F419765

General Info

Members Datasets Scaffolds Average Seq Length
354 200 350 216

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10234469|Ga0157374_102344692
Length 266
Sequence LSLPRAGATLAEKTFTPPSRDSDAAFLAALSRGGRAPSERRAGSIRIGEPVNIADLRREYMRETLDESDVAPDPCRQFERWFAEATKAALPEPNAMTLATVDAAGRPAARIVLLKIVDDRGFVFFTNFTSRKGRELEANRRAALLFFWPELERQVRIEGETARIDPGESAAYFAGRPRASQLGAWASPQSEAIAGRDALMSRFDEVEAQYADPSRAVPCPPHWGGYRLDPEAMEFWQGRPSRLHDRIRYRRKHEQAGAWVIDRLAP

Samples

Sample ID Description Type Environment
1 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
2 2738543023 Pedobacter sp. OK628 Isolate Unclassified
3 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
4 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
142 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
155 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
196 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.26
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10001619 3300003316 Bacteria 18216
2 rootH2_10021864 3300003320 Bacteria 30597
3 rootL2_10042221 3300003322 Bacteria 6992
4 Ga0065714_10002361 3300005288 Bacteria 37849
5 Ga0070658_10010401 3300005327 Bacteria 7461
6 Ga0070658_10072046 3300005327 Bacteria 2831
7 Ga0070676_10005638 3300005328 Bacteria 6667
8 Ga0070670_100014220 3300005331 Bacteria 6827
9 Ga0070670_100050599 3300005331 Bacteria 3569
10 Ga0070670_100074495 3300005331 Bacteria 2916
11 Ga0070677_10001405 3300005333 Bacteria 7677
12 Ga0070677_10013334 3300005333 Bacteria 2873
13 Ga0070666_10027339 3300005335 Bacteria 3735
14 Ga0070666_10355733 3300005335 Bacteria 1048
15 Ga0068868_100042177 3300005338 Bacteria 3559
16 Ga0070661_100008060 3300005344 Bacteria 7271
17 Ga0070668_100003054 3300005347 Bacteria 12385
18 Ga0070668_100023224 3300005347 Bacteria 4690
19 Ga0070668_100047798 3300005347 Bacteria 3290
20 Ga0070668_100827731 3300005347 Bacteria 824
21 Ga0070675_100001486 3300005354 Bacteria 17301
22 Ga0070675_100028788 3300005354 Bacteria 4474
23 Ga0070671_100003732 3300005355 Bacteria 11955
24 Ga0070671_100108365 3300005355 Bacteria 2333
25 Ga0070671_100325729 3300005355 Bacteria 1309
26 Ga0070674_100001820 3300005356 Bacteria 11567
27 Ga0070674_100051552 3300005356 Bacteria 2836
28 Ga0070674_100657201 3300005356 Bacteria 892
29 Ga0070673_100000369 3300005364 Bacteria 23581
30 Ga0070673_100295694 3300005364 Bacteria 1424
31 Ga0070659_100003342 3300005366 Bacteria 11413
32 Ga0070667_100036242 3300005367 Bacteria 4135
33 Ga0070667_100060915 3300005367 Bacteria 3194
34 Ga0070667_100091421 3300005367 Bacteria 2617
35 Ga0070709_10140780 3300005434 Bacteria 1657
36 Ga0070714_100000389 3300005435 Bacteria 32725
37 Ga0070713_100018733 3300005436 Bacteria 5266
38 Ga0070713_100588041 3300005436 Bacteria 1056
39 Ga0070710_10065207 3300005437 Bacteria 2085
40 Ga0070711_100058017 3300005439 Bacteria 2683
41 Ga0070700_100109959 3300005441 Bacteria 1831
42 Ga0070663_100049206 3300005455 Bacteria 2992
43 Ga0070678_100005428 3300005456 Bacteria 7366
44 Ga0070678_100213917 3300005456 Bacteria 1599
45 Ga0070678_100706546 3300005456 Bacteria 909
46 Ga0070662_100070344 3300005457 Bacteria 2578
47 Ga0070662_100143780 3300005457 Bacteria 1851
48 Ga0070681_10228102 3300005458 Bacteria 1777
49 Ga0070681_10234071 3300005458 Bacteria 1751
50 Ga0070681_10256164 3300005458 Bacteria 1662
51 Ga0068867_100003972 3300005459 Bacteria 10404
52 Ga0068867_100005139 3300005459 Bacteria 9247
53 Ga0070685_10095298 3300005466 Bacteria 1809
54 Ga0070699_100233718 3300005518 Bacteria 1640
55 Ga0070679_100060749 3300005530 Bacteria 3766
56 Ga0070679_100192879 3300005530 Bacteria 2006
57 Ga0070679_100346337 3300005530 Bacteria 1434
58 Ga0068853_100031444 3300005539 Bacteria 4490
59 Ga0070672_100000746 3300005543 Bacteria 19295
60 Ga0070672_100028426 3300005543 Bacteria 4183
61 Ga0070672_100061830 3300005543 Bacteria 2953
62 Ga0070696_100018595 3300005546 Bacteria 4700
63 Ga0070665_100006570 3300005548 Bacteria 11823
64 Ga0070665_100017479 3300005548 Bacteria 7202
65 Ga0070665_100062880 3300005548 Bacteria 3722
66 Ga0070665_100483899 3300005548 Bacteria 1248
67 Ga0070704_100325412 3300005549 Bacteria 1289
68 Ga0068855_100145704 3300005563 Bacteria 2696
69 Ga0070664_100164216 3300005564 Bacteria 1966
70 Ga0068857_100454359 3300005577 Unclassified 1198
71 Ga0068856_100504643 3300005614 Bacteria 1231
72 Ga0068852_100001886 3300005616 Bacteria 14284
73 Ga0068852_100005100 3300005616 Bacteria 9351
74 Ga0068852_100216530 3300005616 Bacteria 1819
75 Ga0068852_100366796 3300005616 Bacteria 1410
76 Ga0068852_100594214 3300005616 Bacteria 1111
77 Ga0068864_100003448 3300005618 Bacteria 13076
78 Ga0068864_100039778 3300005618 Bacteria 4019
79 Ga0068864_100107671 3300005618 Bacteria 2480
80 Ga0068864_100224640 3300005618 Bacteria 1734
81 Ga0068861_100043825 3300005719 Bacteria 3361
82 Ga0068861_100057966 3300005719 Bacteria 2960
83 Ga0068861_100426578 3300005719 Bacteria 1183
84 Ga0068851_10000364 3300005834 Bacteria 20414
85 Ga0068851_10006087 3300005834 Bacteria 5504
86 Ga0068851_10133462 3300005834 Bacteria 1344
87 Ga0068870_10003447 3300005840 Bacteria 6704
88 Ga0068863_100006241 3300005841 Bacteria 11708
89 Ga0068863_100008461 3300005841 Bacteria 10050
90 Ga0068863_100049843 3300005841 Bacteria 3970
91 Ga0068863_100187810 3300005841 Bacteria 1985
92 Ga0068858_100027945 3300005842 Bacteria 5242
93 Ga0068860_100014090 3300005843 Bacteria 7844
94 Ga0068860_100145794 3300005843 Bacteria 2278
95 Ga0068860_100311569 3300005843 Bacteria 1543
96 Ga0068862_100381090 3300005844 Bacteria 1315
97 Ga0070715_10047649 3300006163 Bacteria 1828
98 Ga0070715_10151957 3300006163 Bacteria 1135
99 Ga0097621_100023484 3300006237 Bacteria 4802
100 Ga0097621_100073034 3300006237 Bacteria 2839
101 Ga0068871_100017336 3300006358 Bacteria 5446
102 Ga0068871_100037829 3300006358 Bacteria 3851
103 Ga0068871_100148214 3300006358 Bacteria 2000
104 Ga0068871_100369598 3300006358 Bacteria 1272
