPFRMSIPTPLGLAMLEATSFVTSAAPPRVAKTN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 3 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 4 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 5 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 6 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 7 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 8 | 2791355199 | |||
| 9 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 10 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 11 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 12 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 13 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 14 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 15 | 2906610324 | |||
| 16 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 17 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 18 | 2922425934 | |||
| 19 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 20 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 21 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 22 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 23 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 27 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 28 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 122 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 123 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 127 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 129 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 132 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 133 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 134 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 135 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 136 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 137 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 138 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 140 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 141 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 143 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 145 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 146 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 147 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 151 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 154 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 155 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 156 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 159 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 201 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 202 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 203 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 206 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 207 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 208 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 209 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 210 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 211 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 212 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 213 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 214 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 215 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 222 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 223 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 224 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 225 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 226 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 227 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 228 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 229 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 230 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.73 |
| Metatranscriptomes | 0 |
| Isolates | 6.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.52 |
| Nodule | 6.21 |
| Rhizoplane | 8.47 |
| Rhizosphere | 75.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002093 | 3300001979 | Bacteria | 9125 |
| 2 | JGI24739J22299_10007291 | 3300001989 | Bacteria | 4155 |
| 3 | JGI24737J22298_10003234 | 3300001990 | Bacteria | 5779 |
| 4 | JGI25153J46596_10003308 | 3300003215 | Bacteria | 9059 |
| 5 | rootH1_10061607 | 3300003323 | Bacteria | 1696 |
| 6 | Ga0070689_100002201 | 3300005340 | Bacteria | 12643 |
| 7 | Ga0070668_100053698 | 3300005347 | Bacteria | 3107 |
| 8 | Ga0070671_100101933 | 3300005355 | Bacteria | 2408 |
| 9 | Ga0070674_100116578 | 3300005356 | Bacteria | 1970 |
| 10 | Ga0070674_100205347 | 3300005356 | Bacteria | 1524 |
| 11 | Ga0070688_100239073 | 3300005365 | Viruses | 1288 |
| 12 | Ga0070667_100170744 | 3300005367 | Bacteria | 1920 |
| 13 | Ga0070667_100289790 | 3300005367 | Bacteria | 1472 |
| 14 | Ga0070709_10051686 | 3300005434 | Bacteria | 2580 |
| 15 | Ga0070714_100020830 | 3300005435 | Bacteria | 5359 |
| 16 | Ga0070714_100212866 | 3300005435 | Bacteria | 1772 |
| 17 | Ga0070714_100382018 | 3300005435 | Bacteria | 1328 |
| 18 | Ga0070713_100008303 | 3300005436 | Bacteria | 7364 |
| 19 | Ga0070713_100073018 | 3300005436 | Bacteria | 2904 |
| 20 | Ga0070713_100210845 | 3300005436 | Bacteria | 1758 |
| 21 | Ga0070710_10019490 | 3300005437 | Bacteria | 3505 |
| 22 | Ga0070710_10149847 | 3300005437 | Bacteria | 1438 |
| 23 | Ga0070711_100024689 | 3300005439 | Bacteria | 3925 |
| 24 | Ga0070711_100040086 | 3300005439 | Bacteria | 3157 |
| 25 | Ga0070700_100147368 | 3300005441 | Bacteria | 1606 |
| 26 | Ga0070678_100241466 | 3300005456 | Bacteria | 1511 |
| 27 | Ga0070681_10077962 | 3300005458 | Bacteria | 3270 |
| 28 | Ga0070681_10281968 | 3300005458 | Bacteria | 1572 |
| 29 | Ga0068867_100107016 | 3300005459 | Bacteria | 2143 |
| 30 | Ga0070679_100267070 | 3300005530 | Bacteria | 1666 |
| 31 | Ga0068853_100009176 | 3300005539 | Bacteria | 7968 |
| 32 | Ga0068853_100174264 | 3300005539 | Bacteria | 1948 |
| 33 | Ga0068853_100325519 | 3300005539 | Bacteria | 1425 |
| 34 | Ga0070665_100019635 | 3300005548 | Bacteria | 6782 |
| 35 | Ga0068855_100034950 | 3300005563 | Bacteria | 5989 |
| 36 | Ga0068855_100045602 | 3300005563 | Bacteria | 5185 |
| 37 | Ga0068855_100154745 | 3300005563 | Bacteria | 2605 |
| 38 | Ga0068855_100262918 | 3300005563 | Bacteria | 1921 |
| 39 | Ga0068857_100025539 | 3300005577 | Bacteria | 5201 |
| 40 | Ga0068857_100029534 | 3300005577 | Bacteria | 4838 |
