F419781

General Info

Members Datasets Scaffolds Average Seq Length
354 230 329 281

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1021235|Ga0209758_10212352
Length 271
Sequence VTTPRAASSPSSASRLGLAFGLLSGALLALAPQAASAQGRLDAQYEATLAGIPVGKGAWTIEIGDDTFAASAQGGTAGLLKAFSGGSGSGASVGRVVGSETIRMSLANGNVKEFSFDPVPPVDPDRIPVLEAHRKGVLDPMTGSMLRVAGNGELLSPDSCRTGTGVFDGRLRYDLKLDYKRMEMVKAERGYHGPALVCAIYFTPVAGYIPDRPVIKYLAAERRIEIAFVPIAGTRILVPFRMSIPTPLGLAMLEATSFVTSAAPPRVAKTN

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
4 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
5 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
6 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
7 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
8 2791355199
9 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
10 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
11 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
12 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
13 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
14 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
15 2906610324
16 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
17 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
18 2922425934
19 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
20 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
21 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
22 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
23 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
122 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
123 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
133 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
137 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
223 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
224 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
225 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
226 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
227 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
228 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
229 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
230 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.73
Metatranscriptomes 0
Isolates 6.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.52
Nodule 6.21
Rhizoplane 8.47
Rhizosphere 75.42
Stem 0
Stem Tuber 0
Unclassified 5.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002093 3300001979 Bacteria 9125
2 JGI24739J22299_10007291 3300001989 Bacteria 4155
3 JGI24737J22298_10003234 3300001990 Bacteria 5779
4 JGI25153J46596_10003308 3300003215 Bacteria 9059
5 rootH1_10061607 3300003323 Bacteria 1696
6 Ga0070689_100002201 3300005340 Bacteria 12643
7 Ga0070668_100053698 3300005347 Bacteria 3107
8 Ga0070671_100101933 3300005355 Bacteria 2408
9 Ga0070674_100116578 3300005356 Bacteria 1970
10 Ga0070674_100205347 3300005356 Bacteria 1524
11 Ga0070688_100239073 3300005365 Viruses 1288
12 Ga0070667_100170744 3300005367 Bacteria 1920
13 Ga0070667_100289790 3300005367 Bacteria 1472
14 Ga0070709_10051686 3300005434 Bacteria 2580
15 Ga0070714_100020830 3300005435 Bacteria 5359
16 Ga0070714_100212866 3300005435 Bacteria 1772
17 Ga0070714_100382018 3300005435 Bacteria 1328
18 Ga0070713_100008303 3300005436 Bacteria 7364
19 Ga0070713_100073018 3300005436 Bacteria 2904
20 Ga0070713_100210845 3300005436 Bacteria 1758
21 Ga0070710_10019490 3300005437 Bacteria 3505
22 Ga0070710_10149847 3300005437 Bacteria 1438
23 Ga0070711_100024689 3300005439 Bacteria 3925
24 Ga0070711_100040086 3300005439 Bacteria 3157
25 Ga0070700_100147368 3300005441 Bacteria 1606
26 Ga0070678_100241466 3300005456 Bacteria 1511
27 Ga0070681_10077962 3300005458 Bacteria 3270
28 Ga0070681_10281968 3300005458 Bacteria 1572
29 Ga0068867_100107016 3300005459 Bacteria 2143
30 Ga0070679_100267070 3300005530 Bacteria 1666
31 Ga0068853_100009176 3300005539 Bacteria 7968
32 Ga0068853_100174264 3300005539 Bacteria 1948
33 Ga0068853_100325519 3300005539 Bacteria 1425
34 Ga0070665_100019635 3300005548 Bacteria 6782
35 Ga0068855_100034950 3300005563 Bacteria 5989
36 Ga0068855_100045602 3300005563 Bacteria 5185
37 Ga0068855_100154745 3300005563 Bacteria 2605
38 Ga0068855_100262918 3300005563 Bacteria 1921
39 Ga0068857_100025539 3300005577 Bacteria 5201
40 Ga0068857_100029534 3300005577 Bacteria 4838
41 Ga0068854_100031348 3300005578 Bacteria 3694
42 Ga0068854_100034023 3300005578 Bacteria 3557
43 Ga0068854_100234590 3300005578 Bacteria 1458
44 Ga0068856_100007580 3300005614 Bacteria 10590
45 Ga0068856_100079394 3300005614 Bacteria 3254
46 Ga0068856_100147029 3300005614 Bacteria 2364
47 Ga0068852_100009383 3300005616 Bacteria 7266
48 Ga0068852_100042060 3300005616 Bacteria 3867
49 Ga0068852_100273229 3300005616 Bacteria 1627
50 Ga0068859_100146461 3300005617 Bacteria 2437
51 Ga0068866_10168790 3300005718 Viruses 1283
52 Ga0068851_10003386 3300005834 Bacteria 7094
53 Ga0068863_100235975 3300005841 Bacteria 1765
54 Ga0068858_100276740 3300005842 Unclassified 1598
55 Ga0068860_100219591 3300005843 Bacteria 1846
56 Ga0068862_100650281 3300005844 Viruses 1017
57 Ga0081540_1004792 3300005983 Bacteria 10198