105 Ga0075428_100036856 3300006844 Bacteria 5385
106 Ga0075428_100293334 3300006844 Bacteria 1749
107 Ga0068865_100015150 3300006881 Bacteria 4913
108 Ga0068865_100027856 3300006881 Bacteria 3737
109 Ga0068865_100406747 3300006881 Bacteria 1116
110 Ga0105240_10009562 3300009093 Bacteria 13725
111 Ga0105240_10044573 3300009093 Bacteria 5635
112 Ga0111539_10005241 3300009094 Bacteria 16795
113 Ga0111539_10009709 3300009094 Bacteria 12145
114 Ga0111539_10302442 3300009094 Bacteria 1862
115 Ga0111539_10462570 3300009094 Bacteria 1477
116 Ga0114129_10309187 3300009147 Bacteria 2104
117 Ga0105243_11040919 3300009148 Unclassified 823
118 Ga0105241_10729219 3300009174 Bacteria 907
119 Ga0105248_10009560 3300009177 Bacteria 10671
120 Ga0105248_10193830 3300009177 Bacteria 2289
121 Ga0105237_10156214 3300009545 Bacteria 2278
122 Ga0157373_10003717 3300013100 Bacteria 11545
123 Ga0157371_10173845 3300013102 Bacteria 1539
124 Ga0157370_10015373 3300013104 Bacteria 7779
125 Ga0157370_10042224 3300013104 Bacteria 4396
126 Ga0157374_10039116 3300013296 Bacteria 4364
127 Ga0157374_10189367 3300013296 Bacteria 2012
128 Ga0157374_10234469 3300013296 Bacteria 1804
129 Ga0157378_10705527 3300013297 Bacteria 1029
130 Ga0163162_10208135 3300013306 Bacteria 2085
131 Ga0163162_10299557 3300013306 Bacteria 1740
132 Ga0157372_10038365 3300013307 Bacteria 5286
133 Ga0157372_10216452 3300013307 Bacteria 2220
134 Ga0157375_10035881 3300013308 Bacteria 4738
135 Ga0157375_10052494 3300013308 Bacteria 4008
136 Ga0157375_10164124 3300013308 Bacteria 2365
137 Ga0157375_11004425 3300013308 Bacteria 974
138 Ga0163163_10005036 3300014325 Bacteria 11387
139 Ga0163163_10131734 3300014325 Bacteria 2540
140 Ga0157380_10000443 3300014326 Bacteria 25341
141 Ga0157380_10119592 3300014326 Bacteria 2229
142 Ga0157380_10430873 3300014326 Bacteria 1261
143 Ga0157380_10461287 3300014326 Bacteria 1223
144 Ga0157377_10244145 3300014745 Bacteria 1161
145 Ga0157379_10061512 3300014968 Bacteria 3357
146 Ga0163161_10001536 3300017792 Bacteria 17042
147 Ga0163161_10025983 3300017792 Bacteria 4147
148 Ga0163161_10031468 3300017792 Bacteria 3781
149 Ga0163161_10064872 3300017792 Bacteria 2665
150 Ga0213871_10000168 3300021441 Bacteria 7155
151 Ga0207697_10031128 3300025315 Bacteria 2183
152 Ga0207656_10051501 3300025321 Bacteria 1780
153 Ga0207656_10059692 3300025321 Bacteria 1670
154 Ga0207682_10000696 3300025893 Bacteria 15554
155 Ga0207682_10001581 3300025893 Bacteria 10476
156 Ga0207692_10080376 3300025898 Bacteria 1742
157 Ga0207642_10029203 3300025899 Bacteria 2281
158 Ga0207642_10238225 3300025899 Bacteria 1026
159 Ga0207680_10003849 3300025903 Bacteria 7065
160 Ga0207680_10051668 3300025903 Bacteria 2459
161 Ga0207699_10134542 3300025906 Bacteria 1617
162 Ga0207645_10000077 3300025907 Bacteria 69960
163 Ga0207645_10018732 3300025907 Bacteria 4547
164 Ga0207643_10003908 3300025908 Bacteria 8022
165 Ga0207705_10159568 3300025909 Bacteria 1694
166 Ga0207707_10068959 3300025912 Bacteria 3082
167 Ga0207707_10294992 3300025912 Bacteria 1402
168 Ga0207695_10029541 3300025913 Bacteria 6053
169 Ga0207663_10101871 3300025916 Bacteria 1930
170 Ga0207660_10502887 3300025917 Bacteria 983
171 Ga0207660_10561095 3300025917 Bacteria 929
172 Ga0207649_10014459 3300025920 Bacteria 4420
173 Ga0207652_10081892 3300025921 Bacteria 2823
174 Ga0207652_10137928 3300025921 Bacteria 2179
175 Ga0207652_10281724 3300025921 Bacteria 1500
176 Ga0207681_10012240 3300025923 Bacteria 5291
177 Ga0207681_10082783 3300025923 Bacteria 2269
178 Ga0207681_10118027 3300025923 Bacteria 1941
179 Ga0207681_10211771 3300025923 Bacteria 1494
180 Ga0207650_10001400 3300025925 Bacteria 17395
181 Ga0207650_10010912 3300025925 Bacteria 6244
182 Ga0207650_10037114 3300025925 Bacteria 3549
183 Ga0207650_10043367 3300025925 Bacteria 3302
184 Ga0207650_10083976 3300025925 Bacteria 2420
185 Ga0207650_10529010 3300025925 Bacteria 987
186 Ga0207659_10024632 3300025926 Bacteria 4035
187 Ga0207659_10026264 3300025926 Bacteria 3927
188 Ga0207659_10028496 3300025926 Bacteria 3796
189 Ga0207659_10330331 3300025926 Bacteria 1260
190 Ga0207700_10042285 3300025928 Bacteria 3340
191 Ga0207700_10465697 3300025928 Bacteria 1115
192 Ga0207664_10000411 3300025929 Bacteria 30634
193 Ga0207664_10119642 3300025929 Bacteria 2202
194 Ga0207644_10014425 3300025931 Bacteria 5285
195 Ga0207644_10033514 3300025931 Bacteria 3589
196 Ga0207644_10033615 3300025931 Bacteria 3585
197 Ga0207644_10062602 3300025931 Bacteria 2699
198 Ga0207644_10104241 3300025931 Bacteria 2135
199 Ga0207690_10055395 3300025932 Bacteria 2670
200 Ga0207690_10076542 3300025932 Bacteria 2323
201 Ga0207706_10012482 3300025933 Bacteria 7739
202 Ga0207706_10073326 3300025933 Bacteria 3010
203 Ga0207706_10079150 3300025933 Bacteria 2891
204 Ga0207706_10093142 3300025933 Bacteria 2650
205 Ga0207686_10137541 3300025934 Bacteria 1684
206 Ga0207709_10204297 3300025935 Bacteria 1413
207 Ga0207670_10095655 3300025936 Bacteria 2110
208 Ga0207670_10633477 3300025936 Bacteria 880
209 Ga0207669_10008596 3300025937 Bacteria 4802
210 Ga0207669_10080622 3300025937 Bacteria 2082
211 Ga0207704_10018467 3300025938 Bacteria 3641
212 Ga0207704_10060076 3300025938 Bacteria 2350
213 Ga0207691_10000499 3300025940 Bacteria 39022
214 Ga0207691_10002200 3300025940 Bacteria 19071
215 Ga0207691_10020442 3300025940 Bacteria 6258
216 Ga0207691_10033687 3300025940 Bacteria 4770
217 Ga0207711_10008586 3300025941 Bacteria 8539
218 Ga0207711_10340745 3300025941 Bacteria 1387
219 Ga0207689_10001066 3300025942 Bacteria 26408
220 Ga0207679_10015538 3300025945 Bacteria 5034
221 Ga0207667_10121645 3300025949 Bacteria 2689
222 Ga0207651_10010025 3300025960 Bacteria 5225
223 Ga0207651_10018238 3300025960 Bacteria 4170
224 Ga0207651_10059047 3300025960 Bacteria 2654
225 Ga0207651_10229935 3300025960 Bacteria 1505
226 Ga0207651_10387929 3300025960 Bacteria 1185