| 41 | Ga0068854_100031348 | 3300005578 | Bacteria | 3694 |
| 42 | Ga0068854_100034023 | 3300005578 | Bacteria | 3557 |
| 43 | Ga0068854_100234590 | 3300005578 | Bacteria | 1458 |
| 44 | Ga0068856_100007580 | 3300005614 | Bacteria | 10590 |
| 45 | Ga0068856_100079394 | 3300005614 | Bacteria | 3254 |
| 46 | Ga0068856_100147029 | 3300005614 | Bacteria | 2364 |
| 47 | Ga0068852_100009383 | 3300005616 | Bacteria | 7266 |
| 48 | Ga0068852_100042060 | 3300005616 | Bacteria | 3867 |
| 49 | Ga0068852_100273229 | 3300005616 | Bacteria | 1627 |
| 50 | Ga0068859_100146461 | 3300005617 | Bacteria | 2437 |
| 51 | Ga0068866_10168790 | 3300005718 | Viruses | 1283 |
| 52 | Ga0068851_10003386 | 3300005834 | Bacteria | 7094 |
| 53 | Ga0068863_100235975 | 3300005841 | Bacteria | 1765 |
| 54 | Ga0068858_100276740 | 3300005842 | Unclassified | 1598 |
| 55 | Ga0068860_100219591 | 3300005843 | Bacteria | 1846 |
| 56 | Ga0068862_100650281 | 3300005844 | Viruses | 1017 |
| 57 | Ga0081540_1004792 | 3300005983 | Bacteria | 10198 |
| 58 | Ga0081540_1031472 | 3300005983 | Bacteria | 2916 |
| 59 | Ga0081539_10000129 | 3300005985 | Bacteria | 178675 |
| 60 | Ga0075364_10206570 | 3300006051 | Bacteria | 1332 |
| 61 | Ga0070716_100065335 | 3300006173 | Bacteria | 2118 |
| 62 | Ga0070716_100170808 | 3300006173 | Bacteria | 1418 |
| 63 | Ga0070712_100177584 | 3300006175 | Bacteria | 1657 |
| 64 | Ga0097621_100296627 | 3300006237 | Bacteria | 1427 |
| 65 | Ga0075370_10121401 | 3300006353 | Bacteria | 1521 |
| 66 | Ga0075434_100045020 | 3300006871 | Bacteria | 4377 |
| 67 | Ga0097620_100146466 | 3300006931 | Bacteria | 2437 |
| 68 | Ga0099822_1006293 | 3300006943 | Bacteria | 15490 |
| 69 | Ga0105240_10006010 | 3300009093 | Bacteria | 17947 |
| 70 | Ga0105240_10007471 | 3300009093 | Bacteria | 15866 |
| 71 | Ga0105240_10272953 | 3300009093 | Bacteria | 1946 |
| 72 | Ga0105241_10001634 | 3300009174 | Bacteria | 17089 |
| 73 | Ga0105248_10030839 | 3300009177 | Bacteria | 5990 |
| 74 | Ga0105248_10173144 | 3300009177 | Bacteria | 2433 |
| 75 | Ga0105248_10310704 | 3300009177 | Bacteria | 1775 |
| 76 | Ga0105237_10149766 | 3300009545 | Bacteria | 2329 |
| 77 | Ga0105237_10157612 | 3300009545 | Bacteria | 2267 |
| 78 | Ga0105237_10420543 | 3300009545 | Bacteria | 1342 |
| 79 | Ga0105238_10002664 | 3300009551 | Bacteria | 17754 |
| 80 | Ga0105238_10020931 | 3300009551 | Bacteria | 6663 |
| 81 | Ga0105238_10187939 | 3300009551 | Bacteria | 2042 |
| 82 | Ga0105238_10352548 | 3300009551 | Bacteria | 1461 |
| 83 | Ga0105249_10226870 | 3300009553 | Bacteria | 1841 |
| 84 | Ga0105239_10013167 | 3300010375 | Bacteria | 9190 |
| 85 | Ga0105239_10026772 | 3300010375 | Bacteria | 6346 |
| 86 | Ga0105239_10373383 | 3300010375 | Bacteria | 1612 |
| 87 | Ga0157370_10094139 | 3300013104 | Bacteria | 2811 |
| 88 | Ga0157370_10113979 | 3300013104 | Bacteria | 2526 |
| 89 | Ga0157369_10076101 | 3300013105 | Bacteria | 3598 |
| 90 | Ga0163162_10168946 | 3300013306 | Bacteria | 2311 |
| 91 | Ga0157372_10324763 | 3300013307 | Bacteria | 1792 |
| 92 | Ga0157375_10280689 | 3300013308 | Bacteria | 1828 |
| 93 | Ga0163163_10188624 | 3300014325 | Bacteria | 2110 |
| 94 | Ga0163163_10203786 | 3300014325 | Bacteria | 2027 |
| 95 | Ga0157379_10026455 | 3300014968 | Bacteria | 5165 |
| 96 | Ga0157379_10372278 | 3300014968 | Unclassified | 1310 |
| 97 | Ga0157376_10468649 | 3300014969 | Bacteria | 1232 |
| 98 | Ga0209758_1001222 | 3300025297 | Bacteria | 32186 |
| 99 | Ga0209758_1021235 | 3300025297 | Bacteria | 3035 |
| 100 | Ga0207656_10000685 | 3300025321 | Bacteria | 11094 |
| 101 | Ga0207692_10017420 | 3300025898 | Bacteria | 3204 |
| 102 | Ga0207642_10041211 | 3300025899 | Bacteria | 2020 |
| 103 | Ga0207647_10000749 | 3300025904 | Bacteria | 25445 |
| 104 | Ga0207685_10014818 | 3300025905 | Bacteria | 2451 |
| 105 | Ga0207699_10273602 | 3300025906 | Bacteria | 1171 |
| 106 | Ga0207645_10075590 | 3300025907 | Bacteria | 2156 |
| 107 | Ga0207654_10000073 | 3300025911 | Bacteria | 66148 |
| 108 | Ga0207707_10242856 | 3300025912 | Bacteria | 1565 |
| 109 | Ga0207695_10000366 | 3300025913 | Bacteria | 103345 |
| 110 | Ga0207695_10028375 | 3300025913 | Bacteria | 6209 |
| 111 | Ga0207671_10095369 | 3300025914 | Bacteria | 2246 |
| 112 | Ga0207693_10004841 | 3300025915 | Bacteria | 11329 |
| 113 | Ga0207693_10119160 | 3300025915 | Bacteria | 2073 |
| 114 | Ga0207663_10022320 | 3300025916 | Bacteria | 3616 |
| 115 | Ga0207660_10349019 | 3300025917 | Bacteria | 1186 |
| 116 | Ga0207649_10080762 | 3300025920 | Bacteria | 2104 |
| 117 | Ga0207652_10134677 | 3300025921 | Bacteria | 2206 |
| 118 | Ga0207681_10004826 | 3300025923 | Bacteria | 8284 |
| 119 | Ga0207694_10000139 | 3300025924 | Bacteria | 74561 |
| 120 | Ga0207694_10033707 | 3300025924 | Bacteria | 3923 |
| 121 | Ga0207644_10107780 | 3300025931 | Bacteria | 2102 |
| 122 | Ga0207670_10043654 | 3300025936 | Bacteria | 2962 |
| 123 | Ga0207669_10048611 | 3300025937 | Bacteria | 2521 |
| 124 | Ga0207704_10219863 | 3300025938 | Bacteria | 1405 |
| 125 | Ga0207665_10004430 | 3300025939 | Bacteria | 9329 |
| 126 | Ga0207665_10084912 | 3300025939 | Bacteria | 2185 |
| 127 | Ga0207711_10041830 | 3300025941 | Bacteria | 3903 |
| 128 | Ga0207711_10537730 | 3300025941 | Bacteria | 1090 |
| 129 | Ga0207667_10015597 | 3300025949 | Bacteria | 8620 |
| 130 | Ga0207667_10026231 | 3300025949 | Bacteria | 6368 |
| 131 | Ga0207667_10314574 | 3300025949 | Bacteria | 1599 |
| 132 | Ga0207667_10443223 | 3300025949 | Bacteria | 1320 |
| 133 | Ga0207640_10009130 | 3300025981 | Bacteria | 5538 |
| 134 | Ga0207640_10027881 | 3300025981 | Bacteria | 3446 |
| 135 | Ga0207658_10215162 | 3300025986 | Bacteria | 1613 |
| 136 | Ga0207703_10163157 | 3300026035 | Bacteria | 1953 |
| 137 | Ga0207703_10228942 | 3300026035 | Bacteria | 1666 |
| 138 | Ga0207639_10001776 | 3300026041 | Bacteria | 14520 |
| 139 | Ga0207639_10010041 | 3300026041 | Bacteria | 6547 |
| 140 | Ga0207639_10486586 | 3300026041 | Bacteria | 1125 |
| 141 | Ga0207678_10055968 | 3300026067 | Bacteria | 3397 |
| 142 | Ga0207702_10000491 | 3300026078 | Bacteria | 44501 |
| 143 | Ga0207702_10014883 | 3300026078 | Bacteria | 6453 |
| 144 | Ga0207641_10119775 | 3300026088 | Bacteria | 2347 |
| 145 | Ga0207676_10030569 | 3300026095 | Bacteria | 4044 |
| 146 | Ga0207674_10012447 | 3300026116 | Bacteria | 9507 |
| 147 | Ga0207674_10012615 | 3300026116 | Bacteria | 9445 |