58 Ga0081540_1031472 3300005983 Bacteria 2916
59 Ga0081539_10000129 3300005985 Bacteria 178675
60 Ga0075364_10206570 3300006051 Bacteria 1332
61 Ga0070716_100065335 3300006173 Bacteria 2118
62 Ga0070716_100170808 3300006173 Bacteria 1418
63 Ga0070712_100177584 3300006175 Bacteria 1657
64 Ga0097621_100296627 3300006237 Bacteria 1427
65 Ga0075370_10121401 3300006353 Bacteria 1521
66 Ga0075434_100045020 3300006871 Bacteria 4377
67 Ga0097620_100146466 3300006931 Bacteria 2437
68 Ga0099822_1006293 3300006943 Bacteria 15490
69 Ga0105240_10006010 3300009093 Bacteria 17947
70 Ga0105240_10007471 3300009093 Bacteria 15866
71 Ga0105240_10272953 3300009093 Bacteria 1946
72 Ga0105241_10001634 3300009174 Bacteria 17089
73 Ga0105248_10030839 3300009177 Bacteria 5990
74 Ga0105248_10173144 3300009177 Bacteria 2433
75 Ga0105248_10310704 3300009177 Bacteria 1775
76 Ga0105237_10149766 3300009545 Bacteria 2329
77 Ga0105237_10157612 3300009545 Bacteria 2267
78 Ga0105237_10420543 3300009545 Bacteria 1342
79 Ga0105238_10002664 3300009551 Bacteria 17754
80 Ga0105238_10020931 3300009551 Bacteria 6663
81 Ga0105238_10187939 3300009551 Bacteria 2042
82 Ga0105238_10352548 3300009551 Bacteria 1461
83 Ga0105249_10226870 3300009553 Bacteria 1841
84 Ga0105239_10013167 3300010375 Bacteria 9190
85 Ga0105239_10026772 3300010375 Bacteria 6346
86 Ga0105239_10373383 3300010375 Bacteria 1612
87 Ga0157370_10094139 3300013104 Bacteria 2811
88 Ga0157370_10113979 3300013104 Bacteria 2526
89 Ga0157369_10076101 3300013105 Bacteria 3598
90 Ga0163162_10168946 3300013306 Bacteria 2311
91 Ga0157372_10324763 3300013307 Bacteria 1792
92 Ga0157375_10280689 3300013308 Bacteria 1828
93 Ga0163163_10188624 3300014325 Bacteria 2110
94 Ga0163163_10203786 3300014325 Bacteria 2027
95 Ga0157379_10026455 3300014968 Bacteria 5165
96 Ga0157379_10372278 3300014968 Unclassified 1310
97 Ga0157376_10468649 3300014969 Bacteria 1232
98 Ga0209758_1001222 3300025297 Bacteria 32186
99 Ga0209758_1021235 3300025297 Bacteria 3035
100 Ga0207656_10000685 3300025321 Bacteria 11094
101 Ga0207692_10017420 3300025898 Bacteria 3204
102 Ga0207642_10041211 3300025899 Bacteria 2020
103 Ga0207647_10000749 3300025904 Bacteria 25445
104 Ga0207685_10014818 3300025905 Bacteria 2451
105 Ga0207699_10273602 3300025906 Bacteria 1171
106 Ga0207645_10075590 3300025907 Bacteria 2156
107 Ga0207654_10000073 3300025911 Bacteria 66148
108 Ga0207707_10242856 3300025912 Bacteria 1565
109 Ga0207695_10000366 3300025913 Bacteria 103345
110 Ga0207695_10028375 3300025913 Bacteria 6209
111 Ga0207671_10095369 3300025914 Bacteria 2246
112 Ga0207693_10004841 3300025915 Bacteria 11329
113 Ga0207693_10119160 3300025915 Bacteria 2073
114 Ga0207663_10022320 3300025916 Bacteria 3616
115 Ga0207660_10349019 3300025917 Bacteria 1186
116 Ga0207649_10080762 3300025920 Bacteria 2104
117 Ga0207652_10134677 3300025921 Bacteria 2206
118 Ga0207681_10004826 3300025923 Bacteria 8284
119 Ga0207694_10000139 3300025924 Bacteria 74561
120 Ga0207694_10033707 3300025924 Bacteria 3923
121 Ga0207644_10107780 3300025931 Bacteria 2102
122 Ga0207670_10043654 3300025936 Bacteria 2962
123 Ga0207669_10048611 3300025937 Bacteria 2521
124 Ga0207704_10219863 3300025938 Bacteria 1405
125 Ga0207665_10004430 3300025939 Bacteria 9329
126 Ga0207665_10084912 3300025939 Bacteria 2185
127 Ga0207711_10041830 3300025941 Bacteria 3903
128 Ga0207711_10537730 3300025941 Bacteria 1090
129 Ga0207667_10015597 3300025949 Bacteria 8620
130 Ga0207667_10026231 3300025949 Bacteria 6368
131 Ga0207667_10314574 3300025949 Bacteria 1599
132 Ga0207667_10443223 3300025949 Bacteria 1320
133 Ga0207640_10009130 3300025981 Bacteria 5538
134 Ga0207640_10027881 3300025981 Bacteria 3446
135 Ga0207658_10215162 3300025986 Bacteria 1613
136 Ga0207703_10163157 3300026035 Bacteria 1953
137 Ga0207703_10228942 3300026035 Bacteria 1666
138 Ga0207639_10001776 3300026041 Bacteria 14520
139 Ga0207639_10010041 3300026041 Bacteria 6547
140 Ga0207639_10486586 3300026041 Bacteria 1125
141 Ga0207678_10055968 3300026067 Bacteria 3397
142 Ga0207702_10000491 3300026078 Bacteria 44501
143 Ga0207702_10014883 3300026078 Bacteria 6453
144 Ga0207641_10119775 3300026088 Bacteria 2347
145 Ga0207676_10030569 3300026095 Bacteria 4044
146 Ga0207674_10012447 3300026116 Bacteria 9507
147 Ga0207674_10012615 3300026116 Bacteria 9445
148 Ga0207675_100095580 3300026118 Bacteria 2796
149 Ga0207675_100492818 3300026118 Bacteria 1219
150 Ga0207698_10002187 3300026142 Bacteria 11577
151 Ga0207698_10118752 3300026142 Bacteria 2234
152 Ga0207698_10183258 3300026142 Bacteria 1857
153 Ga0209589_1001702 3300027357 Bacteria 36938
154 Ga0209489_102545 3300027361 Bacteria 36938
155 Ga0209700_102508 3300027363 Bacteria 36938
156 Ga0268266_10065448 3300028379 Bacteria 3142
157 Ga0268266_10521312 3300028379 Bacteria 1136
158 Ga0268265_10390700 3300028380 Bacteria 1283
159 Ga0307517_10002031 3300028786 Bacteria 32949
160 Ga0265332_10019853 3300031238 Bacteria 2966
161 Ga0265340_10003861 3300031247 Bacteria 8440
162 Ga0265339_10021130 3300031249 Bacteria 3793
163 Ga0265314_10205616 3300031711 Bacteria 1160
164 Ga0265342_10000139 3300031712 Bacteria 81785
165 Ga0315911_1000042 3300033442 Bacteria 49262
166 Ga0373930_0031544 3300034816 Viruses 1093