227 Ga0207712_10142286 3300025961 Bacteria 1842
228 Ga0207668_10006140 3300025972 Bacteria 7086
229 Ga0207668_10018793 3300025972 Bacteria 4357
230 Ga0207668_10305462 3300025972 Bacteria 1314
231 Ga0207668_10495473 3300025972 Bacteria 1050
232 Ga0207640_10016355 3300025981 Bacteria 4314
233 Ga0207640_10445984 3300025981 Bacteria 1065
234 Ga0207658_10040272 3300025986 Bacteria 3376
235 Ga0207677_10171016 3300026023 Bacteria 1699
236 Ga0207677_10280384 3300026023 Bacteria 1368
237 Ga0207677_10880161 3300026023 Bacteria 806
238 Ga0207703_10511524 3300026035 Bacteria 1128
239 Ga0207639_10032160 3300026041 Bacteria 3860
240 Ga0207639_10384914 3300026041 Bacteria 1260
241 Ga0207678_10014734 3300026067 Bacteria 6879
242 Ga0207678_10237336 3300026067 Bacteria 1561
243 Ga0207708_10257001 3300026075 Bacteria 1409
244 Ga0207702_10424728 3300026078 Bacteria 1286
245 Ga0207641_10012469 3300026088 Bacteria 6968
246 Ga0207641_10017974 3300026088 Bacteria 5792
247 Ga0207641_10085839 3300026088 Bacteria 2743
248 Ga0207641_10108211 3300026088 Bacteria 2460
249 Ga0207641_10699389 3300026088 Bacteria 998
250 Ga0207648_10000589 3300026089 Bacteria 40773
251 Ga0207648_10001872 3300026089 Bacteria 23010
252 Ga0207648_10024655 3300026089 Bacteria 5366
253 Ga0207676_10008388 3300026095 Bacteria 7345
254 Ga0207676_10018746 3300026095 Bacteria 5037
255 Ga0207676_10035610 3300026095 Bacteria 3780
256 Ga0207676_10188978 3300026095 Bacteria 1811
257 Ga0207676_10726666 3300026095 Bacteria 964
258 Ga0207674_10006474 3300026116 Bacteria 13767
259 Ga0207674_10287022 3300026116 Bacteria 1594
260 Ga0207675_100026138 3300026118 Bacteria 5434
261 Ga0207675_100041498 3300026118 Bacteria 4297
262 Ga0207675_100070599 3300026118 Bacteria 3264
263 Ga0207675_100097755 3300026118 Bacteria 2765
264 Ga0207675_100133216 3300026118 Bacteria 2357
265 Ga0207683_10000280 3300026121 Bacteria 45558
266 Ga0207683_10006222 3300026121 Bacteria 10230
267 Ga0207683_10160497 3300026121 Bacteria 2032
268 Ga0207698_10037926 3300026142 Bacteria 3555
269 Ga0207698_10107909 3300026142 Bacteria 2325
270 Ga0207698_10133354 3300026142 Bacteria 2127
271 Ga0207698_10283810 3300026142 Bacteria 1533
272 Ga0209968_1011942 3300027526 Bacteria 1351
273 Ga0209971_1013211 3300027682 Bacteria 1956
274 Ga0209966_1027732 3300027695 Bacteria 1134
275 Ga0207428_10014978 3300027907 Bacteria 6719
276 Ga0207428_10068166 3300027907 Unclassified 2799
277 Ga0268266_10012687 3300028379 Bacteria 7281
278 Ga0268266_10069890 3300028379 Bacteria 3043
279 Ga0268265_10128898 3300028380 Bacteria 2098
280 Ga0268265_10156762 3300028380 Bacteria 1928
281 Ga0268264_10032305 3300028381 Bacteria 4294
282 Ga0268264_10100821 3300028381 Bacteria 2508
283 Ga0268264_10672590 3300028381 Bacteria 1026
284 Ga0265327_10173294 3300031251 Unclassified 990
285 Ga0316579_10063727 3300031691 Bacteria 1738
286 Ga0316576_10069782 3300031727 Bacteria 2591
287 Ga0307405_10263485 3300031731 Bacteria 1289
288 Ga0373926_0154185 3300035083 Bacteria 875
289 Ga0373934_0153228 3300035086 Bacteria 944
290 Ga0373923_0111242 3300035111 Bacteria 1216
291 Ga0373945_0093200 3300035116 Bacteria 1169
292 Ga0373956_0119559 3300035119 Bacteria 1230
293 Ga0373943_0178122 3300035170 Bacteria 1167
294 Ga0373943_0198032 3300035170 Bacteria 1111
295 Ga0373955_0060068 3300035172 Bacteria 2096
296 Ga0316574_0067950 3300035398 Bacteria 2247
297 Ga0373927_0199385 3300035695 Bacteria 1314
298 Ga0373937_0049928 3300036401 Bacteria 3831
299 Ga0316582_0442418 3300036647 Unclassified 896
300 Ga0316584_0032417 3300036712 Bacteria 3868
301 Ga0373925_0175049 3300037068 Bacteria 1695
302 Ga0436364_1418610 3300037853 Bacteria 3688
303 Ga0436364_1536001 3300037853 Bacteria 7107
304 Ga0436360_0726393 3300039438 Bacteria 23002
305 Ga0436362_0312415 3300039453 Bacteria 1207
306 Ga0439466_0003187 3300041411 Bacteria 6384
307 Ga0451853_0884497 3300041512 Bacteria 2479
308 Ga0453684_0989252 3300044712 Bacteria 895
309 Ga0466970_0075111 3300044765 Bacteria 1820
310 Ga0451576_0000020 3300045051 Bacteria 529568
311 Ga0466958_0086891 3300045836 Bacteria 1930
312 Ga0466967_0013563 3300045976 Bacteria 6304
313 Ga0495592_0108079 3300046454 Bacteria 1972
314 Ga0495651_0037256 3300046462 Bacteria 3786
315 Ga0495664_0250775 3300046477 Bacteria 1070
316 Ga0495608_0263954 3300046511 Bacteria 1071
317 Ga0495618_0061664 3300046514 Bacteria 2379
318 Ga0495628_0040970 3300046516 Bacteria 3698
319 Ga0495630_0899819 3300046517 Bacteria 674
320 Ga0495652_0068139 3300046529 Bacteria 2982
321 Ga0495640_0171654 3300046533 Bacteria 1385
322 Ga0495645_0179521 3300046543 Bacteria 1451
323 Ga0495657_0365286 3300046675 Bacteria 852
324 Ga0495599_0025399 3300046678 Bacteria 3708
325 Ga0495646_0388706 3300046680 Bacteria 727
326 Ga0495647_0029676 3300046681 Bacteria 2024
327 Ga0495658_0204185 3300046683 Bacteria 1233
328 Ga0495658_0272370 3300046683 Bacteria 1067
329 Ga0495613_0464227 3300046689 Bacteria 856
330 Ga0495604_0229970 3300047317 Bacteria 1272
331 Ga0495674_0662581 3300047319 Bacteria 822
332 Ga0495680_0075825 3300047322 Bacteria 2551
333 Ga0495684_0096049 3300047471 Bacteria 2243
334 Ga0495602_0230525 3300048088 Bacteria 1392
335 Ga0496100_0815508 3300048903 Bacteria 731
336 Ga0496104_0994671 3300048907 Bacteria 743
337 Ga0496106_0120789 3300048909 Bacteria 2048
338 Ga0496106_0456155 3300048909 Bacteria 1027
339 Ga0496108_0691251 3300048911 Bacteria 885
340 Ga0496110_0154028 3300048913 Bacteria 2082
341 Ga0496112_0779338 3300048915 Bacteria 882
342 Ga0496114_0533342 3300048917 Unclassified 1038
343 Ga0501294_013802 3300049517 Unclassified 821
344 Ga0501242_013138 3300049674 Bacteria 1014
345 nmdc:mga05p37_393366_c1 3300050507 Bacteria 1620
346 nmdc:mga06r32_595827_c1 3300050510 Unclassified 1076
347 nmdc:mga08y16_28509_c1 3300050511 Bacteria 5886
348 nmdc:mga08y16_406117_c1 3300050511 Bacteria 1393
349 nmdc:mga08y16_719284_c1 3300050511 Bacteria 997
350 Ga0495595_0040672 3300053084 Bacteria 2125