| 148 | Ga0207675_100095580 | 3300026118 | Bacteria | 2796 |
| 149 | Ga0207675_100492818 | 3300026118 | Bacteria | 1219 |
| 150 | Ga0207698_10002187 | 3300026142 | Bacteria | 11577 |
| 151 | Ga0207698_10118752 | 3300026142 | Bacteria | 2234 |
| 152 | Ga0207698_10183258 | 3300026142 | Bacteria | 1857 |
| 153 | Ga0209589_1001702 | 3300027357 | Bacteria | 36938 |
| 154 | Ga0209489_102545 | 3300027361 | Bacteria | 36938 |
| 155 | Ga0209700_102508 | 3300027363 | Bacteria | 36938 |
| 156 | Ga0268266_10065448 | 3300028379 | Bacteria | 3142 |
| 157 | Ga0268266_10521312 | 3300028379 | Bacteria | 1136 |
| 158 | Ga0268265_10390700 | 3300028380 | Bacteria | 1283 |
| 159 | Ga0307517_10002031 | 3300028786 | Bacteria | 32949 |
| 160 | Ga0265332_10019853 | 3300031238 | Bacteria | 2966 |
| 161 | Ga0265340_10003861 | 3300031247 | Bacteria | 8440 |
| 162 | Ga0265339_10021130 | 3300031249 | Bacteria | 3793 |
| 163 | Ga0265314_10205616 | 3300031711 | Bacteria | 1160 |
| 164 | Ga0265342_10000139 | 3300031712 | Bacteria | 81785 |
| 165 | Ga0315911_1000042 | 3300033442 | Bacteria | 49262 |
| 166 | Ga0373930_0031544 | 3300034816 | Viruses | 1093 |
| 167 | Ga0373926_0020871 | 3300035083 | Bacteria | 2265 |
| 168 | Ga0373934_0042454 | 3300035086 | Bacteria | 1796 |
| 169 | Ga0373940_0048264 | 3300035088 | Bacteria | 1189 |
| 170 | Ga0373951_0010402 | 3300035091 | Bacteria | 2088 |
| 171 | Ga0373923_0000994 | 3300035111 | Bacteria | 7669 |
| 172 | Ga0373936_0000131 | 3300035113 | Bacteria | 25984 |
| 173 | Ga0373936_0194698 | 3300035113 | Bacteria | 893 |
| 174 | Ga0373939_0005892 | 3300035114 | Bacteria | 2933 |
| 175 | Ga0373945_0002931 | 3300035116 | Bacteria | 5359 |
| 176 | Ga0373953_0051323 | 3300035117 | Bacteria | 1667 |
| 177 | Ga0373954_0002536 | 3300035118 | Bacteria | 7662 |
| 178 | Ga0373956_0002019 | 3300035119 | Bacteria | 8409 |
| 179 | Ga0373957_0003320 | 3300035120 | Bacteria | 4742 |
| 180 | Ga0373960_0037910 | 3300035121 | Bacteria | 1379 |
| 181 | Ga0373943_0005070 | 3300035170 | Bacteria | 5939 |
| 182 | Ga0373943_0015656 | 3300035170 | Bacteria | 3449 |
| 183 | Ga0373946_0137782 | 3300035171 | Bacteria | 1128 |
| 184 | Ga0373955_0002890 | 3300035172 | Bacteria | 7532 |
| 185 | Ga0373955_0021120 | 3300035172 | Bacteria | 3281 |
| 186 | Ga0373924_0002153 | 3300035410 | Bacteria | 6590 |
| 187 | Ga0373924_0011790 | 3300035410 | Bacteria | 3252 |
| 188 | Ga0373931_0000511 | 3300035691 | Bacteria | 15892 |
| 189 | Ga0373931_0046420 | 3300035691 | Bacteria | 2296 |
| 190 | Ga0373935_0000482 | 3300035692 | Bacteria | 20681 |
| 191 | Ga0373927_0017006 | 3300035695 | Bacteria | 4792 |
| 192 | Ga0373927_0018350 | 3300035695 | Bacteria | 4598 |
| 193 | Ga0373927_0062317 | 3300035695 | Bacteria | 2412 |
| 194 | Ga0373933_0017835 | 3300035724 | Bacteria | 3985 |
| 195 | Ga0373933_0054519 | 3300035724 | Bacteria | 2396 |
| 196 | Ga0373947_0003527 | 3300035725 | Bacteria | 9244 |
| 197 | Ga0373937_0000005 | 3300036401 | Bacteria | 199965 |
| 198 | Ga0373937_0048805 | 3300036401 | Bacteria | 3876 |
| 199 | Ga0373937_0094344 | 3300036401 | Bacteria | 2774 |
| 200 | Ga0373925_0000007 | 3300037068 | Bacteria | 257023 |
| 201 | Ga0373925_0275859 | 3300037068 | Bacteria | 1353 |
| 202 | Ga0436364_1030114 | 3300037853 | Bacteria | 1598 |
| 203 | Ga0436365_0690350 | 3300039437 | Bacteria | 2764 |
| 204 | Ga0466967_0076891 | 3300045976 | Bacteria | 3003 |
| 205 | Ga0495592_0000241 | 3300046454 | Bacteria | 46812 |
| 206 | Ga0495592_0055952 | 3300046454 | Bacteria | 2916 |
| 207 | Ga0495629_0002565 | 3300046459 | Bacteria | 13924 |
| 208 | Ga0495629_0019034 | 3300046459 | Bacteria | 4910 |
| 209 | Ga0495651_0010131 | 3300046462 | Bacteria | 7240 |
| 210 | Ga0495651_0043072 | 3300046462 | Bacteria | 3503 |
| 211 | Ga0495653_0000034 | 3300046463 | Bacteria | 131084 |
| 212 | Ga0495653_0032634 | 3300046463 | Bacteria | 4132 |
| 213 | Ga0495662_0004119 | 3300046476 | Bacteria | 7325 |
| 214 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 215 | Ga0495608_0000131 | 3300046511 | Bacteria | 53612 |
| 216 | Ga0495608_0006700 | 3300046511 | Bacteria | 8165 |
| 217 | Ga0495618_0009398 | 3300046514 | Bacteria | 5902 |
| 218 | Ga0495618_0147611 | 3300046514 | Bacteria | 1503 |
| 219 | Ga0495618_0237662 | 3300046514 | Bacteria | 1146 |
| 220 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 221 | Ga0495628_0022338 | 3300046516 | Bacteria | 5197 |
| 222 | Ga0495628_0068135 | 3300046516 | Bacteria | 2777 |
| 223 | Ga0495630_0008375 | 3300046517 | Bacteria | 7420 |
| 224 | Ga0495652_0000006 | 3300046529 | Bacteria | 459709 |
| 225 | Ga0495652_0019375 | 3300046529 | Bacteria | 6061 |
| 226 | Ga0495652_0176696 | 3300046529 | Bacteria | 1643 |
| 227 | Ga0495665_0009431 | 3300046531 | Bacteria | 5283 |
| 228 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 229 | Ga0495640_0009283 | 3300046533 | Bacteria | 7665 |
| 230 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 231 | Ga0495645_0000009 | 3300046543 | Bacteria | 239632 |
| 232 | Ga0495645_0002559 | 3300046543 | Bacteria | 12352 |
| 233 | Ga0495667_0000021 | 3300046559 | Bacteria | 180625 |
| 234 | Ga0495667_0013692 | 3300046559 | Bacteria | 5480 |
| 235 | Ga0495667_0019663 | 3300046559 | Bacteria | 4556 |
| 236 | Ga0495634_0001506 | 3300046642 | Bacteria | 20620 |
| 237 | Ga0495634_0055645 | 3300046642 | Bacteria | 2645 |
| 238 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 239 | Ga0495635_0003584 | 3300046663 | Bacteria | 10744 |
| 240 | Ga0495661_0190605 | 3300046665 | Bacteria | 1080 |
| 241 | Ga0495657_0000088 | 3300046675 | Bacteria | 81307 |
| 242 | Ga0495657_0008868 | 3300046675 | Bacteria | 7655 |
| 243 | Ga0495599_0000025 | 3300046678 | Bacteria | 120337 |
| 244 | Ga0495599_0002056 | 3300046678 | Bacteria | 11665 |
| 245 | Ga0495623_0000018 | 3300046679 | Bacteria | 107338 |
| 246 | Ga0495623_0053535 | 3300046679 | Bacteria | 2547 |
| 247 | Ga0495623_0228162 | 3300046679 | Bacteria | 1058 |
| 248 | Ga0495646_0000003 | 3300046680 | Bacteria | 287773 |
| 249 | Ga0495646_0029394 | 3300046680 | Bacteria | 3435 |
| 250 | Ga0495647_0065721 | 3300046681 | Bacteria | 1441 |
| 251 | Ga0495658_0080106 | 3300046683 | Bacteria | 1915 |
| 252 | Ga0495624_0043351 | 3300046690 | Bacteria | 2871 |
| 253 | Ga0495600_0000025 | 3300046809 | Bacteria | 92167 |
| 254 | Ga0495600_0003865 | 3300046809 | Bacteria | 8888 |
| 255 | Ga0495581_0077154 | 3300047315 | Bacteria | 1928 |