167 Ga0373926_0020871 3300035083 Bacteria 2265
168 Ga0373934_0042454 3300035086 Bacteria 1796
169 Ga0373940_0048264 3300035088 Bacteria 1189
170 Ga0373951_0010402 3300035091 Bacteria 2088
171 Ga0373923_0000994 3300035111 Bacteria 7669
172 Ga0373936_0000131 3300035113 Bacteria 25984
173 Ga0373936_0194698 3300035113 Bacteria 893
174 Ga0373939_0005892 3300035114 Bacteria 2933
175 Ga0373945_0002931 3300035116 Bacteria 5359
176 Ga0373953_0051323 3300035117 Bacteria 1667
177 Ga0373954_0002536 3300035118 Bacteria 7662
178 Ga0373956_0002019 3300035119 Bacteria 8409
179 Ga0373957_0003320 3300035120 Bacteria 4742
180 Ga0373960_0037910 3300035121 Bacteria 1379
181 Ga0373943_0005070 3300035170 Bacteria 5939
182 Ga0373943_0015656 3300035170 Bacteria 3449
183 Ga0373946_0137782 3300035171 Bacteria 1128
184 Ga0373955_0002890 3300035172 Bacteria 7532
185 Ga0373955_0021120 3300035172 Bacteria 3281
186 Ga0373924_0002153 3300035410 Bacteria 6590
187 Ga0373924_0011790 3300035410 Bacteria 3252
188 Ga0373931_0000511 3300035691 Bacteria 15892
189 Ga0373931_0046420 3300035691 Bacteria 2296
190 Ga0373935_0000482 3300035692 Bacteria 20681
191 Ga0373927_0017006 3300035695 Bacteria 4792
192 Ga0373927_0018350 3300035695 Bacteria 4598
193 Ga0373927_0062317 3300035695 Bacteria 2412
194 Ga0373933_0017835 3300035724 Bacteria 3985
195 Ga0373933_0054519 3300035724 Bacteria 2396
196 Ga0373947_0003527 3300035725 Bacteria 9244
197 Ga0373937_0000005 3300036401 Bacteria 199965
198 Ga0373937_0048805 3300036401 Bacteria 3876
199 Ga0373937_0094344 3300036401 Bacteria 2774
200 Ga0373925_0000007 3300037068 Bacteria 257023
201 Ga0373925_0275859 3300037068 Bacteria 1353
202 Ga0436364_1030114 3300037853 Bacteria 1598
203 Ga0436365_0690350 3300039437 Bacteria 2764
204 Ga0466967_0076891 3300045976 Bacteria 3003
205 Ga0495592_0000241 3300046454 Bacteria 46812
206 Ga0495592_0055952 3300046454 Bacteria 2916
207 Ga0495629_0002565 3300046459 Bacteria 13924
208 Ga0495629_0019034 3300046459 Bacteria 4910
209 Ga0495651_0010131 3300046462 Bacteria 7240
210 Ga0495651_0043072 3300046462 Bacteria 3503
211 Ga0495653_0000034 3300046463 Bacteria 131084
212 Ga0495653_0032634 3300046463 Bacteria 4132
213 Ga0495662_0004119 3300046476 Bacteria 7325
214 Ga0495664_0000003 3300046477 Bacteria 551602
215 Ga0495608_0000131 3300046511 Bacteria 53612
216 Ga0495608_0006700 3300046511 Bacteria 8165
217 Ga0495618_0009398 3300046514 Bacteria 5902
218 Ga0495618_0147611 3300046514 Bacteria 1503
219 Ga0495618_0237662 3300046514 Bacteria 1146
220 Ga0495628_0000001 3300046516 Bacteria 917742
221 Ga0495628_0022338 3300046516 Bacteria 5197
222 Ga0495628_0068135 3300046516 Bacteria 2777
223 Ga0495630_0008375 3300046517 Bacteria 7420
224 Ga0495652_0000006 3300046529 Bacteria 459709
225 Ga0495652_0019375 3300046529 Bacteria 6061
226 Ga0495652_0176696 3300046529 Bacteria 1643
227 Ga0495665_0009431 3300046531 Bacteria 5283
228 Ga0495640_0000002 3300046533 Bacteria 646434
229 Ga0495640_0009283 3300046533 Bacteria 7665
230 Ga0495587_0000001 3300046536 Bacteria 724132
231 Ga0495645_0000009 3300046543 Bacteria 239632
232 Ga0495645_0002559 3300046543 Bacteria 12352
233 Ga0495667_0000021 3300046559 Bacteria 180625
234 Ga0495667_0013692 3300046559 Bacteria 5480
235 Ga0495667_0019663 3300046559 Bacteria 4556
236 Ga0495634_0001506 3300046642 Bacteria 20620
237 Ga0495634_0055645 3300046642 Bacteria 2645
238 Ga0495635_0000001 3300046663 Bacteria 704901
239 Ga0495635_0003584 3300046663 Bacteria 10744
240 Ga0495661_0190605 3300046665 Bacteria 1080
241 Ga0495657_0000088 3300046675 Bacteria 81307
242 Ga0495657_0008868 3300046675 Bacteria 7655
243 Ga0495599_0000025 3300046678 Bacteria 120337
244 Ga0495599_0002056 3300046678 Bacteria 11665
245 Ga0495623_0000018 3300046679 Bacteria 107338
246 Ga0495623_0053535 3300046679 Bacteria 2547
247 Ga0495623_0228162 3300046679 Bacteria 1058
248 Ga0495646_0000003 3300046680 Bacteria 287773
249 Ga0495646_0029394 3300046680 Bacteria 3435
250 Ga0495647_0065721 3300046681 Bacteria 1441
251 Ga0495658_0080106 3300046683 Bacteria 1915
252 Ga0495624_0043351 3300046690 Bacteria 2871
253 Ga0495600_0000025 3300046809 Bacteria 92167
254 Ga0495600_0003865 3300046809 Bacteria 8888
255 Ga0495581_0077154 3300047315 Bacteria 1928
256 Ga0495604_0000008 3300047317 Bacteria 341160
257 Ga0495604_0016767 3300047317 Bacteria 5860
258 Ga0495674_0000028 3300047319 Bacteria 124722
259 Ga0495674_0037665 3300047319 Bacteria 4346
260 Ga0495680_0002089 3300047322 Bacteria 20750
261 Ga0495680_0004771 3300047322 Bacteria 12870
262 Ga0495675_0000045 3300047444 Bacteria 82813
263 Ga0495675_0060228 3300047444 Bacteria 2406
264 Ga0495684_0000002 3300047471 Bacteria 341216
265 Ga0495684_0000701 3300047471 Bacteria 26925
266 Ga0495593_0008651 3300047673 Bacteria 5918
267 Ga0495593_0009630 3300047673 Bacteria 5608
268 Ga0495602_0000022 3300048088 Bacteria 163672
269 Ga0495602_0031131 3300048088 Bacteria 5048
270 Ga0495602_0044496 3300048088 Bacteria 4026
271 Ga0495602_0161035 3300048088 Bacteria 1752
272 Ga0496101_0177775 3300048904 Bacteria 1638
273 Ga0496102_0201608 3300048905 Bacteria 1876
274 Ga0496102_0208998 3300048905 Bacteria 1840
275 Ga0496102_0334745 3300048905 Bacteria 1426