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049517 Ga0501294_013802 Ga0501294_013802_82_615 177
2 3300035398 Ga0316574_0067950 Ga0316574_0067950_254_799 180
3 3300046517 Ga0495630_0899819 Ga0495630_0899819_53_598 180
4 3300046680 Ga0495646_0388706 Ga0495646_0388706_19_564 180
5 3300005530 Ga0070679_100192879 Ga0070679_1001928791 198
6 3300025921 Ga0207652_10137928 Ga0207652_101379282 198
7 3300035086 Ga0373934_0153228 Ga0373934_0153228_252_851 198
8 3300035111 Ga0373923_0111242 Ga0373923_0111242_541_1140 198
9 3300035116 Ga0373945_0093200 Ga0373945_0093200_103_702 198
10 3300035119 Ga0373956_0119559 Ga0373956_0119559_42_641 198
11 3300035172 Ga0373955_0060068 Ga0373955_0060068_269_868 198
12 3300035695 Ga0373927_0199385 Ga0373927_0199385_206_805 198
13 3300036401 Ga0373937_0049928 Ga0373937_0049928_1789_2388 198
14 3300037068 Ga0373925_0175049 Ga0373925_0175049_960_1559 198
15 3300046454 Ga0495592_0108079 Ga0495592_0108079_1319_1918 198
16 3300046462 Ga0495651_0037256 Ga0495651_0037256_1529_2128 198
17 3300046477 Ga0495664_0250775 Ga0495664_0250775_79_678 198
18 3300046511 Ga0495608_0263954 Ga0495608_0263954_171_770 198
19 3300046514 Ga0495618_0061664 Ga0495618_0061664_1178_1777 198
20 3300046516 Ga0495628_0040970 Ga0495628_0040970_1398_1997 198
21 3300046529 Ga0495652_0068139 Ga0495652_0068139_2329_2928 198
22 3300046533 Ga0495640_0171654 Ga0495640_0171654_207_806 198
23 3300046543 Ga0495645_0179521 Ga0495645_0179521_516_1115 198
24 3300046675 Ga0495657_0365286 Ga0495657_0365286_167_766 198
25 3300046678 Ga0495599_0025399 Ga0495599_0025399_2661_3260 198
26 3300046683 Ga0495658_0272370 Ga0495658_0272370_356_955 198
27 3300046689 Ga0495613_0464227 Ga0495613_0464227_59_658 198
28 3300047317 Ga0495604_0229970 Ga0495604_0229970_267_866 198
29 3300047319 Ga0495674_0662581 Ga0495674_0662581_184_783 198
30 3300047322 Ga0495680_0075825 Ga0495680_0075825_504_1103 198
31 3300047471 Ga0495684_0096049 Ga0495684_0096049_644_1243 198
32 3300048088 Ga0495602_0230525 Ga0495602_0230525_533_1132 198
33 3300053084 Ga0495595_0040672 Ga0495595_0040672_148_747 198
34 3300005458 Ga0070681_10228102 Ga0070681_102281022 201
35 3300005530 Ga0070679_100346337 Ga0070679_1003463372 201
36 3300025912 Ga0207707_10068959 Ga0207707_100689593 201
37 3300025921 Ga0207652_10281724 Ga0207652_102817242 201
38 3300037853 Ga0436364_1536001 Ga0436364_1536001_4016_4621 201
39 3300005366 Ga0070659_100003342 Ga0070659_1000033421 202
40 3300005834 Ga0068851_10000364 Ga0068851_100003643 202
41 3300009093 Ga0105240_10044573 Ga0105240_100445736 202
42 3300009545 Ga0105237_10156214 Ga0105237_101562142 202
43 3300048917 Ga0496114_0533342 Ga0496114_0533342_48_668 205
44 iso_pu_bacteria 2728369097 2729145331 207
45 3300025907 Ga0207645_10018732 Ga0207645_100187324 208
46 3300041411 Ga0439466_0003187 Ga0439466_0003187_4268_4915 210
47 3300005327 Ga0070658_10010401 Ga0070658_100104012 211
48 3300005331 Ga0070670_100014220 Ga0070670_1000142206 211
49 3300005331 Ga0070670_100074495 Ga0070670_1000744952 211
50 3300005333 Ga0070677_10013334 Ga0070677_100133344 211
51 3300005335 Ga0070666_10027339 Ga0070666_100273392 211
52 3300005344 Ga0070661_100008060 Ga0070661_1000080606 211
53 3300005367 Ga0070667_100091421 Ga0070667_1000914212 211
54 3300005434 Ga0070709_10140780 Ga0070709_101407802 211
55 3300005435 Ga0070714_100000389 Ga0070714_1000003896 211
56 3300005436 Ga0070713_100018733 Ga0070713_1000187334 211
57 3300005436 Ga0070713_100588041 Ga0070713_1005880412 211
58 3300005437 Ga0070710_10065207 Ga0070710_100652073 211
59 3300005439 Ga0070711_100058017 Ga0070711_1000580174 211
60 3300005458 Ga0070681_10256164 Ga0070681_102561642 211
61 3300005518 Ga0070699_100233718 Ga0070699_1002337182 211
62 3300005530 Ga0070679_100060749 Ga0070679_1000607493 211
63 3300005546 Ga0070696_100018595 Ga0070696_1000185955 211
64 3300005548 Ga0070665_100017479 Ga0070665_1000174799 211
65 3300005548 Ga0070665_100483899 Ga0070665_1004838992 211
66 3300005563 Ga0068855_100145704 Ga0068855_1001457042 211
67 3300005616 Ga0068852_100001886 Ga0068852_10000188612 211
68 3300005618 Ga0068864_100003448 Ga0068864_10000344813 211
69 3300005841 Ga0068863_100008461 Ga0068863_1000084611 211
70 3300005841 Ga0068863_100049843 Ga0068863_1000498432 211
71 3300005843 Ga0068860_100145794 Ga0068860_1001457943 211
72 3300006163 Ga0070715_10151957 Ga0070715_101519571 211
73 3300006237 Ga0097621_100073034 Ga0097621_1000730342 211
74 3300006358 Ga0068871_100017336 Ga0068871_1000173366 211
75 3300006844 Ga0075428_100293334 Ga0075428_1002933342 211
76 3300009093 Ga0105240_10009562 Ga0105240_100095626 211
77 3300009147 Ga0114129_10309187 Ga0114129_103091872 211
78 3300009148 Ga0105243_11040919 Ga0105243_110409191 211
79 3300009174 Ga0105241_10729219 Ga0105241_107292191 211
80 3300009177 Ga0105248_10009560 Ga0105248_100095609 211
81 3300009177 Ga0105248_10193830 Ga0105248_101938303 211
82 3300013102 Ga0157371_10173845 Ga0157371_101738452 211
83 3300013104 Ga0157370_10015373 Ga0157370_100153739 211
84 3300013296 Ga0157374_10039116 Ga0157374_100391166 211
85 3300013306 Ga0163162_10208135 Ga0163162_102081352 211
86 3300013306 Ga0163162_10299557 Ga0163162_102995572 211
87 3300013307 Ga0157372_10038365 Ga0157372_100383656 211
88 3300013307 Ga0157372_10216452 Ga0157372_102164522 211