| 256 | Ga0495604_0000008 | 3300047317 | Bacteria | 341160 |
| 257 | Ga0495604_0016767 | 3300047317 | Bacteria | 5860 |
| 258 | Ga0495674_0000028 | 3300047319 | Bacteria | 124722 |
| 259 | Ga0495674_0037665 | 3300047319 | Bacteria | 4346 |
| 260 | Ga0495680_0002089 | 3300047322 | Bacteria | 20750 |
| 261 | Ga0495680_0004771 | 3300047322 | Bacteria | 12870 |
| 262 | Ga0495675_0000045 | 3300047444 | Bacteria | 82813 |
| 263 | Ga0495675_0060228 | 3300047444 | Bacteria | 2406 |
| 264 | Ga0495684_0000002 | 3300047471 | Bacteria | 341216 |
| 265 | Ga0495684_0000701 | 3300047471 | Bacteria | 26925 |
| 266 | Ga0495593_0008651 | 3300047673 | Bacteria | 5918 |
| 267 | Ga0495593_0009630 | 3300047673 | Bacteria | 5608 |
| 268 | Ga0495602_0000022 | 3300048088 | Bacteria | 163672 |
| 269 | Ga0495602_0031131 | 3300048088 | Bacteria | 5048 |
| 270 | Ga0495602_0044496 | 3300048088 | Bacteria | 4026 |
| 271 | Ga0495602_0161035 | 3300048088 | Bacteria | 1752 |
| 272 | Ga0496101_0177775 | 3300048904 | Bacteria | 1638 |
| 273 | Ga0496102_0201608 | 3300048905 | Bacteria | 1876 |
| 274 | Ga0496102_0208998 | 3300048905 | Bacteria | 1840 |
| 275 | Ga0496102_0334745 | 3300048905 | Bacteria | 1426 |
| 276 | Ga0496103_0014359 | 3300048906 | Bacteria | 4705 |
| 277 | Ga0496104_0120119 | 3300048907 | Bacteria | 2523 |
| 278 | Ga0496104_0266398 | 3300048907 | Bacteria | 1626 |
| 279 | Ga0496104_0304745 | 3300048907 | Bacteria | 1505 |
| 280 | Ga0496104_0377602 | 3300048907 | Bacteria | 1330 |
| 281 | Ga0496105_0001797 | 3300048908 | Bacteria | 15330 |
| 282 | Ga0496106_0039671 | 3300048909 | Bacteria | 3526 |
| 283 | Ga0496106_0259889 | 3300048909 | Bacteria | 1389 |
| 284 | Ga0496107_0001223 | 3300048910 | Bacteria | 15659 |
| 285 | Ga0496107_0010724 | 3300048910 | Bacteria | 6374 |
| 286 | Ga0496107_0190407 | 3300048910 | Bacteria | 1524 |
| 287 | Ga0496108_0001270 | 3300048911 | Bacteria | 19743 |
| 288 | Ga0496108_0026382 | 3300048911 | Bacteria | 4792 |
| 289 | Ga0496109_0008952 | 3300048912 | Bacteria | 8527 |
| 290 | Ga0496110_0008410 | 3300048913 | Bacteria | 8302 |
| 291 | Ga0496110_0180806 | 3300048913 | Bacteria | 1915 |
| 292 | Ga0496111_0155616 | 3300048914 | Bacteria | 1696 |
| 293 | Ga0496111_0215588 | 3300048914 | Bacteria | 1426 |
| 294 | Ga0496111_0223673 | 3300048914 | Viruses | 1398 |
| 295 | Ga0496112_0001047 | 3300048915 | Bacteria | 20382 |
| 296 | Ga0496112_0021077 | 3300048915 | Bacteria | 6191 |
| 297 | Ga0496114_0029669 | 3300048917 | Bacteria | 4497 |
| 298 | Ga0496114_0189941 | 3300048917 | Bacteria | 1797 |
| 299 | Ga0496115_0022624 | 3300048918 | Bacteria | 4873 |
| 300 | Ga0496115_0251364 | 3300048918 | Bacteria | 1455 |
| 301 | Ga0496121_0006192 | 3300048924 | Bacteria | 14999 |
| 302 | Ga0496125_0006588 | 3300048928 | Bacteria | 12507 |
| 303 | Ga0496126_0007979 | 3300048929 | Bacteria | 11498 |
| 304 | Ga0496126_0022419 | 3300048929 | Bacteria | 6147 |
| 305 | Ga0496126_0124393 | 3300048929 | Bacteria | 2233 |
| 306 | Ga0496126_0154151 | 3300048929 | Bacteria | 1967 |
| 307 | Ga0496126_0186001 | 3300048929 | Bacteria | 1762 |
| 308 | Ga0496126_0321241 | 3300048929 | Bacteria | 1272 |
| 309 | nmdc:mga0yw44_77310_c1 | 3300050492 | Bacteria | 2079 |
| 310 | nmdc:mga07m45_142762_c1 | 3300050496 | Bacteria | 1387 |
| 311 | nmdc:mga08y16_181940_c1 | 3300050511 | Bacteria | 2182 |
| 312 | nmdc:mga0n895_262222_c1 | 3300050512 | Bacteria | 1753 |
| 313 | nmdc:mga0n895_57513_c1 | 3300050512 | Bacteria | 3833 |
| 314 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 315 | Ga0495612_0000003 | 3300053078 | Bacteria | 303629 |
| 316 | Ga0495612_0044383 | 3300053078 | Bacteria | 1819 |
| 317 | Ga0495595_0021113 | 3300053084 | Bacteria | 2841 |
| 318 | Ga0495619_0000004 | 3300053085 | Bacteria | 500068 |
| 319 | Ga0495619_0002102 | 3300053085 | Bacteria | 13212 |
| 320 | Ga0495619_0154455 | 3300053085 | Bacteria | 1583 |
| 321 | Ga0500651_0027444 | 3300053093 | Bacteria | 3580 |
| 322 | Ga0500650_0150357 | 3300053098 | Bacteria | 1077 |
| 323 | Ga0500554_014943 | 3300053102 | Bacteria | 2015 |
| 324 | Ga0500595_000945 | 3300053119 | Bacteria | 16377 |
| 325 | Ga0500595_001412 | 3300053119 | Bacteria | 12893 |
| 326 | Ga0500642_0023096 | 3300053130 | Bacteria | 2491 |
| 327 | Ga0500638_022573 | 3300053162 | Bacteria | 2983 |
| 328 | Ga0500637_0000114 | 3300053178 | Bacteria | 29267 |
| 329 | Ga0500661_001047 | 3300055283 | Bacteria | 5220 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005539 | Ga0068853_100325519 | Ga0068853_1003255191 | 261 |
| 2 | 3300010375 | Ga0105239_10373383 | Ga0105239_103733831 | 262 |
| 3 | 3300036401 | Ga0373937_0048805 | Ga0373937_0048805_850_1650 | 263 |
| 4 | 3300005458 | Ga0070681_10077962 | Ga0070681_100779622 | 264 |
| 5 | 3300009093 | Ga0105240_10007471 | Ga0105240_1000747110 | 264 |
| 6 | 3300031238 | Ga0265332_10019853 | Ga0265332_100198532 | 264 |
| 7 | 3300031247 | Ga0265340_10003861 | Ga0265340_100038612 | 264 |
| 8 | 3300031249 | Ga0265339_10021130 | Ga0265339_100211301 | 264 |
| 9 | 3300031711 | Ga0265314_10205616 | Ga0265314_102056162 | 264 |
| 10 | 3300031712 | Ga0265342_10000139 | Ga0265342_1000013926 | 264 |
| 11 | 3300035111 | Ga0373923_0000994 | Ga0373923_0000994_2428_3237 | 264 |
| 12 | 3300035113 | Ga0373936_0000131 | Ga0373936_0000131_23994_24803 | 264 |
| 13 | 3300035116 | Ga0373945_0002931 | Ga0373945_0002931_3268_4077 | 264 |
| 14 | 3300035170 | Ga0373943_0005070 | Ga0373943_0005070_4189_4998 | 264 |
| 15 | 3300035171 | Ga0373946_0137782 | Ga0373946_0137782_25_834 | 264 |
| 16 | 3300035172 | Ga0373955_0021120 | Ga0373955_0021120_2256_3065 | 264 |
| 17 | 3300035410 | Ga0373924_0002153 | Ga0373924_0002153_4476_5285 | 264 |
| 18 | 3300035692 | Ga0373935_0000482 | Ga0373935_0000482_2837_3646 | 264 |
| 19 | 3300035695 | Ga0373927_0017006 | Ga0373927_0017006_1100_1909 | 264 |
| 20 | 3300035724 | Ga0373933_0054519 | Ga0373933_0054519_651_1460 | 264 |
| 21 | 3300035725 | Ga0373947_0003527 | Ga0373947_0003527_6090_6899 | 264 |
| 22 | 3300036401 | Ga0373937_0000005 | Ga0373937_0000005_63878_64687 | 264 |
| 23 | 3300037068 | Ga0373925_0000007 | Ga0373925_0000007_135506_136315 | 264 |
| 24 | 3300046454 | Ga0495592_0000241 | Ga0495592_0000241_25739_26548 | 264 |
| 25 | 3300046459 | Ga0495629_0019034 | Ga0495629_0019034_1258_2067 | 264 |
| 26 | 3300046462 | Ga0495651_0010131 | Ga0495651_0010131_3643_4452 | 264 |