276 Ga0496103_0014359 3300048906 Bacteria 4705
277 Ga0496104_0120119 3300048907 Bacteria 2523
278 Ga0496104_0266398 3300048907 Bacteria 1626
279 Ga0496104_0304745 3300048907 Bacteria 1505
280 Ga0496104_0377602 3300048907 Bacteria 1330
281 Ga0496105_0001797 3300048908 Bacteria 15330
282 Ga0496106_0039671 3300048909 Bacteria 3526
283 Ga0496106_0259889 3300048909 Bacteria 1389
284 Ga0496107_0001223 3300048910 Bacteria 15659
285 Ga0496107_0010724 3300048910 Bacteria 6374
286 Ga0496107_0190407 3300048910 Bacteria 1524
287 Ga0496108_0001270 3300048911 Bacteria 19743
288 Ga0496108_0026382 3300048911 Bacteria 4792
289 Ga0496109_0008952 3300048912 Bacteria 8527
290 Ga0496110_0008410 3300048913 Bacteria 8302
291 Ga0496110_0180806 3300048913 Bacteria 1915
292 Ga0496111_0155616 3300048914 Bacteria 1696
293 Ga0496111_0215588 3300048914 Bacteria 1426
294 Ga0496111_0223673 3300048914 Viruses 1398
295 Ga0496112_0001047 3300048915 Bacteria 20382
296 Ga0496112_0021077 3300048915 Bacteria 6191
297 Ga0496114_0029669 3300048917 Bacteria 4497
298 Ga0496114_0189941 3300048917 Bacteria 1797
299 Ga0496115_0022624 3300048918 Bacteria 4873
300 Ga0496115_0251364 3300048918 Bacteria 1455
301 Ga0496121_0006192 3300048924 Bacteria 14999
302 Ga0496125_0006588 3300048928 Bacteria 12507
303 Ga0496126_0007979 3300048929 Bacteria 11498
304 Ga0496126_0022419 3300048929 Bacteria 6147
305 Ga0496126_0124393 3300048929 Bacteria 2233
306 Ga0496126_0154151 3300048929 Bacteria 1967
307 Ga0496126_0186001 3300048929 Bacteria 1762
308 Ga0496126_0321241 3300048929 Bacteria 1272
309 nmdc:mga0yw44_77310_c1 3300050492 Bacteria 2079
310 nmdc:mga07m45_142762_c1 3300050496 Bacteria 1387
311 nmdc:mga08y16_181940_c1 3300050511 Bacteria 2182
312 nmdc:mga0n895_262222_c1 3300050512 Bacteria 1753
313 nmdc:mga0n895_57513_c1 3300050512 Bacteria 3833
314 Ga0495601_0000001 3300053077 Bacteria 549454
315 Ga0495612_0000003 3300053078 Bacteria 303629
316 Ga0495612_0044383 3300053078 Bacteria 1819
317 Ga0495595_0021113 3300053084 Bacteria 2841
318 Ga0495619_0000004 3300053085 Bacteria 500068
319 Ga0495619_0002102 3300053085 Bacteria 13212
320 Ga0495619_0154455 3300053085 Bacteria 1583
321 Ga0500651_0027444 3300053093 Bacteria 3580
322 Ga0500650_0150357 3300053098 Bacteria 1077
323 Ga0500554_014943 3300053102 Bacteria 2015
324 Ga0500595_000945 3300053119 Bacteria 16377
325 Ga0500595_001412 3300053119 Bacteria 12893
326 Ga0500642_0023096 3300053130 Bacteria 2491
327 Ga0500638_022573 3300053162 Bacteria 2983
328 Ga0500637_0000114 3300053178 Bacteria 29267
329 Ga0500661_001047 3300055283 Bacteria 5220

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100325519 Ga0068853_1003255191 261
2 3300010375 Ga0105239_10373383 Ga0105239_103733831 262
3 3300036401 Ga0373937_0048805 Ga0373937_0048805_850_1650 263
4 3300005458 Ga0070681_10077962 Ga0070681_100779622 264
5 3300009093 Ga0105240_10007471 Ga0105240_1000747110 264
6 3300031238 Ga0265332_10019853 Ga0265332_100198532 264
7 3300031247 Ga0265340_10003861 Ga0265340_100038612 264
8 3300031249 Ga0265339_10021130 Ga0265339_100211301 264
9 3300031711 Ga0265314_10205616 Ga0265314_102056162 264
10 3300031712 Ga0265342_10000139 Ga0265342_1000013926 264
11 3300035111 Ga0373923_0000994 Ga0373923_0000994_2428_3237 264
12 3300035113 Ga0373936_0000131 Ga0373936_0000131_23994_24803 264
13 3300035116 Ga0373945_0002931 Ga0373945_0002931_3268_4077 264
14 3300035170 Ga0373943_0005070 Ga0373943_0005070_4189_4998 264
15 3300035171 Ga0373946_0137782 Ga0373946_0137782_25_834 264
16 3300035172 Ga0373955_0021120 Ga0373955_0021120_2256_3065 264
17 3300035410 Ga0373924_0002153 Ga0373924_0002153_4476_5285 264
18 3300035692 Ga0373935_0000482 Ga0373935_0000482_2837_3646 264
19 3300035695 Ga0373927_0017006 Ga0373927_0017006_1100_1909 264
20 3300035724 Ga0373933_0054519 Ga0373933_0054519_651_1460 264
21 3300035725 Ga0373947_0003527 Ga0373947_0003527_6090_6899 264
22 3300036401 Ga0373937_0000005 Ga0373937_0000005_63878_64687 264
23 3300037068 Ga0373925_0000007 Ga0373925_0000007_135506_136315 264
24 3300046454 Ga0495592_0000241 Ga0495592_0000241_25739_26548 264
25 3300046459 Ga0495629_0019034 Ga0495629_0019034_1258_2067 264
26 3300046462 Ga0495651_0010131 Ga0495651_0010131_3643_4452 264
27 3300046463 Ga0495653_0000034 Ga0495653_0000034_120749_121558 264
28 3300046476 Ga0495662_0004119 Ga0495662_0004119_2896_3705 264
29 3300046477 Ga0495664_0000003 Ga0495664_0000003_423246_424055 264
30 3300046511 Ga0495608_0000131 Ga0495608_0000131_41958_42767 264
31 3300046514 Ga0495618_0009398 Ga0495618_0009398_3767_4576 264
32 3300046516 Ga0495628_0000001 Ga0495628_0000001_912647_913456 264
33 3300046517 Ga0495630_0008375 Ga0495630_0008375_6223_7032 264
34 3300046529 Ga0495652_0000006 Ga0495652_0000006_180719_181528 264
35 3300046533 Ga0495640_0000002 Ga0495640_0000002_367460_368269 264
36 3300046536 Ga0495587_0000001 Ga0495587_0000001_439916_440725 264
37 3300046543 Ga0495645_0000009 Ga0495645_0000009_41959_42768 264
38 3300046559 Ga0495667_0000021 Ga0495667_0000021_44393_45202 264
39 3300046642 Ga0495634_0001506 Ga0495634_0001506_17248_18057 264
40 3300046663 Ga0495635_0000001 Ga0495635_0000001_425727_426536 264