89 3300013308 Ga0157375_10052494 Ga0157375_100524942 211
90 3300013308 Ga0157375_10164124 Ga0157375_101641242 211
91 3300014325 Ga0163163_10005036 Ga0163163_100050362 211
92 3300014745 Ga0157377_10244145 Ga0157377_102441452 211
93 3300017792 Ga0163161_10025983 Ga0163161_100259835 211
94 3300025893 Ga0207682_10000696 Ga0207682_100006967 211
95 3300025898 Ga0207692_10080376 Ga0207692_100803761 211
96 3300025903 Ga0207680_10003849 Ga0207680_100038496 211
97 3300025906 Ga0207699_10134542 Ga0207699_101345423 211
98 3300025909 Ga0207705_10159568 Ga0207705_101595682 211
99 3300025912 Ga0207707_10294992 Ga0207707_102949922 211
100 3300025913 Ga0207695_10029541 Ga0207695_100295412 211
101 3300025916 Ga0207663_10101871 Ga0207663_101018713 211
102 3300025917 Ga0207660_10502887 Ga0207660_105028871 211
103 3300025917 Ga0207660_10561095 Ga0207660_105610952 211
104 3300025920 Ga0207649_10014459 Ga0207649_100144595 211
105 3300025921 Ga0207652_10081892 Ga0207652_100818923 211
106 3300025923 Ga0207681_10082783 Ga0207681_100827832 211
107 3300025923 Ga0207681_10211771 Ga0207681_102117712 211
108 3300025925 Ga0207650_10001400 Ga0207650_100014007 211
109 3300025925 Ga0207650_10010912 Ga0207650_100109127 211
110 3300025925 Ga0207650_10043367 Ga0207650_100433675 211
111 3300025925 Ga0207650_10083976 Ga0207650_100839763 211
112 3300025926 Ga0207659_10026264 Ga0207659_100262644 211
113 3300025928 Ga0207700_10042285 Ga0207700_100422853 211
114 3300025928 Ga0207700_10465697 Ga0207700_104656971 211
115 3300025929 Ga0207664_10000411 Ga0207664_100004112 211
116 3300025929 Ga0207664_10119642 Ga0207664_101196422 211
117 3300025931 Ga0207644_10014425 Ga0207644_100144255 211
118 3300025931 Ga0207644_10033514 Ga0207644_100335145 211
119 3300025931 Ga0207644_10104241 Ga0207644_101042412 211
120 3300025932 Ga0207690_10055395 Ga0207690_100553953 211
121 3300025932 Ga0207690_10076542 Ga0207690_100765422 211
122 3300025933 Ga0207706_10093142 Ga0207706_100931422 211
123 3300025936 Ga0207670_10095655 Ga0207670_100956552 211
124 3300025936 Ga0207670_10633477 Ga0207670_106334771 211
125 3300025940 Ga0207691_10033687 Ga0207691_100336875 211
126 3300025941 Ga0207711_10008586 Ga0207711_100085865 211
127 3300025942 Ga0207689_10001066 Ga0207689_1000106617 211
128 3300025945 Ga0207679_10015538 Ga0207679_100155382 211
129 3300025949 Ga0207667_10121645 Ga0207667_101216453 211
130 3300025960 Ga0207651_10059047 Ga0207651_100590471 211
131 3300026023 Ga0207677_10880161 Ga0207677_108801611 211
132 3300026041 Ga0207639_10384914 Ga0207639_103849141 211
133 3300026088 Ga0207641_10017974 Ga0207641_100179745 211
134 3300026089 Ga0207648_10001872 Ga0207648_100018729 211
135 3300026095 Ga0207676_10008388 Ga0207676_100083887 211
136 3300026095 Ga0207676_10018746 Ga0207676_100187465 211
137 3300026095 Ga0207676_10726666 Ga0207676_107266662 211
138 3300026116 Ga0207674_10006474 Ga0207674_1000647417 211
139 3300026116 Ga0207674_10287022 Ga0207674_102870221 211
140 3300026118 Ga0207675_100070599 Ga0207675_1000705995 211
141 3300026118 Ga0207675_100133216 Ga0207675_1001332162 211
142 3300026121 Ga0207683_10006222 Ga0207683_100062228 211
143 3300026142 Ga0207698_10107909 Ga0207698_101079092 211
144 3300027526 Ga0209968_1011942 Ga0209968_10119422 211
145 3300027682 Ga0209971_1013211 Ga0209971_10132112 211
146 3300027695 Ga0209966_1027732 Ga0209966_10277321 211
147 3300027907 Ga0207428_10014978 Ga0207428_100149783 211
148 3300028379 Ga0268266_10069890 Ga0268266_100698902 211
149 3300035083 Ga0373926_0154185 Ga0373926_0154185_211_858 211
150 3300035170 Ga0373943_0178122 Ga0373943_0178122_465_1112 211
151 3300035170 Ga0373943_0198032 Ga0373943_0198032_30_677 211
152 3300041512 Ga0451853_0884497 Ga0451853_0884497_311_958 211
153 3300045836 Ga0466958_0086891 Ga0466958_0086891_810_1460 211
154 3300045976 Ga0466967_0013563 Ga0466967_0013563_1376_2017 211
155 3300046681 Ga0495647_0029676 Ga0495647_0029676_1235_1882 211
156 3300046683 Ga0495658_0204185 Ga0495658_0204185_359_1006 211
157 3300048903 Ga0496100_0815508 Ga0496100_0815508_56_703 211
158 3300048907 Ga0496104_0994671 Ga0496104_0994671_10_645 211
159 3300048909 Ga0496106_0120789 Ga0496106_0120789_1327_1974 211
160 3300048909 Ga0496106_0456155 Ga0496106_0456155_125_772 211
161 3300048911 Ga0496108_0691251 Ga0496108_0691251_46_681 211
162 3300048913 Ga0496110_0154028 Ga0496110_0154028_1192_1827 211
163 3300048915 Ga0496112_0779338 Ga0496112_0779338_213_863 211
164 3300050507 nmdc:mga05p37_393366_c1 nmdc:mga05p37_393366_c1_460_1107 211
165 3300050511 nmdc:mga08y16_406117_c1 nmdc:mga08y16_406117_c1_631_1266 211
166 3300005288 Ga0065714_10002361 Ga0065714_1000236129 212
167 3300005327 Ga0070658_10072046 Ga0070658_100720462 212
168 3300005328 Ga0070676_10005638 Ga0070676_100056389 212
169 3300005331 Ga0070670_100050599 Ga0070670_1000505993 212
170 3300005333 Ga0070677_10001405 Ga0070677_100014058 212
171 3300005335 Ga0070666_10355733 Ga0070666_103557331 212
172 3300005338 Ga0068868_100042177 Ga0068868_1000421773 212
173 3300005347 Ga0070668_100003054 Ga0070668_10000305412 212
174 3300005347 Ga0070668_100023224 Ga0070668_1000232247 212
175 3300005347 Ga0070668_100047798 Ga0070668_1000477982 212
176 3300005347 Ga0070668_100827731 Ga0070668_1008277311 212