| 27 | 3300046463 | Ga0495653_0000034 | Ga0495653_0000034_120749_121558 | 264 |
| 28 | 3300046476 | Ga0495662_0004119 | Ga0495662_0004119_2896_3705 | 264 |
| 29 | 3300046477 | Ga0495664_0000003 | Ga0495664_0000003_423246_424055 | 264 |
| 30 | 3300046511 | Ga0495608_0000131 | Ga0495608_0000131_41958_42767 | 264 |
| 31 | 3300046514 | Ga0495618_0009398 | Ga0495618_0009398_3767_4576 | 264 |
| 32 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_912647_913456 | 264 |
| 33 | 3300046517 | Ga0495630_0008375 | Ga0495630_0008375_6223_7032 | 264 |
| 34 | 3300046529 | Ga0495652_0000006 | Ga0495652_0000006_180719_181528 | 264 |
| 35 | 3300046533 | Ga0495640_0000002 | Ga0495640_0000002_367460_368269 | 264 |
| 36 | 3300046536 | Ga0495587_0000001 | Ga0495587_0000001_439916_440725 | 264 |
| 37 | 3300046543 | Ga0495645_0000009 | Ga0495645_0000009_41959_42768 | 264 |
| 38 | 3300046559 | Ga0495667_0000021 | Ga0495667_0000021_44393_45202 | 264 |
| 39 | 3300046642 | Ga0495634_0001506 | Ga0495634_0001506_17248_18057 | 264 |
| 40 | 3300046663 | Ga0495635_0000001 | Ga0495635_0000001_425727_426536 | 264 |
| 41 | 3300046675 | Ga0495657_0000088 | Ga0495657_0000088_76686_77495 | 264 |
| 42 | 3300046678 | Ga0495599_0000025 | Ga0495599_0000025_40194_41003 | 264 |
| 43 | 3300046679 | Ga0495623_0000018 | Ga0495623_0000018_31435_32244 | 264 |
| 44 | 3300046680 | Ga0495646_0000003 | Ga0495646_0000003_3715_4524 | 264 |
| 45 | 3300046681 | Ga0495647_0065721 | Ga0495647_0065721_237_1046 | 264 |
| 46 | 3300046683 | Ga0495658_0080106 | Ga0495658_0080106_235_1044 | 264 |
| 47 | 3300046690 | Ga0495624_0043351 | Ga0495624_0043351_2011_2820 | 264 |
| 48 | 3300046809 | Ga0495600_0000025 | Ga0495600_0000025_86833_87642 | 264 |
| 49 | 3300047315 | Ga0495581_0077154 | Ga0495581_0077154_546_1424 | 264 |
| 50 | 3300047317 | Ga0495604_0000008 | Ga0495604_0000008_79309_80118 | 264 |
| 51 | 3300047319 | Ga0495674_0000028 | Ga0495674_0000028_44521_45330 | 264 |
| 52 | 3300047322 | Ga0495680_0002089 | Ga0495680_0002089_10667_11476 | 264 |
| 53 | 3300047444 | Ga0495675_0000045 | Ga0495675_0000045_7180_7989 | 264 |
| 54 | 3300047471 | Ga0495684_0000002 | Ga0495684_0000002_79367_80176 | 264 |
| 55 | 3300047673 | Ga0495593_0009630 | Ga0495593_0009630_276_1085 | 264 |
| 56 | 3300048088 | Ga0495602_0000022 | Ga0495602_0000022_41972_42781 | 264 |
| 57 | 3300053077 | Ga0495601_0000001 | Ga0495601_0000001_118867_119676 | 264 |
| 58 | 3300053078 | Ga0495612_0000003 | Ga0495612_0000003_223429_224238 | 264 |
| 59 | 3300053085 | Ga0495619_0000004 | Ga0495619_0000004_118898_119707 | 264 |
| 60 | 3300003215 | JGI25153J46596_10003308 | JGI25153J46596_100033085 | 265 |
| 61 | 3300025297 | Ga0209758_1021235 | Ga0209758_10212352 | 265 |
| 62 | 3300033442 | Ga0315911_1000042 | Ga0315911_100004235 | 265 |
| 63 | 3300048907 | Ga0496104_0304745 | Ga0496104_0304745_402_1202 | 266 |
| 64 | 3300025921 | Ga0207652_10134677 | Ga0207652_101346773 | 267 |
| 65 | 3300026035 | Ga0207703_10163157 | Ga0207703_101631572 | 268 |
| 66 | 3300048905 | Ga0496102_0201608 | Ga0496102_0201608_101_907 | 268 |
| 67 | 3300048907 | Ga0496104_0120119 | Ga0496104_0120119_709_1515 | 268 |
| 68 | 3300048909 | Ga0496106_0039671 | Ga0496106_0039671_29_835 | 268 |
| 69 | 3300048910 | Ga0496107_0001223 | Ga0496107_0001223_11292_12098 | 268 |
| 70 | 3300048911 | Ga0496108_0001270 | Ga0496108_0001270_18608_19414 | 268 |
| 71 | 3300048914 | Ga0496111_0215588 | Ga0496111_0215588_339_1145 | 268 |
| 72 | 3300048915 | Ga0496112_0001047 | Ga0496112_0001047_13387_14193 | 268 |
| 73 | 3300035086 | Ga0373934_0042454 | Ga0373934_0042454_82_915 | 269 |
| 74 | 3300035117 | Ga0373953_0051323 | Ga0373953_0051323_417_1250 | 269 |
| 75 | 3300035118 | Ga0373954_0002536 | Ga0373954_0002536_2850_3683 | 269 |
| 76 | 3300035119 | Ga0373956_0002019 | Ga0373956_0002019_1158_1991 | 269 |
| 77 | 3300035120 | Ga0373957_0003320 | Ga0373957_0003320_2821_3654 | 269 |
| 78 | 3300035172 | Ga0373955_0002890 | Ga0373955_0002890_2725_3558 | 269 |
| 79 | 3300035410 | Ga0373924_0011790 | Ga0373924_0011790_598_1431 | 269 |
| 80 | 3300035724 | Ga0373933_0017835 | Ga0373933_0017835_1098_1931 | 269 |
| 81 | 3300036401 | Ga0373937_0094344 | Ga0373937_0094344_41_874 | 269 |
| 82 | 3300037853 | Ga0436364_1030114 | Ga0436364_1030114_640_1449 | 269 |
| 83 | 3300039437 | Ga0436365_0690350 | Ga0436365_0690350_1778_2587 | 269 |
| 84 | 3300046454 | Ga0495592_0055952 | Ga0495592_0055952_416_1249 | 269 |
| 85 | 3300046459 | Ga0495629_0002565 | Ga0495629_0002565_11229_12062 | 269 |
| 86 | 3300046462 | Ga0495651_0043072 | Ga0495651_0043072_1865_2698 | 269 |
| 87 | 3300046463 | Ga0495653_0032634 | Ga0495653_0032634_191_1024 | 269 |
| 88 | 3300046511 | Ga0495608_0006700 | Ga0495608_0006700_1953_2786 | 269 |
| 89 | 3300046514 | Ga0495618_0237662 | Ga0495618_0237662_268_1101 | 269 |
| 90 | 3300046516 | Ga0495628_0022338 | Ga0495628_0022338_882_1715 | 269 |
| 91 | 3300046529 | Ga0495652_0019375 | Ga0495652_0019375_1246_2079 | 269 |
| 92 | 3300046533 | Ga0495640_0009283 | Ga0495640_0009283_3219_4052 | 269 |
| 93 | 3300046543 | Ga0495645_0002559 | Ga0495645_0002559_11230_12063 | 269 |
| 94 | 3300046559 | Ga0495667_0013692 | Ga0495667_0013692_1827_2660 | 269 |
| 95 | 3300046642 | Ga0495634_0055645 | Ga0495634_0055645_1780_2613 | 269 |
| 96 | 3300046663 | Ga0495635_0003584 | Ga0495635_0003584_5937_6770 | 269 |
| 97 | 3300046675 | Ga0495657_0008868 | Ga0495657_0008868_2820_3653 | 269 |
| 98 | 3300046678 | Ga0495599_0002056 | Ga0495599_0002056_8153_8986 | 269 |
| 99 | 3300046679 | Ga0495623_0053535 | Ga0495623_0053535_887_1720 | 269 |
| 100 | 3300046679 | Ga0495623_0228162 | Ga0495623_0228162_233_1042 | 269 |
| 101 | 3300046680 | Ga0495646_0029394 | Ga0495646_0029394_834_1667 | 269 |
| 102 | 3300046809 | Ga0495600_0003865 | Ga0495600_0003865_4053_4886 | 269 |
| 103 | 3300047317 | Ga0495604_0016767 | Ga0495604_0016767_3483_4316 | 269 |
| 104 | 3300047319 | Ga0495674_0037665 | Ga0495674_0037665_652_1485 | 269 |
| 105 | 3300047322 | Ga0495680_0004771 | Ga0495680_0004771_8239_9072 | 269 |
| 106 | 3300047444 | Ga0495675_0060228 | Ga0495675_0060228_1384_2217 | 269 |
| 107 | 3300047471 | Ga0495684_0000701 | Ga0495684_0000701_3799_4632 | 269 |
| 108 | 3300047673 | Ga0495593_0008651 | Ga0495593_0008651_4302_5135 | 269 |
| 109 | 3300048088 | Ga0495602_0031131 | Ga0495602_0031131_2832_3665 | 269 |
| 110 | 3300048904 | Ga0496101_0177775 | Ga0496101_0177775_505_1422 | 269 |