41 3300046675 Ga0495657_0000088 Ga0495657_0000088_76686_77495 264
42 3300046678 Ga0495599_0000025 Ga0495599_0000025_40194_41003 264
43 3300046679 Ga0495623_0000018 Ga0495623_0000018_31435_32244 264
44 3300046680 Ga0495646_0000003 Ga0495646_0000003_3715_4524 264
45 3300046681 Ga0495647_0065721 Ga0495647_0065721_237_1046 264
46 3300046683 Ga0495658_0080106 Ga0495658_0080106_235_1044 264
47 3300046690 Ga0495624_0043351 Ga0495624_0043351_2011_2820 264
48 3300046809 Ga0495600_0000025 Ga0495600_0000025_86833_87642 264
49 3300047315 Ga0495581_0077154 Ga0495581_0077154_546_1424 264
50 3300047317 Ga0495604_0000008 Ga0495604_0000008_79309_80118 264
51 3300047319 Ga0495674_0000028 Ga0495674_0000028_44521_45330 264
52 3300047322 Ga0495680_0002089 Ga0495680_0002089_10667_11476 264
53 3300047444 Ga0495675_0000045 Ga0495675_0000045_7180_7989 264
54 3300047471 Ga0495684_0000002 Ga0495684_0000002_79367_80176 264
55 3300047673 Ga0495593_0009630 Ga0495593_0009630_276_1085 264
56 3300048088 Ga0495602_0000022 Ga0495602_0000022_41972_42781 264
57 3300053077 Ga0495601_0000001 Ga0495601_0000001_118867_119676 264
58 3300053078 Ga0495612_0000003 Ga0495612_0000003_223429_224238 264
59 3300053085 Ga0495619_0000004 Ga0495619_0000004_118898_119707 264
60 3300003215 JGI25153J46596_10003308 JGI25153J46596_100033085 265
61 3300025297 Ga0209758_1021235 Ga0209758_10212352 265
62 3300033442 Ga0315911_1000042 Ga0315911_100004235 265
63 3300048907 Ga0496104_0304745 Ga0496104_0304745_402_1202 266
64 3300025921 Ga0207652_10134677 Ga0207652_101346773 267
65 3300026035 Ga0207703_10163157 Ga0207703_101631572 268
66 3300048905 Ga0496102_0201608 Ga0496102_0201608_101_907 268
67 3300048907 Ga0496104_0120119 Ga0496104_0120119_709_1515 268
68 3300048909 Ga0496106_0039671 Ga0496106_0039671_29_835 268
69 3300048910 Ga0496107_0001223 Ga0496107_0001223_11292_12098 268
70 3300048911 Ga0496108_0001270 Ga0496108_0001270_18608_19414 268
71 3300048914 Ga0496111_0215588 Ga0496111_0215588_339_1145 268
72 3300048915 Ga0496112_0001047 Ga0496112_0001047_13387_14193 268
73 3300035086 Ga0373934_0042454 Ga0373934_0042454_82_915 269
74 3300035117 Ga0373953_0051323 Ga0373953_0051323_417_1250 269
75 3300035118 Ga0373954_0002536 Ga0373954_0002536_2850_3683 269
76 3300035119 Ga0373956_0002019 Ga0373956_0002019_1158_1991 269
77 3300035120 Ga0373957_0003320 Ga0373957_0003320_2821_3654 269
78 3300035172 Ga0373955_0002890 Ga0373955_0002890_2725_3558 269
79 3300035410 Ga0373924_0011790 Ga0373924_0011790_598_1431 269
80 3300035724 Ga0373933_0017835 Ga0373933_0017835_1098_1931 269
81 3300036401 Ga0373937_0094344 Ga0373937_0094344_41_874 269
82 3300037853 Ga0436364_1030114 Ga0436364_1030114_640_1449 269
83 3300039437 Ga0436365_0690350 Ga0436365_0690350_1778_2587 269
84 3300046454 Ga0495592_0055952 Ga0495592_0055952_416_1249 269
85 3300046459 Ga0495629_0002565 Ga0495629_0002565_11229_12062 269
86 3300046462 Ga0495651_0043072 Ga0495651_0043072_1865_2698 269
87 3300046463 Ga0495653_0032634 Ga0495653_0032634_191_1024 269
88 3300046511 Ga0495608_0006700 Ga0495608_0006700_1953_2786 269
89 3300046514 Ga0495618_0237662 Ga0495618_0237662_268_1101 269
90 3300046516 Ga0495628_0022338 Ga0495628_0022338_882_1715 269
91 3300046529 Ga0495652_0019375 Ga0495652_0019375_1246_2079 269
92 3300046533 Ga0495640_0009283 Ga0495640_0009283_3219_4052 269
93 3300046543 Ga0495645_0002559 Ga0495645_0002559_11230_12063 269
94 3300046559 Ga0495667_0013692 Ga0495667_0013692_1827_2660 269
95 3300046642 Ga0495634_0055645 Ga0495634_0055645_1780_2613 269
96 3300046663 Ga0495635_0003584 Ga0495635_0003584_5937_6770 269
97 3300046675 Ga0495657_0008868 Ga0495657_0008868_2820_3653 269
98 3300046678 Ga0495599_0002056 Ga0495599_0002056_8153_8986 269
99 3300046679 Ga0495623_0053535 Ga0495623_0053535_887_1720 269
100 3300046679 Ga0495623_0228162 Ga0495623_0228162_233_1042 269
101 3300046680 Ga0495646_0029394 Ga0495646_0029394_834_1667 269
102 3300046809 Ga0495600_0003865 Ga0495600_0003865_4053_4886 269
103 3300047317 Ga0495604_0016767 Ga0495604_0016767_3483_4316 269
104 3300047319 Ga0495674_0037665 Ga0495674_0037665_652_1485 269
105 3300047322 Ga0495680_0004771 Ga0495680_0004771_8239_9072 269
106 3300047444 Ga0495675_0060228 Ga0495675_0060228_1384_2217 269
107 3300047471 Ga0495684_0000701 Ga0495684_0000701_3799_4632 269
108 3300047673 Ga0495593_0008651 Ga0495593_0008651_4302_5135 269
109 3300048088 Ga0495602_0031131 Ga0495602_0031131_2832_3665 269
110 3300048904 Ga0496101_0177775 Ga0496101_0177775_505_1422 269
111 3300048907 Ga0496104_0266398 Ga0496104_0266398_294_1211 269
112 3300053084 Ga0495595_0021113 Ga0495595_0021113_1947_2780 269
113 3300053085 Ga0495619_0002102 Ga0495619_0002102_8377_9210 269
114 iso_pu_bacteria 2513237098 2513673960 269
115 3300025939 Ga0207665_10084912 Ga0207665_100849122 270
116 3300053119 Ga0500595_001412 Ga0500595_001412_6482_7375 270
117 3300035113 Ga0373936_0194698 Ga0373936_0194698_45_860 271
118 3300050512 nmdc:mga0n895_57513_c1 nmdc:mga0n895_57513_c1_2846_3679 271
119 3300009545 Ga0105237_10149766 Ga0105237_101497662 272
120 3300013105 Ga0157369_10076101 Ga0157369_100761012 272
121 3300013307 Ga0157372_10324763 Ga0157372_103247632 272
122 3300025913 Ga0207695_10028375 Ga0207695_100283756 272
123 3300048905 Ga0496102_0334745 Ga0496102_0334745_62_895 272
124 3300048918 Ga0496115_0022624 Ga0496115_0022624_1718_2548 272
125 3300005985 Ga0081539_10000129 Ga0081539_1000012933 273
126 3300048929 Ga0496126_0007979 Ga0496126_0007979_6501_7322 273
127 3300026041 Ga0207639_10486586 Ga0207639_104865862 274
128 3300006871 Ga0075434_100045020 Ga0075434_1000450206 275
129 3300013104 Ga0157370_10113979 Ga0157370_101139792 275
130 3300025917 Ga0207660_10349019 Ga0207660_103490191 275
131 3300005367 Ga0070667_100170744 Ga0070667_1001707442 276
132 3300005441 Ga0070700_100147368 Ga0070700_1001473681 276
133 3300005458 Ga0070681_10281968 Ga0070681_102819681 276
134 3300005578 Ga0068854_100234590 Ga0068854_1002345901 276
135 3300005617 Ga0068859_100146461 Ga0068859_1001464612 276
136 3300005841 Ga0068863_100235975 Ga0068863_1002359751 276
137 3300005842 Ga0068858_100276740 Ga0068858_1002767401 276
138 3300005843 Ga0068860_100219591 Ga0068860_1002195913 276
139 3300005844 Ga0068862_100650281 Ga0068862_1006502811 276
140 3300006931 Ga0097620_100146466 Ga0097620_1001464662 276
141 3300025899 Ga0207642_10041211 Ga0207642_100412111 276
142 3300025907 Ga0207645_10075590 Ga0207645_100755902 276
143 3300025923 Ga0207681_10004826 Ga0207681_100048265 276
144 3300025931 Ga0207644_10107780 Ga0207644_101077802 276
145 3300025936 Ga0207670_10043654 Ga0207670_100436541 276
146 3300025937 Ga0207669_10048611 Ga0207669_100486113 276
147 3300025938 Ga0207704_10219863 Ga0207704_102198632 276
148 3300025941 Ga0207711_10041830 Ga0207711_100418302 276
149 3300025986 Ga0207658_10215162 Ga0207658_102151623 276
150 3300026088 Ga0207641_10119775 Ga0207641_101197752 276
151 3300026118 Ga0207675_100095580 Ga0207675_1000955803 276
152 3300028380 Ga0268265_10390700 Ga0268265_103907001 276
153 iso_pu_bacteria 2513237137 2513860668 276
154 iso_pu_bacteria 2517572143 2517888398 276
155 iso_pu_bacteria 2524023210 2524468411 276
156 iso_pu_bacteria 2667528175 2671124221 276
157 iso_pu_bacteria 2728368998 2728752095 276
158 iso_pu_bacteria 2791355197 2793067213 276
159 iso_pu_bacteria 2885383462 2885392010 276
160 iso_pu_bacteria 2903748898 2903753267 276
161 iso_pu_bacteria 2903768456 2903777094 276
162 iso_pu_bacteria 2904690495 2904692285 276
163 iso_pu_bacteria 2906610324 2906614243 276
164 iso_pu_bacteria 2908739725 2908746928 276
165 iso_pu_bacteria 2908756301 2908758908 276
166 iso_pu_bacteria 2922425934 2922426068 276
167 iso_pu_bacteria 2935630451 2935632482 276
168 iso_pu_bacteria 2941507105 2941508855 276
169 iso_pu_bacteria 2941515067 2941516684 276
170 iso_pu_bacteria 2941523033 2941524299 276
171 iso_pu_bacteria 3005474847 3005483472 276
172 iso_pu_bacteria 8019565922 8019571997 276
173 3300005340 Ga0070689_100002201 Ga0070689_1000022019 277
174 3300005347 Ga0070668_100053698 Ga0070668_1000536983 277
175 3300005355 Ga0070671_100101933 Ga0070671_1001019332 277
176 3300005356 Ga0070674_100116578 Ga0070674_1001165782 277
177 3300005365 Ga0070688_100239073 Ga0070688_1002390731 277
178 3300005459 Ga0068867_100107016 Ga0068867_1001070163 277
179 3300005718 Ga0068866_10168790 Ga0068866_101687901 277
180 3300009177 Ga0105248_10030839 Ga0105248_100308394 277
181 3300009177 Ga0105248_10173144 Ga0105248_101731442 277
182 3300009177 Ga0105248_10310704 Ga0105248_103107042 277
183 3300013306 Ga0163162_10168946 Ga0163162_101689463 277
184 3300014325 Ga0163163_10203786 Ga0163163_102037861 277
185 3300014968 Ga0157379_10026455 Ga0157379_100264556 277
186 3300014968 Ga0157379_10372278 Ga0157379_103722781 277
187 3300025941 Ga0207711_10537730 Ga0207711_105377301 277
188 3300026035 Ga0207703_10228942 Ga0207703_102289421 277
189 3300026095 Ga0207676_10030569 Ga0207676_100305691 277
190 3300034816 Ga0373930_0031544 Ga0373930_0031544_104_958 277
191 3300035088 Ga0373940_0048264 Ga0373940_0048264_128_982 277
192 3300035091 Ga0373951_0010402 Ga0373951_0010402_822_1676 277
193 3300035114 Ga0373939_0005892 Ga0373939_0005892_1974_2828 277
194 3300035121 Ga0373960_0037910 Ga0373960_0037910_128_982 277
195 3300035691 Ga0373931_0000511 Ga0373931_0000511_6691_7545 277
196 3300035691 Ga0373931_0046420 Ga0373931_0046420_1175_2029 277
197 3300035695 Ga0373927_0062317 Ga0373927_0062317_69_914 277
198 3300048906 Ga0496103_0014359 Ga0496103_0014359_383_1237 277
199 3300048908 Ga0496105_0001797 Ga0496105_0001797_7324_8178 277
200 3300048910 Ga0496107_0010724 Ga0496107_0010724_1401_2255 277
201 3300048911 Ga0496108_0026382 Ga0496108_0026382_109_963 277
202 3300048912 Ga0496109_0008952 Ga0496109_0008952_2806_3660 277
203 3300048913 Ga0496110_0008410 Ga0496110_0008410_7284_8138 277
204 3300048913 Ga0496110_0180806 Ga0496110_0180806_641_1495 277
205 3300048914 Ga0496111_0223673 Ga0496111_0223673_146_1000 277
206 3300048915 Ga0496112_0021077 Ga0496112_0021077_4679_5533 277
207 3300048917 Ga0496114_0029669 Ga0496114_0029669_2361_3215 277
208 iso_pu_bacteria 2791355199 2793077133 277
209 iso_pu_bacteria 2879110137 2879112768 277
210 iso_pu_bacteria 8006984368 8006992483 277
211 3300005367 Ga0070667_100289790 Ga0070667_1002897901 278
212 3300005456 Ga0070678_100241466 Ga0070678_1002414662 278
213 3300006237 Ga0097621_100296627 Ga0097621_1002966272 278
214 3300009545 Ga0105237_10420543 Ga0105237_104205431 278
215 3300009551 Ga0105238_10352548 Ga0105238_103525482 278
216 3300013308 Ga0157375_10280689 Ga0157375_102806891 278
217 3300045976 Ga0466967_0076891 Ga0466967_0076891_733_1569 278
218 3300046516 Ga0495628_0068135 Ga0495628_0068135_1864_2736 278
219 3300048088 Ga0495602_0044496 Ga0495602_0044496_1116_1988 278
220 3300048924 Ga0496121_0006192 Ga0496121_0006192_8918_9772 278
221 3300053102 Ga0500554_014943 Ga0500554_014943_775_1644 278
222 3300053119 Ga0500595_000945 Ga0500595_000945_9758_10627 278
223 3300053162 Ga0500638_022573 Ga0500638_022573_350_1219 278
224 3300053178 Ga0500637_0000114 Ga0500637_0000114_4197_5066 278
225 3300055283 Ga0500661_001047 Ga0500661_001047_2151_3020 278
226 3300005356 Ga0070674_100205347 Ga0070674_1002053472 279
227 3300005434 Ga0070709_10051686 Ga0070709_100516863 279
228 3300005435 Ga0070714_100382018 Ga0070714_1003820182 279
229 3300005436 Ga0070713_100073018 Ga0070713_1000730182 279
230 3300005439 Ga0070711_100040086 Ga0070711_1000400862 279
231 3300005563 Ga0068855_100262918 Ga0068855_1002629182 279
232 3300005614 Ga0068856_100147029 Ga0068856_1001470292 279
233 3300005616 Ga0068852_100042060 Ga0068852_1000420602 279
234 3300005983 Ga0081540_1031472 Ga0081540_10314722 279
235 3300006173 Ga0070716_100170808 Ga0070716_1001708081 279
236 3300006175 Ga0070712_100177584 Ga0070712_1001775842 279
237 3300006943 Ga0099822_1006293 Ga0099822_10062936 279
238 3300025912 Ga0207707_10242856 Ga0207707_102428562 279
239 3300025915 Ga0207693_10119160 Ga0207693_101191601 279
240 3300025920 Ga0207649_10080762 Ga0207649_100807623 279
241 3300025949 Ga0207667_10443223 Ga0207667_104432231 279
242 3300026142 Ga0207698_10183258 Ga0207698_101832584 279
243 3300027357 Ga0209589_1001702 Ga0209589_100170212 279
244 3300027361 Ga0209489_102545 Ga0209489_10254512 279
245 3300027363 Ga0209700_102508 Ga0209700_10250812 279
246 3300028786 Ga0307517_10002031 Ga0307517_1000203117 279
247 3300035083 Ga0373926_0020871 Ga0373926_0020871_19_858 279
248 3300035170 Ga0373943_0015656 Ga0373943_0015656_2589_3428 279
249 3300037068 Ga0373925_0275859 Ga0373925_0275859_309_1157 279
250 3300046514 Ga0495618_0147611 Ga0495618_0147611_642_1481 279
251 3300046531 Ga0495665_0009431 Ga0495665_0009431_32_871 279
252 3300048914 Ga0496111_0155616 Ga0496111_0155616_252_1103 279
253 3300048917 Ga0496114_0189941 Ga0496114_0189941_238_1089 279
254 3300048929 Ga0496126_0154151 Ga0496126_0154151_265_1122 279
255 3300053085 Ga0495619_0154455 Ga0495619_0154455_171_1058 279
256 3300005983 Ga0081540_1004792 Ga0081540_10047929 280
257 3300046665 Ga0495661_0190605 Ga0495661_0190605_86_976 280
258 3300048929 Ga0496126_0022419 Ga0496126_0022419_3561_4403 280
259 3300048929 Ga0496126_0321241 Ga0496126_0321241_323_1213 280
260 3300050511 nmdc:mga08y16_181940_c1 nmdc:mga08y16_181940_c1_592_1443 280
261 iso_pu_bacteria 2889033259 2889035911 280
262 3300003323 rootH1_10061607 rootH1_100616072 281
263 3300005435 Ga0070714_100212866 Ga0070714_1002128662 281
264 3300005436 Ga0070713_100210845 Ga0070713_1002108452 281
265 3300005437 Ga0070710_10149847 Ga0070710_101498472 281
266 3300005530 Ga0070679_100267070 Ga0070679_1002670702 281
267 3300005548 Ga0070665_100019635 Ga0070665_1000196352 281
268 3300005563 Ga0068855_100154745 Ga0068855_1001547452 281
269 3300006051 Ga0075364_10206570 Ga0075364_102065701 281
270 3300006353 Ga0075370_10121401 Ga0075370_101214012 281
271 3300009093 Ga0105240_10272953 Ga0105240_102729532 281
272 3300013104 Ga0157370_10094139 Ga0157370_100941392 281
273 3300014325 Ga0163163_10188624 Ga0163163_101886242 281
274 3300025949 Ga0207667_10314574 Ga0207667_103145741 281
275 3300026067 Ga0207678_10055968 Ga0207678_100559682 281
276 3300028379 Ga0268266_10065448 Ga0268266_100654482 281
277 3300046529 Ga0495652_0176696 Ga0495652_0176696_649_1506 281
278 3300046559 Ga0495667_0019663 Ga0495667_0019663_3361_4218 281
279 3300048905 Ga0496102_0208998 Ga0496102_0208998_444_1346 281
280 3300048907 Ga0496104_0377602 Ga0496104_0377602_376_1278 281
281 3300048909 Ga0496106_0259889 Ga0496106_0259889_447_1349 281
282 3300050496 nmdc:mga07m45_142762_c1 nmdc:mga07m45_142762_c1_379_1281 281
283 3300009551 Ga0105238_10187939 Ga0105238_101879391 282
284 3300009553 Ga0105249_10226870 Ga0105249_102268702 282
285 3300014969 Ga0157376_10468649 Ga0157376_104686491 282
286 3300026118 Ga0207675_100492818 Ga0207675_1004928181 282
287 3300028379 Ga0268266_10521312 Ga0268266_105213121 282
288 3300035695 Ga0373927_0018350 Ga0373927_0018350_3184_4050 282
289 3300050492 nmdc:mga0yw44_77310_c1 nmdc:mga0yw44_77310_c1_612_1517 282
290 3300050512 nmdc:mga0n895_262222_c1 nmdc:mga0n895_262222_c1_752_1657 282
291 3300053078 Ga0495612_0044383 Ga0495612_0044383_583_1467 282
292 3300053093 Ga0500651_0027444 Ga0500651_0027444_1919_2803 282
293 3300053098 Ga0500650_0150357 Ga0500650_0150357_14_1003 282
294 3300053130 Ga0500642_0023096 Ga0500642_0023096_768_1652 282
295 3300025297 Ga0209758_1001222 Ga0209758_10012227 283
296 3300048088 Ga0495602_0161035 Ga0495602_0161035_803_1657 283
297 3300005435 Ga0070714_100020830 Ga0070714_1000208302 284
298 3300005437 Ga0070710_10019490 Ga0070710_100194901 284
299 3300025898 Ga0207692_10017420 Ga0207692_100174201 284
300 3300025906 Ga0207699_10273602 Ga0207699_102736021 284
301 3300025916 Ga0207663_10022320 Ga0207663_100223202 284
302 3300048910 Ga0496107_0190407 Ga0496107_0190407_628_1482 284
303 3300048928 Ga0496125_0006588 Ga0496125_0006588_9773_10651 285
304 3300048929 Ga0496126_0124393 Ga0496126_0124393_1056_1934 285
305 3300001979 JGI24740J21852_10002093 JGI24740J21852_100020938 286
306 3300001989 JGI24739J22299_10007291 JGI24739J22299_100072913 286
307 3300001990 JGI24737J22298_10003234 JGI24737J22298_100032343 286
308 3300005436 Ga0070713_100008303 Ga0070713_1000083031 286
309 3300005439 Ga0070711_100024689 Ga0070711_1000246891 286
310 3300005539 Ga0068853_100009176 Ga0068853_1000091762 286
311 3300005539 Ga0068853_100174264 Ga0068853_1001742643 286
312 3300005563 Ga0068855_100034950 Ga0068855_1000349504 286
313 3300005563 Ga0068855_100045602 Ga0068855_1000456022 286
314 3300005577 Ga0068857_100025539 Ga0068857_1000255391 286
315 3300005577 Ga0068857_100029534 Ga0068857_1000295343 286
316 3300005578 Ga0068854_100031348 Ga0068854_1000313482 286
317 3300005578 Ga0068854_100034023 Ga0068854_1000340235 286
318 3300005614 Ga0068856_100007580 Ga0068856_1000075805 286
319 3300005614 Ga0068856_100079394 Ga0068856_1000793942 286
320 3300005616 Ga0068852_100009383 Ga0068852_1000093832 286
321 3300005616 Ga0068852_100273229 Ga0068852_1002732292 286
322 3300005834 Ga0068851_10003386 Ga0068851_100033864 286
323 3300006173 Ga0070716_100065335 Ga0070716_1000653351 286
324 3300009093 Ga0105240_10006010 Ga0105240_1000601016 286
325 3300009174 Ga0105241_10001634 Ga0105241_100016344 286
326 3300009545 Ga0105237_10157612 Ga0105237_101576123 286
327 3300009551 Ga0105238_10002664 Ga0105238_100026644 286
328 3300009551 Ga0105238_10020931 Ga0105238_100209315 286
329 3300010375 Ga0105239_10013167 Ga0105239_100131675 286
330 3300010375 Ga0105239_10026772 Ga0105239_100267722 286
331 3300025321 Ga0207656_10000685 Ga0207656_100006853 286
332 3300025904 Ga0207647_10000749 Ga0207647_1000074911 286
333 3300025905 Ga0207685_10014818 Ga0207685_100148182 286
334 3300025911 Ga0207654_10000073 Ga0207654_1000007310 286
335 3300025913 Ga0207695_10000366 Ga0207695_1000036647 286
336 3300025914 Ga0207671_10095369 Ga0207671_100953692 286
337 3300025915 Ga0207693_10004841 Ga0207693_100048417 286
338 3300025924 Ga0207694_10000139 Ga0207694_100001395 286
339 3300025924 Ga0207694_10033707 Ga0207694_100337072 286
340 3300025939 Ga0207665_10004430 Ga0207665_100044304 286
341 3300025949 Ga0207667_10015597 Ga0207667_100155975 286
342 3300025949 Ga0207667_10026231 Ga0207667_100262314 286
343 3300025981 Ga0207640_10009130 Ga0207640_100091302 286
344 3300025981 Ga0207640_10027881 Ga0207640_100278813 286
345 3300026041 Ga0207639_10001776 Ga0207639_100017765 286
346 3300026041 Ga0207639_10010041 Ga0207639_100100413 286
347 3300026078 Ga0207702_10000491 Ga0207702_100004919 286
348 3300026078 Ga0207702_10014883 Ga0207702_100148834 286
349 3300026116 Ga0207674_10012447 Ga0207674_100124474 286
350 3300026116 Ga0207674_10012615 Ga0207674_100126155 286
351 3300026142 Ga0207698_10002187 Ga0207698_100021871 286
352 3300026142 Ga0207698_10118752 Ga0207698_101187522 286
353 3300048918 Ga0496115_0251364 Ga0496115_0251364_140_1024 286
354 3300048929 Ga0496126_0186001 Ga0496126_0186001_721_1617 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11306

DUF3108

Protein of unknown function (DUF3108)

22

258

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bju-assembly2.cif.gz_C the structure of atzh: a little known member of the atrazine breakdown pathway 0.6384 43 110
2zxk-assembly1.cif.gz_A crystal structure of semet-red chlorophyll catabolite reductase 0.6249 44 120
3agb-assembly1.cif.gz_B f218v mutant of the substrate-free form of red chlorophyll catabolite reductase from arabidopsis thaliana 0.6049 44 120
3f7s-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (pp_4556) from pseudomonas putida kt2440 at 2.11 a resolution 0.5653 43 101
6bju-assembly1.cif.gz_A the structure of atzh: a little known member of the atrazine breakdown pathway 0.5635 43 101
ID Description Score Start End Superfamily
af_Q8IJC0_48_207_3.40.50.10480 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Brix domain 0.7439 103 131 3.40.50.10480
af_E7F1M4_1_172_3.30.500.10 Alpha Beta;2-Layer Sandwich;Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1;MHC class I-like antigen recognition-like 0.558 84 132 3.30.500.10
4r80B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5168 20 109 3.10.450.630
af_Q9JIL8_3_164_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.501 52 112 3.40.50.300
3sluA02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.4965 84 128 3.10.450.350
ID Description Score Start End GO Terms
AF-A0A023XUQ5-F1-model_v4 deleted 0.9684 34 286
AF-A0A7S7ZMJ8-F1-model_v4 DUF3108 domain-containing protein 0.9684 32 286
AF-A0A1I4MLY2-F1-model_v4 deleted 0.9684 32 286
AF-A0A7U3E6B1-F1-model_v4 deleted 0.9682 32 277
AF-A0A182D0D8-F1-model_v4 DUF3108 domain-containing protein 0.966 28 277

Feature Viewer

pLDDT pTM Quality
87.62 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map