177 3300005354 Ga0070675_100001486 Ga0070675_10000148611 212
178 3300005354 Ga0070675_100028788 Ga0070675_1000287883 212
179 3300005355 Ga0070671_100003732 Ga0070671_1000037327 212
180 3300005355 Ga0070671_100108365 Ga0070671_1001083652 212
181 3300005355 Ga0070671_100325729 Ga0070671_1003257292 212
182 3300005356 Ga0070674_100001820 Ga0070674_1000018205 212
183 3300005356 Ga0070674_100051552 Ga0070674_1000515522 212
184 3300005356 Ga0070674_100657201 Ga0070674_1006572012 212
185 3300005364 Ga0070673_100000369 Ga0070673_10000036911 212
186 3300005364 Ga0070673_100295694 Ga0070673_1002956942 212
187 3300005367 Ga0070667_100036242 Ga0070667_1000362422 212
188 3300005367 Ga0070667_100060915 Ga0070667_1000609151 212
189 3300005441 Ga0070700_100109959 Ga0070700_1001099593 212
190 3300005455 Ga0070663_100049206 Ga0070663_1000492062 212
191 3300005456 Ga0070678_100005428 Ga0070678_1000054285 212
192 3300005456 Ga0070678_100213917 Ga0070678_1002139172 212
193 3300005456 Ga0070678_100706546 Ga0070678_1007065461 212
194 3300005457 Ga0070662_100070344 Ga0070662_1000703443 212
195 3300005457 Ga0070662_100143780 Ga0070662_1001437802 212
196 3300005458 Ga0070681_10234071 Ga0070681_102340712 212
197 3300005459 Ga0068867_100003972 Ga0068867_1000039729 212
198 3300005459 Ga0068867_100005139 Ga0068867_1000051399 212
199 3300005466 Ga0070685_10095298 Ga0070685_100952981 212
200 3300005539 Ga0068853_100031444 Ga0068853_1000314444 212
201 3300005543 Ga0070672_100000746 Ga0070672_1000007462 212
202 3300005543 Ga0070672_100028426 Ga0070672_1000284265 212
203 3300005543 Ga0070672_100061830 Ga0070672_1000618302 212
204 3300005548 Ga0070665_100006570 Ga0070665_1000065705 212
205 3300005548 Ga0070665_100062880 Ga0070665_1000628804 212
206 3300005549 Ga0070704_100325412 Ga0070704_1003254122 212
207 3300005564 Ga0070664_100164216 Ga0070664_1001642162 212
208 3300005577 Ga0068857_100454359 Ga0068857_1004543592 212
209 3300005614 Ga0068856_100504643 Ga0068856_1005046431 212
210 3300005616 Ga0068852_100005100 Ga0068852_1000051006 212
211 3300005616 Ga0068852_100216530 Ga0068852_1002165303 212
212 3300005616 Ga0068852_100366796 Ga0068852_1003667962 212
213 3300005616 Ga0068852_100594214 Ga0068852_1005942142 212
214 3300005618 Ga0068864_100039778 Ga0068864_1000397785 212
215 3300005618 Ga0068864_100107671 Ga0068864_1001076712 212
216 3300005618 Ga0068864_100224640 Ga0068864_1002246402 212
217 3300005719 Ga0068861_100043825 Ga0068861_1000438253 212
218 3300005719 Ga0068861_100057966 Ga0068861_1000579663 212
219 3300005719 Ga0068861_100426578 Ga0068861_1004265781 212
220 3300005834 Ga0068851_10006087 Ga0068851_100060873 212
221 3300005834 Ga0068851_10133462 Ga0068851_101334622 212
222 3300005840 Ga0068870_10003447 Ga0068870_100034472 212
223 3300005841 Ga0068863_100006241 Ga0068863_1000062412 212
224 3300005841 Ga0068863_100187810 Ga0068863_1001878102 212
225 3300005842 Ga0068858_100027945 Ga0068858_1000279454 212
226 3300005843 Ga0068860_100014090 Ga0068860_1000140905 212
227 3300005843 Ga0068860_100311569 Ga0068860_1003115692 212
228 3300005844 Ga0068862_100381090 Ga0068862_1003810901 212
229 3300006163 Ga0070715_10047649 Ga0070715_100476492 212
230 3300006237 Ga0097621_100023484 Ga0097621_1000234842 212
231 3300006358 Ga0068871_100037829 Ga0068871_1000378294 212
232 3300006358 Ga0068871_100148214 Ga0068871_1001482142 212
233 3300006358 Ga0068871_100369598 Ga0068871_1003695982 212
234 3300006881 Ga0068865_100015150 Ga0068865_1000151507 212
235 3300006881 Ga0068865_100027856 Ga0068865_1000278564 212
236 3300006881 Ga0068865_100406747 Ga0068865_1004067472 212
237 3300009094 Ga0111539_10302442 Ga0111539_103024422 212
238 3300009094 Ga0111539_10462570 Ga0111539_104625702 212
239 3300013100 Ga0157373_10003717 Ga0157373_100037178 212
240 3300013296 Ga0157374_10189367 Ga0157374_101893672 212
241 3300013296 Ga0157374_10234469 Ga0157374_102344692 212
242 3300013297 Ga0157378_10705527 Ga0157378_107055271 212
243 3300013308 Ga0157375_10035881 Ga0157375_100358816 212
244 3300013308 Ga0157375_11004425 Ga0157375_110044252 212
245 3300014325 Ga0163163_10131734 Ga0163163_101317341 212
246 3300014326 Ga0157380_10119592 Ga0157380_101195922 212
247 3300014326 Ga0157380_10430873 Ga0157380_104308732 212
248 3300014326 Ga0157380_10461287 Ga0157380_104612872 212
249 3300014968 Ga0157379_10061512 Ga0157379_100615123 212
250 3300017792 Ga0163161_10001536 Ga0163161_100015367 212
251 3300017792 Ga0163161_10031468 Ga0163161_100314685 212
252 3300017792 Ga0163161_10064872 Ga0163161_100648724 212
253 3300021441 Ga0213871_10000168 Ga0213871_1000016812 212
254 3300025315 Ga0207697_10031128 Ga0207697_100311283 212
255 3300025321 Ga0207656_10051501 Ga0207656_100515012 212
256 3300025321 Ga0207656_10059692 Ga0207656_100596921 212
257 3300025893 Ga0207682_10001581 Ga0207682_100015817 212
258 3300025899 Ga0207642_10029203 Ga0207642_100292032 212
259 3300025899 Ga0207642_10238225 Ga0207642_102382252 212
260 3300025903 Ga0207680_10051668 Ga0207680_100516682 212
261 3300025907 Ga0207645_10000077 Ga0207645_1000007741 212
262 3300025908 Ga0207643_10003908 Ga0207643_100039089 212
263 3300025923 Ga0207681_10012240 Ga0207681_100122401 212
264 3300025923 Ga0207681_10118027 Ga0207681_101180273 212
265 3300025925 Ga0207650_10037114 Ga0207650_100371143 212
266 3300025925 Ga0207650_10529010 Ga0207650_105290101 212
267 3300025926 Ga0207659_10024632 Ga0207659_100246322 212
268 3300025926 Ga0207659_10028496 Ga0207659_100284961 212
269 3300025926 Ga0207659_10330331 Ga0207659_103303312 212
270 3300025931 Ga0207644_10033615 Ga0207644_100336154 212
271 3300025931 Ga0207644_10062602 Ga0207644_100626023 212
272 3300025933 Ga0207706_10012482 Ga0207706_100124822 212
273 3300025933 Ga0207706_10073326 Ga0207706_100733262 212
274 3300025933 Ga0207706_10079150 Ga0207706_100791504 212
275 3300025934 Ga0207686_10137541 Ga0207686_101375412 212
276 3300025935 Ga0207709_10204297 Ga0207709_102042972 212
277 3300025937 Ga0207669_10008596 Ga0207669_100085965 212
278 3300025937 Ga0207669_10080622 Ga0207669_100806222 212
279 3300025938 Ga0207704_10018467 Ga0207704_100184674 212
280 3300025938 Ga0207704_10060076 Ga0207704_100600762 212
281 3300025940 Ga0207691_10000499 Ga0207691_1000049927 212
282 3300025940 Ga0207691_10002200 Ga0207691_1000220013 212
283 3300025940 Ga0207691_10020442 Ga0207691_100204427 212
284 3300025941 Ga0207711_10340745 Ga0207711_103407452 212
285 3300025960 Ga0207651_10010025 Ga0207651_100100255 212
286 3300025960 Ga0207651_10018238 Ga0207651_100182382 212
287 3300025960 Ga0207651_10229935 Ga0207651_102299352 212
288 3300025960 Ga0207651_10387929 Ga0207651_103879292 212
289 3300025961 Ga0207712_10142286 Ga0207712_101422864 212
290 3300025972 Ga0207668_10006140 Ga0207668_100061405 212
291 3300025972 Ga0207668_10018793 Ga0207668_100187934 212
292 3300025972 Ga0207668_10305462 Ga0207668_103054622 212
293 3300025972 Ga0207668_10495473 Ga0207668_104954732 212
294 3300025981 Ga0207640_10016355 Ga0207640_100163555 212
295 3300025981 Ga0207640_10445984 Ga0207640_104459842 212
296 3300025986 Ga0207658_10040272 Ga0207658_100402722 212
297 3300026023 Ga0207677_10171016 Ga0207677_101710162 212
298 3300026023 Ga0207677_10280384 Ga0207677_102803842 212
299 3300026035 Ga0207703_10511524 Ga0207703_105115242 212
300 3300026041 Ga0207639_10032160 Ga0207639_100321605 212
301 3300026067 Ga0207678_10014734 Ga0207678_100147341 212
302 3300026067 Ga0207678_10237336 Ga0207678_102373362 212
303 3300026075 Ga0207708_10257001 Ga0207708_102570012 212
304 3300026078 Ga0207702_10424728 Ga0207702_104247282 212
305 3300026088 Ga0207641_10012469 Ga0207641_100124697 212
306 3300026088 Ga0207641_10085839 Ga0207641_100858393 212
307 3300026088 Ga0207641_10108211 Ga0207641_101082112 212
308 3300026088 Ga0207641_10699389 Ga0207641_106993892 212
309 3300026089 Ga0207648_10000589 Ga0207648_1000058913 212
310 3300026089 Ga0207648_10024655 Ga0207648_100246552 212
311 3300026095 Ga0207676_10035610 Ga0207676_100356102 212
312 3300026095 Ga0207676_10188978 Ga0207676_101889783 212
313 3300026118 Ga0207675_100026138 Ga0207675_1000261385 212
314 3300026118 Ga0207675_100041498 Ga0207675_1000414983 212
315 3300026118 Ga0207675_100097755 Ga0207675_1000977552 212
316 3300026121 Ga0207683_10000280 Ga0207683_1000028027 212
317 3300026121 Ga0207683_10160497 Ga0207683_101604973 212
318 3300026142 Ga0207698_10037926 Ga0207698_100379264 212
319 3300026142 Ga0207698_10133354 Ga0207698_101333542 212
320 3300026142 Ga0207698_10283810 Ga0207698_102838102 212
321 3300028379 Ga0268266_10012687 Ga0268266_100126877 212
322 3300028380 Ga0268265_10128898 Ga0268265_101288982 212
323 3300028380 Ga0268265_10156762 Ga0268265_101567622 212
324 3300028381 Ga0268264_10032305 Ga0268264_100323052 212
325 3300028381 Ga0268264_10100821 Ga0268264_101008212 212
326 3300028381 Ga0268264_10672590 Ga0268264_106725902 212
327 3300031251 Ga0265327_10173294 Ga0265327_101732941 212
328 3300031691 Ga0316579_10063727 Ga0316579_100637272 212
329 3300031727 Ga0316576_10069782 Ga0316576_100697822 212
330 3300031731 Ga0307405_10263485 Ga0307405_102634852 212
331 3300036647 Ga0316582_0442418 Ga0316582_0442418_104_760 212
332 3300036712 Ga0316584_0032417 Ga0316584_0032417_2153_2809 212
333 3300037853 Ga0436364_1418610 Ga0436364_1418610_2706_3356 212
334 3300039438 Ga0436360_0726393 Ga0436360_0726393_19818_20489 212
335 3300039453 Ga0436362_0312415 Ga0436362_0312415_233_883 212
336 3300044712 Ga0453684_0989252 Ga0453684_0989252_168_812 212
337 3300044765 Ga0466970_0075111 Ga0466970_0075111_449_1099 212
338 3300045051 Ga0451576_0000020 Ga0451576_0000020_408163_408813 212
339 3300050511 nmdc:mga08y16_719284_c1 nmdc:mga08y16_719284_c1_251_901 212
340 iso_pu_bacteria 2738543023 2739303986 212
341 iso_pu_bacteria 2852627209 2852627317 212
342 iso_pu_bacteria 3003233435 3003233948 212
343 3300003316 rootH1_10001619 rootH1_100016198 213
344 3300003320 rootH2_10021864 rootH2_100218645 213
345 3300003322 rootL2_10042221 rootL2_100422213 213
346 3300006844 Ga0075428_100036856 Ga0075428_1000368565 213
347 3300009094 Ga0111539_10005241 Ga0111539_1000524116 213
348 3300009094 Ga0111539_10009709 Ga0111539_100097095 213
349 3300013104 Ga0157370_10042224 Ga0157370_100422242 213
350 3300014326 Ga0157380_10000443 Ga0157380_100004439 213
351 3300027907 Ga0207428_10068166 Ga0207428_100681663 213
352 3300049674 Ga0501242_013138 Ga0501242_013138_234_875 213
353 3300050510 nmdc:mga06r32_595827_c1 nmdc:mga06r32_595827_c1_64_705 213
354 3300050511 nmdc:mga08y16_28509_c1 nmdc:mga08y16_28509_c1_3145_3786 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

82

168

0.96

PF10590

PNP_phzG_C

Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region

223

266

0.96

PF12766

Pyridox_oxase_2

Pyridoxamine 5'-phosphate oxidase

75

165

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jnw-assembly1.cif.gz_A-2 active site structure of e. coli pyridoxine 5'-phosphate oxidase 0.9658 1 213
1ci0-assembly1.cif.gz_B pnp oxidase from saccharomyces cerevisiae 0.9627 15 213
1jnw-assembly1.cif.gz_A-2 active site structure of e. coli pyridoxine 5'-phosphate oxidase 0.957 1 213
1dnl-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution 0.9533 14 213
1dnl-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution 0.9487 14 213
ID Description Score Start End Superfamily
af_Q9LTX3_323_519_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9745 11 203 2.30.110.10
af_A0A1R3LXN8_584_738_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9733 11 164 2.30.110.10
1g78A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9642 14 213 2.30.110.10
af_A0A1R3LXN8_584_738_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9611 11 164 2.30.110.10
1g78A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9594 14 213 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A6M1NTA4-F1-model_v4 Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) 0.9881 4 213 GO:0004733
GO:0008615
GO:0010181
AF-A0A838F021-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9856 4 213 GO:0004733
GO:0008615
GO:0010181
AF-A0A4R7HWV7-F1-model_v4 Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) 0.9831 4 213 GO:0004733
GO:0008615
GO:0010181
AF-W9C9M7-F1-model_v4 pyridoxal 5'-phosphate synthase (EC 1.4.3.5) 0.9806 8 213 GO:0004733
GO:0008615
GO:0010181
AF-A0A3N5KEF8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9806 3 196 GO:0004733
GO:0008615
GO:0010181

Feature Viewer

pLDDT pTM Quality
94.02 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map