| 111 | 3300048907 | Ga0496104_0266398 | Ga0496104_0266398_294_1211 | 269 |
| 112 | 3300053084 | Ga0495595_0021113 | Ga0495595_0021113_1947_2780 | 269 |
| 113 | 3300053085 | Ga0495619_0002102 | Ga0495619_0002102_8377_9210 | 269 |
| 114 | iso_pu_bacteria | 2513237098 | 2513673960 | 269 |
| 115 | 3300025939 | Ga0207665_10084912 | Ga0207665_100849122 | 270 |
| 116 | 3300053119 | Ga0500595_001412 | Ga0500595_001412_6482_7375 | 270 |
| 117 | 3300035113 | Ga0373936_0194698 | Ga0373936_0194698_45_860 | 271 |
| 118 | 3300050512 | nmdc:mga0n895_57513_c1 | nmdc:mga0n895_57513_c1_2846_3679 | 271 |
| 119 | 3300009545 | Ga0105237_10149766 | Ga0105237_101497662 | 272 |
| 120 | 3300013105 | Ga0157369_10076101 | Ga0157369_100761012 | 272 |
| 121 | 3300013307 | Ga0157372_10324763 | Ga0157372_103247632 | 272 |
| 122 | 3300025913 | Ga0207695_10028375 | Ga0207695_100283756 | 272 |
| 123 | 3300048905 | Ga0496102_0334745 | Ga0496102_0334745_62_895 | 272 |
| 124 | 3300048918 | Ga0496115_0022624 | Ga0496115_0022624_1718_2548 | 272 |
| 125 | 3300005985 | Ga0081539_10000129 | Ga0081539_1000012933 | 273 |
| 126 | 3300048929 | Ga0496126_0007979 | Ga0496126_0007979_6501_7322 | 273 |
| 127 | 3300026041 | Ga0207639_10486586 | Ga0207639_104865862 | 274 |
| 128 | 3300006871 | Ga0075434_100045020 | Ga0075434_1000450206 | 275 |
| 129 | 3300013104 | Ga0157370_10113979 | Ga0157370_101139792 | 275 |
| 130 | 3300025917 | Ga0207660_10349019 | Ga0207660_103490191 | 275 |
| 131 | 3300005367 | Ga0070667_100170744 | Ga0070667_1001707442 | 276 |
| 132 | 3300005441 | Ga0070700_100147368 | Ga0070700_1001473681 | 276 |
| 133 | 3300005458 | Ga0070681_10281968 | Ga0070681_102819681 | 276 |
| 134 | 3300005578 | Ga0068854_100234590 | Ga0068854_1002345901 | 276 |
| 135 | 3300005617 | Ga0068859_100146461 | Ga0068859_1001464612 | 276 |
| 136 | 3300005841 | Ga0068863_100235975 | Ga0068863_1002359751 | 276 |
| 137 | 3300005842 | Ga0068858_100276740 | Ga0068858_1002767401 | 276 |
| 138 | 3300005843 | Ga0068860_100219591 | Ga0068860_1002195913 | 276 |
| 139 | 3300005844 | Ga0068862_100650281 | Ga0068862_1006502811 | 276 |
| 140 | 3300006931 | Ga0097620_100146466 | Ga0097620_1001464662 | 276 |
| 141 | 3300025899 | Ga0207642_10041211 | Ga0207642_100412111 | 276 |
| 142 | 3300025907 | Ga0207645_10075590 | Ga0207645_100755902 | 276 |
| 143 | 3300025923 | Ga0207681_10004826 | Ga0207681_100048265 | 276 |
| 144 | 3300025931 | Ga0207644_10107780 | Ga0207644_101077802 | 276 |
| 145 | 3300025936 | Ga0207670_10043654 | Ga0207670_100436541 | 276 |
| 146 | 3300025937 | Ga0207669_10048611 | Ga0207669_100486113 | 276 |
| 147 | 3300025938 | Ga0207704_10219863 | Ga0207704_102198632 | 276 |
| 148 | 3300025941 | Ga0207711_10041830 | Ga0207711_100418302 | 276 |
| 149 | 3300025986 | Ga0207658_10215162 | Ga0207658_102151623 | 276 |
| 150 | 3300026088 | Ga0207641_10119775 | Ga0207641_101197752 | 276 |
| 151 | 3300026118 | Ga0207675_100095580 | Ga0207675_1000955803 | 276 |
| 152 | 3300028380 | Ga0268265_10390700 | Ga0268265_103907001 | 276 |
| 153 | iso_pu_bacteria | 2513237137 | 2513860668 | 276 |
| 154 | iso_pu_bacteria | 2517572143 | 2517888398 | 276 |
| 155 | iso_pu_bacteria | 2524023210 | 2524468411 | 276 |
| 156 | iso_pu_bacteria | 2667528175 | 2671124221 | 276 |
| 157 | iso_pu_bacteria | 2728368998 | 2728752095 | 276 |
| 158 | iso_pu_bacteria | 2791355197 | 2793067213 | 276 |
| 159 | iso_pu_bacteria | 2885383462 | 2885392010 | 276 |
| 160 | iso_pu_bacteria | 2903748898 | 2903753267 | 276 |
| 161 | iso_pu_bacteria | 2903768456 | 2903777094 | 276 |
| 162 | iso_pu_bacteria | 2904690495 | 2904692285 | 276 |
| 163 | iso_pu_bacteria | 2906610324 | 2906614243 | 276 |
| 164 | iso_pu_bacteria | 2908739725 | 2908746928 | 276 |
| 165 | iso_pu_bacteria | 2908756301 | 2908758908 | 276 |
| 166 | iso_pu_bacteria | 2922425934 | 2922426068 | 276 |
| 167 | iso_pu_bacteria | 2935630451 | 2935632482 | 276 |
| 168 | iso_pu_bacteria | 2941507105 | 2941508855 | 276 |
| 169 | iso_pu_bacteria | 2941515067 | 2941516684 | 276 |
| 170 | iso_pu_bacteria | 2941523033 | 2941524299 | 276 |
| 171 | iso_pu_bacteria | 3005474847 | 3005483472 | 276 |
| 172 | iso_pu_bacteria | 8019565922 | 8019571997 | 276 |
| 173 | 3300005340 | Ga0070689_100002201 | Ga0070689_1000022019 | 277 |
| 174 | 3300005347 | Ga0070668_100053698 | Ga0070668_1000536983 | 277 |
| 175 | 3300005355 | Ga0070671_100101933 | Ga0070671_1001019332 | 277 |
| 176 | 3300005356 | Ga0070674_100116578 | Ga0070674_1001165782 | 277 |
| 177 | 3300005365 | Ga0070688_100239073 | Ga0070688_1002390731 | 277 |
| 178 | 3300005459 | Ga0068867_100107016 | Ga0068867_1001070163 | 277 |
| 179 | 3300005718 | Ga0068866_10168790 | Ga0068866_101687901 | 277 |
| 180 | 3300009177 | Ga0105248_10030839 | Ga0105248_100308394 | 277 |
| 181 | 3300009177 | Ga0105248_10173144 | Ga0105248_101731442 | 277 |
| 182 | 3300009177 | Ga0105248_10310704 | Ga0105248_103107042 | 277 |
| 183 | 3300013306 | Ga0163162_10168946 | Ga0163162_101689463 | 277 |
| 184 | 3300014325 | Ga0163163_10203786 | Ga0163163_102037861 | 277 |
| 185 | 3300014968 | Ga0157379_10026455 | Ga0157379_100264556 | 277 |
| 186 | 3300014968 | Ga0157379_10372278 | Ga0157379_103722781 | 277 |
| 187 | 3300025941 | Ga0207711_10537730 | Ga0207711_105377301 | 277 |
| 188 | 3300026035 | Ga0207703_10228942 | Ga0207703_102289421 | 277 |
| 189 | 3300026095 | Ga0207676_10030569 | Ga0207676_100305691 | 277 |
| 190 | 3300034816 | Ga0373930_0031544 | Ga0373930_0031544_104_958 | 277 |
| 191 | 3300035088 | Ga0373940_0048264 | Ga0373940_0048264_128_982 | 277 |
| 192 | 3300035091 | Ga0373951_0010402 | Ga0373951_0010402_822_1676 | 277 |
| 193 | 3300035114 | Ga0373939_0005892 | Ga0373939_0005892_1974_2828 | 277 |
| 194 | 3300035121 | Ga0373960_0037910 | Ga0373960_0037910_128_982 | 277 |
| 195 | 3300035691 | Ga0373931_0000511 | Ga0373931_0000511_6691_7545 | 277 |
| 196 | 3300035691 | Ga0373931_0046420 | Ga0373931_0046420_1175_2029 | 277 |
| 197 | 3300035695 | Ga0373927_0062317 | Ga0373927_0062317_69_914 | 277 |
| 198 | 3300048906 | Ga0496103_0014359 | Ga0496103_0014359_383_1237 | 277 |
| 199 | 3300048908 | Ga0496105_0001797 | Ga0496105_0001797_7324_8178 | 277 |
| 200 | 3300048910 | Ga0496107_0010724 | Ga0496107_0010724_1401_2255 | 277 |
| 201 | 3300048911 | Ga0496108_0026382 | Ga0496108_0026382_109_963 | 277 |
| 202 | 3300048912 | Ga0496109_0008952 | Ga0496109_0008952_2806_3660 | 277 |
| 203 | 3300048913 | Ga0496110_0008410 | Ga0496110_0008410_7284_8138 | 277 |
| 204 | 3300048913 | Ga0496110_0180806 | Ga0496110_0180806_641_1495 | 277 |
| 205 | 3300048914 | Ga0496111_0223673 | Ga0496111_0223673_146_1000 | 277 |
| 206 | 3300048915 | Ga0496112_0021077 | Ga0496112_0021077_4679_5533 | 277 |
| 207 | 3300048917 | Ga0496114_0029669 | Ga0496114_0029669_2361_3215 | 277 |
| 208 | iso_pu_bacteria | 2791355199 | 2793077133 | 277 |
| 209 | iso_pu_bacteria | 2879110137 | 2879112768 | 277 |
| 210 | iso_pu_bacteria | 8006984368 | 8006992483 | 277 |
| 211 | 3300005367 | Ga0070667_100289790 | Ga0070667_1002897901 | 278 |
| 212 | 3300005456 | Ga0070678_100241466 | Ga0070678_1002414662 | 278 |
| 213 | 3300006237 | Ga0097621_100296627 | Ga0097621_1002966272 | 278 |
| 214 | 3300009545 | Ga0105237_10420543 | Ga0105237_104205431 | 278 |
| 215 | 3300009551 | Ga0105238_10352548 | Ga0105238_103525482 | 278 |
| 216 | 3300013308 | Ga0157375_10280689 | Ga0157375_102806891 | 278 |
| 217 | 3300045976 | Ga0466967_0076891 | Ga0466967_0076891_733_1569 | 278 |
| 218 | 3300046516 | Ga0495628_0068135 | Ga0495628_0068135_1864_2736 | 278 |
| 219 | 3300048088 | Ga0495602_0044496 | Ga0495602_0044496_1116_1988 | 278 |
| 220 | 3300048924 | Ga0496121_0006192 | Ga0496121_0006192_8918_9772 | 278 |
| 221 | 3300053102 | Ga0500554_014943 | Ga0500554_014943_775_1644 | 278 |
| 222 | 3300053119 | Ga0500595_000945 | Ga0500595_000945_9758_10627 | 278 |
| 223 | 3300053162 | Ga0500638_022573 | Ga0500638_022573_350_1219 | 278 |
| 224 | 3300053178 | Ga0500637_0000114 | Ga0500637_0000114_4197_5066 | 278 |
| 225 | 3300055283 | Ga0500661_001047 | Ga0500661_001047_2151_3020 | 278 |
| 226 | 3300005356 | Ga0070674_100205347 | Ga0070674_1002053472 | 279 |
| 227 | 3300005434 | Ga0070709_10051686 | Ga0070709_100516863 | 279 |
| 228 | 3300005435 | Ga0070714_100382018 | Ga0070714_1003820182 | 279 |
| 229 | 3300005436 | Ga0070713_100073018 | Ga0070713_1000730182 | 279 |
| 230 | 3300005439 | Ga0070711_100040086 | Ga0070711_1000400862 | 279 |
| 231 | 3300005563 | Ga0068855_100262918 | Ga0068855_1002629182 | 279 |
| 232 | 3300005614 | Ga0068856_100147029 | Ga0068856_1001470292 | 279 |
| 233 | 3300005616 | Ga0068852_100042060 | Ga0068852_1000420602 | 279 |
| 234 | 3300005983 | Ga0081540_1031472 | Ga0081540_10314722 | 279 |
| 235 | 3300006173 | Ga0070716_100170808 | Ga0070716_1001708081 | 279 |
| 236 | 3300006175 | Ga0070712_100177584 | Ga0070712_1001775842 | 279 |
| 237 | 3300006943 | Ga0099822_1006293 | Ga0099822_10062936 | 279 |
| 238 | 3300025912 | Ga0207707_10242856 | Ga0207707_102428562 | 279 |
| 239 | 3300025915 | Ga0207693_10119160 | Ga0207693_101191601 | 279 |
| 240 | 3300025920 | Ga0207649_10080762 | Ga0207649_100807623 | 279 |
| 241 | 3300025949 | Ga0207667_10443223 | Ga0207667_104432231 | 279 |
| 242 | 3300026142 | Ga0207698_10183258 | Ga0207698_101832584 | 279 |
| 243 | 3300027357 | Ga0209589_1001702 | Ga0209589_100170212 | 279 |
| 244 | 3300027361 | Ga0209489_102545 | Ga0209489_10254512 | 279 |
| 245 | 3300027363 | Ga0209700_102508 | Ga0209700_10250812 | 279 |
| 246 | 3300028786 | Ga0307517_10002031 | Ga0307517_1000203117 | 279 |
| 247 | 3300035083 | Ga0373926_0020871 | Ga0373926_0020871_19_858 | 279 |
| 248 | 3300035170 | Ga0373943_0015656 | Ga0373943_0015656_2589_3428 | 279 |
| 249 | 3300037068 | Ga0373925_0275859 | Ga0373925_0275859_309_1157 | 279 |
| 250 | 3300046514 | Ga0495618_0147611 | Ga0495618_0147611_642_1481 | 279 |
| 251 | 3300046531 | Ga0495665_0009431 | Ga0495665_0009431_32_871 | 279 |
| 252 | 3300048914 | Ga0496111_0155616 | Ga0496111_0155616_252_1103 | 279 |
| 253 | 3300048917 | Ga0496114_0189941 | Ga0496114_0189941_238_1089 | 279 |
| 254 | 3300048929 | Ga0496126_0154151 | Ga0496126_0154151_265_1122 | 279 |
| 255 | 3300053085 | Ga0495619_0154455 | Ga0495619_0154455_171_1058 | 279 |
| 256 | 3300005983 | Ga0081540_1004792 | Ga0081540_10047929 | 280 |
| 257 | 3300046665 | Ga0495661_0190605 | Ga0495661_0190605_86_976 | 280 |
| 258 | 3300048929 | Ga0496126_0022419 | Ga0496126_0022419_3561_4403 | 280 |
| 259 | 3300048929 | Ga0496126_0321241 | Ga0496126_0321241_323_1213 | 280 |
| 260 | 3300050511 | nmdc:mga08y16_181940_c1 | nmdc:mga08y16_181940_c1_592_1443 | 280 |
| 261 | iso_pu_bacteria | 2889033259 | 2889035911 | 280 |
| 262 | 3300003323 | rootH1_10061607 | rootH1_100616072 | 281 |
| 263 | 3300005435 | Ga0070714_100212866 | Ga0070714_1002128662 | 281 |
| 264 | 3300005436 | Ga0070713_100210845 | Ga0070713_1002108452 | 281 |
| 265 | 3300005437 | Ga0070710_10149847 | Ga0070710_101498472 | 281 |
| 266 | 3300005530 | Ga0070679_100267070 | Ga0070679_1002670702 | 281 |
| 267 | 3300005548 | Ga0070665_100019635 | Ga0070665_1000196352 | 281 |
| 268 | 3300005563 | Ga0068855_100154745 | Ga0068855_1001547452 | 281 |
| 269 | 3300006051 | Ga0075364_10206570 | Ga0075364_102065701 | 281 |
| 270 | 3300006353 | Ga0075370_10121401 | Ga0075370_101214012 | 281 |
| 271 | 3300009093 | Ga0105240_10272953 | Ga0105240_102729532 | 281 |
| 272 | 3300013104 | Ga0157370_10094139 | Ga0157370_100941392 | 281 |
| 273 | 3300014325 | Ga0163163_10188624 | Ga0163163_101886242 | 281 |
| 274 | 3300025949 | Ga0207667_10314574 | Ga0207667_103145741 | 281 |
| 275 | 3300026067 | Ga0207678_10055968 | Ga0207678_100559682 | 281 |
| 276 | 3300028379 | Ga0268266_10065448 | Ga0268266_100654482 | 281 |
| 277 | 3300046529 | Ga0495652_0176696 | Ga0495652_0176696_649_1506 | 281 |
| 278 | 3300046559 | Ga0495667_0019663 | Ga0495667_0019663_3361_4218 | 281 |
| 279 | 3300048905 | Ga0496102_0208998 | Ga0496102_0208998_444_1346 | 281 |
| 280 | 3300048907 | Ga0496104_0377602 | Ga0496104_0377602_376_1278 | 281 |
| 281 | 3300048909 | Ga0496106_0259889 | Ga0496106_0259889_447_1349 | 281 |
| 282 | 3300050496 | nmdc:mga07m45_142762_c1 | nmdc:mga07m45_142762_c1_379_1281 | 281 |
| 283 | 3300009551 | Ga0105238_10187939 | Ga0105238_101879391 | 282 |
| 284 | 3300009553 | Ga0105249_10226870 | Ga0105249_102268702 | 282 |
| 285 | 3300014969 | Ga0157376_10468649 | Ga0157376_104686491 | 282 |
| 286 | 3300026118 | Ga0207675_100492818 | Ga0207675_1004928181 | 282 |
| 287 | 3300028379 | Ga0268266_10521312 | Ga0268266_105213121 | 282 |
| 288 | 3300035695 | Ga0373927_0018350 | Ga0373927_0018350_3184_4050 | 282 |
| 289 | 3300050492 | nmdc:mga0yw44_77310_c1 | nmdc:mga0yw44_77310_c1_612_1517 | 282 |
| 290 | 3300050512 | nmdc:mga0n895_262222_c1 | nmdc:mga0n895_262222_c1_752_1657 | 282 |
| 291 | 3300053078 | Ga0495612_0044383 | Ga0495612_0044383_583_1467 | 282 |
| 292 | 3300053093 | Ga0500651_0027444 | Ga0500651_0027444_1919_2803 | 282 |
| 293 | 3300053098 | Ga0500650_0150357 | Ga0500650_0150357_14_1003 | 282 |
| 294 | 3300053130 | Ga0500642_0023096 | Ga0500642_0023096_768_1652 | 282 |
| 295 | 3300025297 | Ga0209758_1001222 | Ga0209758_10012227 | 283 |
| 296 | 3300048088 | Ga0495602_0161035 | Ga0495602_0161035_803_1657 | 283 |
| 297 | 3300005435 | Ga0070714_100020830 | Ga0070714_1000208302 | 284 |
| 298 | 3300005437 | Ga0070710_10019490 | Ga0070710_100194901 | 284 |
| 299 | 3300025898 | Ga0207692_10017420 | Ga0207692_100174201 | 284 |
| 300 | 3300025906 | Ga0207699_10273602 | Ga0207699_102736021 | 284 |
| 301 | 3300025916 | Ga0207663_10022320 | Ga0207663_100223202 | 284 |
| 302 | 3300048910 | Ga0496107_0190407 | Ga0496107_0190407_628_1482 | 284 |
| 303 | 3300048928 | Ga0496125_0006588 | Ga0496125_0006588_9773_10651 | 285 |
| 304 | 3300048929 | Ga0496126_0124393 | Ga0496126_0124393_1056_1934 | 285 |
| 305 | 3300001979 | JGI24740J21852_10002093 | JGI24740J21852_100020938 | 286 |
| 306 | 3300001989 | JGI24739J22299_10007291 | JGI24739J22299_100072913 | 286 |
| 307 | 3300001990 | JGI24737J22298_10003234 | JGI24737J22298_100032343 | 286 |
| 308 | 3300005436 | Ga0070713_100008303 | Ga0070713_1000083031 | 286 |
| 309 | 3300005439 | Ga0070711_100024689 | Ga0070711_1000246891 | 286 |
| 310 | 3300005539 | Ga0068853_100009176 | Ga0068853_1000091762 | 286 |
| 311 | 3300005539 | Ga0068853_100174264 | Ga0068853_1001742643 | 286 |
| 312 | 3300005563 | Ga0068855_100034950 | Ga0068855_1000349504 | 286 |
| 313 | 3300005563 | Ga0068855_100045602 | Ga0068855_1000456022 | 286 |
| 314 | 3300005577 | Ga0068857_100025539 | Ga0068857_1000255391 | 286 |
| 315 | 3300005577 | Ga0068857_100029534 | Ga0068857_1000295343 | 286 |
| 316 | 3300005578 | Ga0068854_100031348 | Ga0068854_1000313482 | 286 |
| 317 | 3300005578 | Ga0068854_100034023 | Ga0068854_1000340235 | 286 |
| 318 | 3300005614 | Ga0068856_100007580 | Ga0068856_1000075805 | 286 |
| 319 | 3300005614 | Ga0068856_100079394 | Ga0068856_1000793942 | 286 |
| 320 | 3300005616 | Ga0068852_100009383 | Ga0068852_1000093832 | 286 |
| 321 | 3300005616 | Ga0068852_100273229 | Ga0068852_1002732292 | 286 |
| 322 | 3300005834 | Ga0068851_10003386 | Ga0068851_100033864 | 286 |
| 323 | 3300006173 | Ga0070716_100065335 | Ga0070716_1000653351 | 286 |
| 324 | 3300009093 | Ga0105240_10006010 | Ga0105240_1000601016 | 286 |
| 325 | 3300009174 | Ga0105241_10001634 | Ga0105241_100016344 | 286 |
| 326 | 3300009545 | Ga0105237_10157612 | Ga0105237_101576123 | 286 |
| 327 | 3300009551 | Ga0105238_10002664 | Ga0105238_100026644 | 286 |
| 328 | 3300009551 | Ga0105238_10020931 | Ga0105238_100209315 | 286 |
| 329 | 3300010375 | Ga0105239_10013167 | Ga0105239_100131675 | 286 |
| 330 | 3300010375 | Ga0105239_10026772 | Ga0105239_100267722 | 286 |
| 331 | 3300025321 | Ga0207656_10000685 | Ga0207656_100006853 | 286 |
| 332 | 3300025904 | Ga0207647_10000749 | Ga0207647_1000074911 | 286 |
| 333 | 3300025905 | Ga0207685_10014818 | Ga0207685_100148182 | 286 |
| 334 | 3300025911 | Ga0207654_10000073 | Ga0207654_1000007310 | 286 |
| 335 | 3300025913 | Ga0207695_10000366 | Ga0207695_1000036647 | 286 |
| 336 | 3300025914 | Ga0207671_10095369 | Ga0207671_100953692 | 286 |
| 337 | 3300025915 | Ga0207693_10004841 | Ga0207693_100048417 | 286 |
| 338 | 3300025924 | Ga0207694_10000139 | Ga0207694_100001395 | 286 |
| 339 | 3300025924 | Ga0207694_10033707 | Ga0207694_100337072 | 286 |
| 340 | 3300025939 | Ga0207665_10004430 | Ga0207665_100044304 | 286 |
| 341 | 3300025949 | Ga0207667_10015597 | Ga0207667_100155975 | 286 |
| 342 | 3300025949 | Ga0207667_10026231 | Ga0207667_100262314 | 286 |
| 343 | 3300025981 | Ga0207640_10009130 | Ga0207640_100091302 | 286 |
| 344 | 3300025981 | Ga0207640_10027881 | Ga0207640_100278813 | 286 |
| 345 | 3300026041 | Ga0207639_10001776 | Ga0207639_100017765 | 286 |
| 346 | 3300026041 | Ga0207639_10010041 | Ga0207639_100100413 | 286 |
| 347 | 3300026078 | Ga0207702_10000491 | Ga0207702_100004919 | 286 |
| 348 | 3300026078 | Ga0207702_10014883 | Ga0207702_100148834 | 286 |
| 349 | 3300026116 | Ga0207674_10012447 | Ga0207674_100124474 | 286 |
| 350 | 3300026116 | Ga0207674_10012615 | Ga0207674_100126155 | 286 |
| 351 | 3300026142 | Ga0207698_10002187 | Ga0207698_100021871 | 286 |
| 352 | 3300026142 | Ga0207698_10118752 | Ga0207698_101187522 | 286 |
| 353 | 3300048918 | Ga0496115_0251364 | Ga0496115_0251364_140_1024 | 286 |
| 354 | 3300048929 | Ga0496126_0186001 | Ga0496126_0186001_721_1617 | 286 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bju-assembly2.cif.gz_C | the structure of atzh: a little known member of the atrazine breakdown pathway | 0.6384 | 43 | 110 |
| 2zxk-assembly1.cif.gz_A | crystal structure of semet-red chlorophyll catabolite reductase | 0.6249 | 44 | 120 |
| 3agb-assembly1.cif.gz_B | f218v mutant of the substrate-free form of red chlorophyll catabolite reductase from arabidopsis thaliana | 0.6049 | 44 | 120 |
| 3f7s-assembly1.cif.gz_A-2 | crystal structure of a ntf2-like protein of unknown function (pp_4556) from pseudomonas putida kt2440 at 2.11 a resolution | 0.5653 | 43 | 101 |
| 6bju-assembly1.cif.gz_A | the structure of atzh: a little known member of the atrazine breakdown pathway | 0.5635 | 43 | 101 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IJC0_48_207_3.40.50.10480 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Brix domain | 0.7439 | 103 | 131 | 3.40.50.10480 |
| af_E7F1M4_1_172_3.30.500.10 | Alpha Beta;2-Layer Sandwich;Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1;MHC class I-like antigen recognition-like | 0.558 | 84 | 132 | 3.30.500.10 |
| 4r80B00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.5168 | 20 | 109 | 3.10.450.630 |
| af_Q9JIL8_3_164_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.501 | 52 | 112 | 3.40.50.300 |
| 3sluA02 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.4965 | 84 | 128 | 3.10.450.350 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A023XUQ5-F1-model_v4 | deleted | 0.9684 | 34 | 286 |
|
| AF-A0A7S7ZMJ8-F1-model_v4 | DUF3108 domain-containing protein | 0.9684 | 32 | 286 |
|
| AF-A0A1I4MLY2-F1-model_v4 | deleted | 0.9684 | 32 | 286 |
|
| AF-A0A7U3E6B1-F1-model_v4 | deleted | 0.9682 | 32 | 277 |
|
| AF-A0A182D0D8-F1-model_v4 | DUF3108 domain-containing protein | 0.966 | 28 | 277 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar