F419765
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 354 | 200 | 350 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300013296|Ga0157374_10234469|Ga0157374_102344692 |
| Length | 266 |
| Sequence | LSLPRAGATLAEKTFTPPSRDSDAAFLAALSRGGRAPSERRAGSIRIGEPVNIADLRREYMRETLDESDVAPDPCRQFERWFAEATKAALPEPNAMTLATVDAAGRPAARIVLLKIVDDRGFVFFTNFTSRKGRELEANRRAALLFFWPELERQVRIEGETARIDPGESAAYFAGRPRASQLGAWASPQSEAIAGRDALMSRFDEVEAQYADPSRAVPCPPHWGGYRLDPEAMEFWQGRPSRLHDRIRYRRKHEQAGAWVIDRLAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 2 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 3 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 4 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 81 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 141 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 142 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 143 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 144 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 145 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 152 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 153 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 155 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 158 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 159 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 160 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 161 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 162 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 163 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 164 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 165 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 190 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 191 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 193 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 194 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 195 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 196 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 197 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.87 |
| Metatranscriptomes | 0 |
| Isolates | 1.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.26 |
| Rhizosphere | 95.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10001619 | 3300003316 | Bacteria | 18216 |
| 2 | rootH2_10021864 | 3300003320 | Bacteria | 30597 |
| 3 | rootL2_10042221 | 3300003322 | Bacteria | 6992 |
| 4 | Ga0065714_10002361 | 3300005288 | Bacteria | 37849 |
| 5 | Ga0070658_10010401 | 3300005327 | Bacteria | 7461 |
| 6 | Ga0070658_10072046 | 3300005327 | Bacteria | 2831 |
| 7 | Ga0070676_10005638 | 3300005328 | Bacteria | 6667 |
| 8 | Ga0070670_100014220 | 3300005331 | Bacteria | 6827 |
| 9 | Ga0070670_100050599 | 3300005331 | Bacteria | 3569 |
| 10 | Ga0070670_100074495 | 3300005331 | Bacteria | 2916 |
| 11 | Ga0070677_10001405 | 3300005333 | Bacteria | 7677 |
| 12 | Ga0070677_10013334 | 3300005333 | Bacteria | 2873 |
| 13 | Ga0070666_10027339 | 3300005335 | Bacteria | 3735 |
| 14 | Ga0070666_10355733 | 3300005335 | Bacteria | 1048 |
| 15 | Ga0068868_100042177 | 3300005338 | Bacteria | 3559 |
| 16 | Ga0070661_100008060 | 3300005344 | Bacteria | 7271 |
| 17 | Ga0070668_100003054 | 3300005347 | Bacteria | 12385 |
| 18 | Ga0070668_100023224 | 3300005347 | Bacteria | 4690 |
| 19 | Ga0070668_100047798 | 3300005347 | Bacteria | 3290 |
| 20 | Ga0070668_100827731 | 3300005347 | Bacteria | 824 |
| 21 | Ga0070675_100001486 | 3300005354 | Bacteria | 17301 |
| 22 | Ga0070675_100028788 | 3300005354 | Bacteria | 4474 |
| 23 | Ga0070671_100003732 | 3300005355 | Bacteria | 11955 |
| 24 | Ga0070671_100108365 | 3300005355 | Bacteria | 2333 |
| 25 | Ga0070671_100325729 | 3300005355 | Bacteria | 1309 |
| 26 | Ga0070674_100001820 | 3300005356 | Bacteria | 11567 |
| 27 | Ga0070674_100051552 | 3300005356 | Bacteria | 2836 |
| 28 | Ga0070674_100657201 | 3300005356 | Bacteria | 892 |
| 29 | Ga0070673_100000369 | 3300005364 | Bacteria | 23581 |
| 30 | Ga0070673_100295694 | 3300005364 | Bacteria | 1424 |
| 31 | Ga0070659_100003342 | 3300005366 | Bacteria | 11413 |
| 32 | Ga0070667_100036242 | 3300005367 | Bacteria | 4135 |
| 33 | Ga0070667_100060915 | 3300005367 | Bacteria | 3194 |
| 34 | Ga0070667_100091421 | 3300005367 | Bacteria | 2617 |
| 35 | Ga0070709_10140780 | 3300005434 | Bacteria | 1657 |
| 36 | Ga0070714_100000389 | 3300005435 | Bacteria | 32725 |
| 37 | Ga0070713_100018733 | 3300005436 | Bacteria | 5266 |
| 38 | Ga0070713_100588041 | 3300005436 | Bacteria | 1056 |
| 39 | Ga0070710_10065207 | 3300005437 | Bacteria | 2085 |
| 40 | Ga0070711_100058017 | 3300005439 | Bacteria | 2683 |
| 41 | Ga0070700_100109959 | 3300005441 | Bacteria | 1831 |
| 42 | Ga0070663_100049206 | 3300005455 | Bacteria | 2992 |
| 43 | Ga0070678_100005428 | 3300005456 | Bacteria | 7366 |
| 44 | Ga0070678_100213917 | 3300005456 | Bacteria | 1599 |
| 45 | Ga0070678_100706546 | 3300005456 | Bacteria | 909 |
| 46 | Ga0070662_100070344 | 3300005457 | Bacteria | 2578 |
| 47 | Ga0070662_100143780 | 3300005457 | Bacteria | 1851 |
| 48 | Ga0070681_10228102 | 3300005458 | Bacteria | 1777 |
| 49 | Ga0070681_10234071 | 3300005458 | Bacteria | 1751 |
| 50 | Ga0070681_10256164 | 3300005458 | Bacteria | 1662 |
| 51 | Ga0068867_100003972 | 3300005459 | Bacteria | 10404 |
| 52 | Ga0068867_100005139 | 3300005459 | Bacteria | 9247 |
| 53 | Ga0070685_10095298 | 3300005466 | Bacteria | 1809 |
| 54 | Ga0070699_100233718 | 3300005518 | Bacteria | 1640 |
| 55 | Ga0070679_100060749 | 3300005530 | Bacteria | 3766 |
| 56 | Ga0070679_100192879 | 3300005530 | Bacteria | 2006 |
| 57 | Ga0070679_100346337 | 3300005530 | Bacteria | 1434 |
| 58 | Ga0068853_100031444 | 3300005539 | Bacteria | 4490 |
| 59 | Ga0070672_100000746 | 3300005543 | Bacteria | 19295 |
| 60 | Ga0070672_100028426 | 3300005543 | Bacteria | 4183 |
| 61 | Ga0070672_100061830 | 3300005543 | Bacteria | 2953 |
| 62 | Ga0070696_100018595 | 3300005546 | Bacteria | 4700 |
| 63 | Ga0070665_100006570 | 3300005548 | Bacteria | 11823 |
| 64 | Ga0070665_100017479 | 3300005548 | Bacteria | 7202 |
| 65 | Ga0070665_100062880 | 3300005548 | Bacteria | 3722 |
| 66 | Ga0070665_100483899 | 3300005548 | Bacteria | 1248 |
| 67 | Ga0070704_100325412 | 3300005549 | Bacteria | 1289 |
| 68 | Ga0068855_100145704 | 3300005563 | Bacteria | 2696 |
| 69 | Ga0070664_100164216 | 3300005564 | Bacteria | 1966 |
| 70 | Ga0068857_100454359 | 3300005577 | Unclassified | 1198 |
| 71 | Ga0068856_100504643 | 3300005614 | Bacteria | 1231 |
| 72 | Ga0068852_100001886 | 3300005616 | Bacteria | 14284 |
| 73 | Ga0068852_100005100 | 3300005616 | Bacteria | 9351 |
| 74 | Ga0068852_100216530 | 3300005616 | Bacteria | 1819 |
| 75 | Ga0068852_100366796 | 3300005616 | Bacteria | 1410 |
| 76 | Ga0068852_100594214 | 3300005616 | Bacteria | 1111 |
| 77 | Ga0068864_100003448 | 3300005618 | Bacteria | 13076 |
| 78 | Ga0068864_100039778 | 3300005618 | Bacteria | 4019 |
| 79 | Ga0068864_100107671 | 3300005618 | Bacteria | 2480 |
| 80 | Ga0068864_100224640 | 3300005618 | Bacteria | 1734 |
| 81 | Ga0068861_100043825 | 3300005719 | Bacteria | 3361 |
| 82 | Ga0068861_100057966 | 3300005719 | Bacteria | 2960 |
| 83 | Ga0068861_100426578 | 3300005719 | Bacteria | 1183 |
| 84 | Ga0068851_10000364 | 3300005834 | Bacteria | 20414 |
| 85 | Ga0068851_10006087 | 3300005834 | Bacteria | 5504 |
| 86 | Ga0068851_10133462 | 3300005834 | Bacteria | 1344 |
| 87 | Ga0068870_10003447 | 3300005840 | Bacteria | 6704 |
| 88 | Ga0068863_100006241 | 3300005841 | Bacteria | 11708 |
| 89 | Ga0068863_100008461 | 3300005841 | Bacteria | 10050 |
| 90 | Ga0068863_100049843 | 3300005841 | Bacteria | 3970 |
| 91 | Ga0068863_100187810 | 3300005841 | Bacteria | 1985 |
| 92 | Ga0068858_100027945 | 3300005842 | Bacteria | 5242 |
| 93 | Ga0068860_100014090 | 3300005843 | Bacteria | 7844 |
| 94 | Ga0068860_100145794 | 3300005843 | Bacteria | 2278 |
| 95 | Ga0068860_100311569 | 3300005843 | Bacteria | 1543 |
| 96 | Ga0068862_100381090 | 3300005844 | Bacteria | 1315 |
| 97 | Ga0070715_10047649 | 3300006163 | Bacteria | 1828 |
| 98 | Ga0070715_10151957 | 3300006163 | Bacteria | 1135 |
| 99 | Ga0097621_100023484 | 3300006237 | Bacteria | 4802 |
| 100 | Ga0097621_100073034 | 3300006237 | Bacteria | 2839 |
| 101 | Ga0068871_100017336 | 3300006358 | Bacteria | 5446 |
| 102 | Ga0068871_100037829 | 3300006358 | Bacteria | 3851 |
| 103 | Ga0068871_100148214 | 3300006358 | Bacteria | 2000 |
| 104 | Ga0068871_100369598 | 3300006358 | Bacteria | 1272 |
| 105 | Ga0075428_100036856 | 3300006844 | Bacteria | 5385 |
| 106 | Ga0075428_100293334 | 3300006844 | Bacteria | 1749 |
| 107 | Ga0068865_100015150 | 3300006881 | Bacteria | 4913 |
| 108 | Ga0068865_100027856 | 3300006881 | Bacteria | 3737 |
| 109 | Ga0068865_100406747 | 3300006881 | Bacteria | 1116 |
| 110 | Ga0105240_10009562 | 3300009093 | Bacteria | 13725 |
| 111 | Ga0105240_10044573 | 3300009093 | Bacteria | 5635 |
| 112 | Ga0111539_10005241 | 3300009094 | Bacteria | 16795 |
| 113 | Ga0111539_10009709 | 3300009094 | Bacteria | 12145 |
| 114 | Ga0111539_10302442 | 3300009094 | Bacteria | 1862 |
| 115 | Ga0111539_10462570 | 3300009094 | Bacteria | 1477 |
| 116 | Ga0114129_10309187 | 3300009147 | Bacteria | 2104 |
| 117 | Ga0105243_11040919 | 3300009148 | Unclassified | 823 |
| 118 | Ga0105241_10729219 | 3300009174 | Bacteria | 907 |
| 119 | Ga0105248_10009560 | 3300009177 | Bacteria | 10671 |
| 120 | Ga0105248_10193830 | 3300009177 | Bacteria | 2289 |
| 121 | Ga0105237_10156214 | 3300009545 | Bacteria | 2278 |
| 122 | Ga0157373_10003717 | 3300013100 | Bacteria | 11545 |
| 123 | Ga0157371_10173845 | 3300013102 | Bacteria | 1539 |
| 124 | Ga0157370_10015373 | 3300013104 | Bacteria | 7779 |
| 125 | Ga0157370_10042224 | 3300013104 | Bacteria | 4396 |
| 126 | Ga0157374_10039116 | 3300013296 | Bacteria | 4364 |
| 127 | Ga0157374_10189367 | 3300013296 | Bacteria | 2012 |
| 128 | Ga0157374_10234469 | 3300013296 | Bacteria | 1804 |
| 129 | Ga0157378_10705527 | 3300013297 | Bacteria | 1029 |
| 130 | Ga0163162_10208135 | 3300013306 | Bacteria | 2085 |
| 131 | Ga0163162_10299557 | 3300013306 | Bacteria | 1740 |
| 132 | Ga0157372_10038365 | 3300013307 | Bacteria | 5286 |
| 133 | Ga0157372_10216452 | 3300013307 | Bacteria | 2220 |
| 134 | Ga0157375_10035881 | 3300013308 | Bacteria | 4738 |
| 135 | Ga0157375_10052494 | 3300013308 | Bacteria | 4008 |
| 136 | Ga0157375_10164124 | 3300013308 | Bacteria | 2365 |
| 137 | Ga0157375_11004425 | 3300013308 | Bacteria | 974 |
| 138 | Ga0163163_10005036 | 3300014325 | Bacteria | 11387 |
| 139 | Ga0163163_10131734 | 3300014325 | Bacteria | 2540 |
| 140 | Ga0157380_10000443 | 3300014326 | Bacteria | 25341 |
| 141 | Ga0157380_10119592 | 3300014326 | Bacteria | 2229 |
| 142 | Ga0157380_10430873 | 3300014326 | Bacteria | 1261 |
| 143 | Ga0157380_10461287 | 3300014326 | Bacteria | 1223 |
| 144 | Ga0157377_10244145 | 3300014745 | Bacteria | 1161 |
| 145 | Ga0157379_10061512 | 3300014968 | Bacteria | 3357 |
| 146 | Ga0163161_10001536 | 3300017792 | Bacteria | 17042 |
| 147 | Ga0163161_10025983 | 3300017792 | Bacteria | 4147 |
| 148 | Ga0163161_10031468 | 3300017792 | Bacteria | 3781 |
| 149 | Ga0163161_10064872 | 3300017792 | Bacteria | 2665 |
| 150 | Ga0213871_10000168 | 3300021441 | Bacteria | 7155 |
| 151 | Ga0207697_10031128 | 3300025315 | Bacteria | 2183 |
| 152 | Ga0207656_10051501 | 3300025321 | Bacteria | 1780 |
| 153 | Ga0207656_10059692 | 3300025321 | Bacteria | 1670 |
| 154 | Ga0207682_10000696 | 3300025893 | Bacteria | 15554 |
| 155 | Ga0207682_10001581 | 3300025893 | Bacteria | 10476 |
| 156 | Ga0207692_10080376 | 3300025898 | Bacteria | 1742 |
| 157 | Ga0207642_10029203 | 3300025899 | Bacteria | 2281 |
| 158 | Ga0207642_10238225 | 3300025899 | Bacteria | 1026 |
| 159 | Ga0207680_10003849 | 3300025903 | Bacteria | 7065 |
| 160 | Ga0207680_10051668 | 3300025903 | Bacteria | 2459 |
| 161 | Ga0207699_10134542 | 3300025906 | Bacteria | 1617 |
| 162 | Ga0207645_10000077 | 3300025907 | Bacteria | 69960 |
| 163 | Ga0207645_10018732 | 3300025907 | Bacteria | 4547 |
| 164 | Ga0207643_10003908 | 3300025908 | Bacteria | 8022 |
| 165 | Ga0207705_10159568 | 3300025909 | Bacteria | 1694 |
| 166 | Ga0207707_10068959 | 3300025912 | Bacteria | 3082 |
| 167 | Ga0207707_10294992 | 3300025912 | Bacteria | 1402 |
| 168 | Ga0207695_10029541 | 3300025913 | Bacteria | 6053 |
| 169 | Ga0207663_10101871 | 3300025916 | Bacteria | 1930 |
| 170 | Ga0207660_10502887 | 3300025917 | Bacteria | 983 |
| 171 | Ga0207660_10561095 | 3300025917 | Bacteria | 929 |
| 172 | Ga0207649_10014459 | 3300025920 | Bacteria | 4420 |
| 173 | Ga0207652_10081892 | 3300025921 | Bacteria | 2823 |
| 174 | Ga0207652_10137928 | 3300025921 | Bacteria | 2179 |
| 175 | Ga0207652_10281724 | 3300025921 | Bacteria | 1500 |
| 176 | Ga0207681_10012240 | 3300025923 | Bacteria | 5291 |
| 177 | Ga0207681_10082783 | 3300025923 | Bacteria | 2269 |
| 178 | Ga0207681_10118027 | 3300025923 | Bacteria | 1941 |
| 179 | Ga0207681_10211771 | 3300025923 | Bacteria | 1494 |
| 180 | Ga0207650_10001400 | 3300025925 | Bacteria | 17395 |
| 181 | Ga0207650_10010912 | 3300025925 | Bacteria | 6244 |
| 182 | Ga0207650_10037114 | 3300025925 | Bacteria | 3549 |
| 183 | Ga0207650_10043367 | 3300025925 | Bacteria | 3302 |
| 184 | Ga0207650_10083976 | 3300025925 | Bacteria | 2420 |
| 185 | Ga0207650_10529010 | 3300025925 | Bacteria | 987 |
| 186 | Ga0207659_10024632 | 3300025926 | Bacteria | 4035 |
| 187 | Ga0207659_10026264 | 3300025926 | Bacteria | 3927 |
| 188 | Ga0207659_10028496 | 3300025926 | Bacteria | 3796 |
| 189 | Ga0207659_10330331 | 3300025926 | Bacteria | 1260 |
| 190 | Ga0207700_10042285 | 3300025928 | Bacteria | 3340 |
| 191 | Ga0207700_10465697 | 3300025928 | Bacteria | 1115 |
| 192 | Ga0207664_10000411 | 3300025929 | Bacteria | 30634 |
| 193 | Ga0207664_10119642 | 3300025929 | Bacteria | 2202 |
| 194 | Ga0207644_10014425 | 3300025931 | Bacteria | 5285 |
| 195 | Ga0207644_10033514 | 3300025931 | Bacteria | 3589 |
| 196 | Ga0207644_10033615 | 3300025931 | Bacteria | 3585 |
| 197 | Ga0207644_10062602 | 3300025931 | Bacteria | 2699 |
| 198 | Ga0207644_10104241 | 3300025931 | Bacteria | 2135 |
| 199 | Ga0207690_10055395 | 3300025932 | Bacteria | 2670 |
| 200 | Ga0207690_10076542 | 3300025932 | Bacteria | 2323 |
| 201 | Ga0207706_10012482 | 3300025933 | Bacteria | 7739 |
| 202 | Ga0207706_10073326 | 3300025933 | Bacteria | 3010 |
| 203 | Ga0207706_10079150 | 3300025933 | Bacteria | 2891 |
| 204 | Ga0207706_10093142 | 3300025933 | Bacteria | 2650 |
| 205 | Ga0207686_10137541 | 3300025934 | Bacteria | 1684 |
| 206 | Ga0207709_10204297 | 3300025935 | Bacteria | 1413 |
| 207 | Ga0207670_10095655 | 3300025936 | Bacteria | 2110 |
| 208 | Ga0207670_10633477 | 3300025936 | Bacteria | 880 |
| 209 | Ga0207669_10008596 | 3300025937 | Bacteria | 4802 |
| 210 | Ga0207669_10080622 | 3300025937 | Bacteria | 2082 |
| 211 | Ga0207704_10018467 | 3300025938 | Bacteria | 3641 |
| 212 | Ga0207704_10060076 | 3300025938 | Bacteria | 2350 |
| 213 | Ga0207691_10000499 | 3300025940 | Bacteria | 39022 |
| 214 | Ga0207691_10002200 | 3300025940 | Bacteria | 19071 |
| 215 | Ga0207691_10020442 | 3300025940 | Bacteria | 6258 |
| 216 | Ga0207691_10033687 | 3300025940 | Bacteria | 4770 |
| 217 | Ga0207711_10008586 | 3300025941 | Bacteria | 8539 |
| 218 | Ga0207711_10340745 | 3300025941 | Bacteria | 1387 |
| 219 | Ga0207689_10001066 | 3300025942 | Bacteria | 26408 |
| 220 | Ga0207679_10015538 | 3300025945 | Bacteria | 5034 |
| 221 | Ga0207667_10121645 | 3300025949 | Bacteria | 2689 |
| 222 | Ga0207651_10010025 | 3300025960 | Bacteria | 5225 |
| 223 | Ga0207651_10018238 | 3300025960 | Bacteria | 4170 |
| 224 | Ga0207651_10059047 | 3300025960 | Bacteria | 2654 |
| 225 | Ga0207651_10229935 | 3300025960 | Bacteria | 1505 |
| 226 | Ga0207651_10387929 | 3300025960 | Bacteria | 1185 |
| 227 | Ga0207712_10142286 | 3300025961 | Bacteria | 1842 |
| 228 | Ga0207668_10006140 | 3300025972 | Bacteria | 7086 |
| 229 | Ga0207668_10018793 | 3300025972 | Bacteria | 4357 |
| 230 | Ga0207668_10305462 | 3300025972 | Bacteria | 1314 |
| 231 | Ga0207668_10495473 | 3300025972 | Bacteria | 1050 |
| 232 | Ga0207640_10016355 | 3300025981 | Bacteria | 4314 |
| 233 | Ga0207640_10445984 | 3300025981 | Bacteria | 1065 |
| 234 | Ga0207658_10040272 | 3300025986 | Bacteria | 3376 |
| 235 | Ga0207677_10171016 | 3300026023 | Bacteria | 1699 |
| 236 | Ga0207677_10280384 | 3300026023 | Bacteria | 1368 |
| 237 | Ga0207677_10880161 | 3300026023 | Bacteria | 806 |
| 238 | Ga0207703_10511524 | 3300026035 | Bacteria | 1128 |
| 239 | Ga0207639_10032160 | 3300026041 | Bacteria | 3860 |
| 240 | Ga0207639_10384914 | 3300026041 | Bacteria | 1260 |
| 241 | Ga0207678_10014734 | 3300026067 | Bacteria | 6879 |
| 242 | Ga0207678_10237336 | 3300026067 | Bacteria | 1561 |
| 243 | Ga0207708_10257001 | 3300026075 | Bacteria | 1409 |
| 244 | Ga0207702_10424728 | 3300026078 | Bacteria | 1286 |
| 245 | Ga0207641_10012469 | 3300026088 | Bacteria | 6968 |
| 246 | Ga0207641_10017974 | 3300026088 | Bacteria | 5792 |
| 247 | Ga0207641_10085839 | 3300026088 | Bacteria | 2743 |
| 248 | Ga0207641_10108211 | 3300026088 | Bacteria | 2460 |
| 249 | Ga0207641_10699389 | 3300026088 | Bacteria | 998 |
| 250 | Ga0207648_10000589 | 3300026089 | Bacteria | 40773 |
| 251 | Ga0207648_10001872 | 3300026089 | Bacteria | 23010 |
| 252 | Ga0207648_10024655 | 3300026089 | Bacteria | 5366 |
| 253 | Ga0207676_10008388 | 3300026095 | Bacteria | 7345 |
| 254 | Ga0207676_10018746 | 3300026095 | Bacteria | 5037 |
| 255 | Ga0207676_10035610 | 3300026095 | Bacteria | 3780 |
| 256 | Ga0207676_10188978 | 3300026095 | Bacteria | 1811 |
| 257 | Ga0207676_10726666 | 3300026095 | Bacteria | 964 |
| 258 | Ga0207674_10006474 | 3300026116 | Bacteria | 13767 |
| 259 | Ga0207674_10287022 | 3300026116 | Bacteria | 1594 |
| 260 | Ga0207675_100026138 | 3300026118 | Bacteria | 5434 |
| 261 | Ga0207675_100041498 | 3300026118 | Bacteria | 4297 |
| 262 | Ga0207675_100070599 | 3300026118 | Bacteria | 3264 |
| 263 | Ga0207675_100097755 | 3300026118 | Bacteria | 2765 |
| 264 | Ga0207675_100133216 | 3300026118 | Bacteria | 2357 |
| 265 | Ga0207683_10000280 | 3300026121 | Bacteria | 45558 |
| 266 | Ga0207683_10006222 | 3300026121 | Bacteria | 10230 |
| 267 | Ga0207683_10160497 | 3300026121 | Bacteria | 2032 |
| 268 | Ga0207698_10037926 | 3300026142 | Bacteria | 3555 |
| 269 | Ga0207698_10107909 | 3300026142 | Bacteria | 2325 |
| 270 | Ga0207698_10133354 | 3300026142 | Bacteria | 2127 |
| 271 | Ga0207698_10283810 | 3300026142 | Bacteria | 1533 |
| 272 | Ga0209968_1011942 | 3300027526 | Bacteria | 1351 |
| 273 | Ga0209971_1013211 | 3300027682 | Bacteria | 1956 |
| 274 | Ga0209966_1027732 | 3300027695 | Bacteria | 1134 |
| 275 | Ga0207428_10014978 | 3300027907 | Bacteria | 6719 |
| 276 | Ga0207428_10068166 | 3300027907 | Unclassified | 2799 |
| 277 | Ga0268266_10012687 | 3300028379 | Bacteria | 7281 |
| 278 | Ga0268266_10069890 | 3300028379 | Bacteria | 3043 |
| 279 | Ga0268265_10128898 | 3300028380 | Bacteria | 2098 |
| 280 | Ga0268265_10156762 | 3300028380 | Bacteria | 1928 |
| 281 | Ga0268264_10032305 | 3300028381 | Bacteria | 4294 |
| 282 | Ga0268264_10100821 | 3300028381 | Bacteria | 2508 |
| 283 | Ga0268264_10672590 | 3300028381 | Bacteria | 1026 |
| 284 | Ga0265327_10173294 | 3300031251 | Unclassified | 990 |
| 285 | Ga0316579_10063727 | 3300031691 | Bacteria | 1738 |
| 286 | Ga0316576_10069782 | 3300031727 | Bacteria | 2591 |
| 287 | Ga0307405_10263485 | 3300031731 | Bacteria | 1289 |
| 288 | Ga0373926_0154185 | 3300035083 | Bacteria | 875 |
| 289 | Ga0373934_0153228 | 3300035086 | Bacteria | 944 |
| 290 | Ga0373923_0111242 | 3300035111 | Bacteria | 1216 |
| 291 | Ga0373945_0093200 | 3300035116 | Bacteria | 1169 |
| 292 | Ga0373956_0119559 | 3300035119 | Bacteria | 1230 |
| 293 | Ga0373943_0178122 | 3300035170 | Bacteria | 1167 |
| 294 | Ga0373943_0198032 | 3300035170 | Bacteria | 1111 |
| 295 | Ga0373955_0060068 | 3300035172 | Bacteria | 2096 |
| 296 | Ga0316574_0067950 | 3300035398 | Bacteria | 2247 |
| 297 | Ga0373927_0199385 | 3300035695 | Bacteria | 1314 |
| 298 | Ga0373937_0049928 | 3300036401 | Bacteria | 3831 |
| 299 | Ga0316582_0442418 | 3300036647 | Unclassified | 896 |
| 300 | Ga0316584_0032417 | 3300036712 | Bacteria | 3868 |
| 301 | Ga0373925_0175049 | 3300037068 | Bacteria | 1695 |
| 302 | Ga0436364_1418610 | 3300037853 | Bacteria | 3688 |
| 303 | Ga0436364_1536001 | 3300037853 | Bacteria | 7107 |
| 304 | Ga0436360_0726393 | 3300039438 | Bacteria | 23002 |
| 305 | Ga0436362_0312415 | 3300039453 | Bacteria | 1207 |
| 306 | Ga0439466_0003187 | 3300041411 | Bacteria | 6384 |
| 307 | Ga0451853_0884497 | 3300041512 | Bacteria | 2479 |
| 308 | Ga0453684_0989252 | 3300044712 | Bacteria | 895 |
| 309 | Ga0466970_0075111 | 3300044765 | Bacteria | 1820 |
| 310 | Ga0451576_0000020 | 3300045051 | Bacteria | 529568 |
| 311 | Ga0466958_0086891 | 3300045836 | Bacteria | 1930 |
| 312 | Ga0466967_0013563 | 3300045976 | Bacteria | 6304 |
| 313 | Ga0495592_0108079 | 3300046454 | Bacteria | 1972 |
| 314 | Ga0495651_0037256 | 3300046462 | Bacteria | 3786 |
| 315 | Ga0495664_0250775 | 3300046477 | Bacteria | 1070 |
| 316 | Ga0495608_0263954 | 3300046511 | Bacteria | 1071 |
| 317 | Ga0495618_0061664 | 3300046514 | Bacteria | 2379 |
| 318 | Ga0495628_0040970 | 3300046516 | Bacteria | 3698 |
| 319 | Ga0495630_0899819 | 3300046517 | Bacteria | 674 |
| 320 | Ga0495652_0068139 | 3300046529 | Bacteria | 2982 |
| 321 | Ga0495640_0171654 | 3300046533 | Bacteria | 1385 |
| 322 | Ga0495645_0179521 | 3300046543 | Bacteria | 1451 |
| 323 | Ga0495657_0365286 | 3300046675 | Bacteria | 852 |
| 324 | Ga0495599_0025399 | 3300046678 | Bacteria | 3708 |
| 325 | Ga0495646_0388706 | 3300046680 | Bacteria | 727 |
| 326 | Ga0495647_0029676 | 3300046681 | Bacteria | 2024 |
| 327 | Ga0495658_0204185 | 3300046683 | Bacteria | 1233 |
| 328 | Ga0495658_0272370 | 3300046683 | Bacteria | 1067 |
| 329 | Ga0495613_0464227 | 3300046689 | Bacteria | 856 |
| 330 | Ga0495604_0229970 | 3300047317 | Bacteria | 1272 |
| 331 | Ga0495674_0662581 | 3300047319 | Bacteria | 822 |
| 332 | Ga0495680_0075825 | 3300047322 | Bacteria | 2551 |
| 333 | Ga0495684_0096049 | 3300047471 | Bacteria | 2243 |
| 334 | Ga0495602_0230525 | 3300048088 | Bacteria | 1392 |
| 335 | Ga0496100_0815508 | 3300048903 | Bacteria | 731 |
| 336 | Ga0496104_0994671 | 3300048907 | Bacteria | 743 |
| 337 | Ga0496106_0120789 | 3300048909 | Bacteria | 2048 |
| 338 | Ga0496106_0456155 | 3300048909 | Bacteria | 1027 |
| 339 | Ga0496108_0691251 | 3300048911 | Bacteria | 885 |
| 340 | Ga0496110_0154028 | 3300048913 | Bacteria | 2082 |
| 341 | Ga0496112_0779338 | 3300048915 | Bacteria | 882 |
| 342 | Ga0496114_0533342 | 3300048917 | Unclassified | 1038 |
| 343 | Ga0501294_013802 | 3300049517 | Unclassified | 821 |
| 344 | Ga0501242_013138 | 3300049674 | Bacteria | 1014 |
| 345 | nmdc:mga05p37_393366_c1 | 3300050507 | Bacteria | 1620 |
| 346 | nmdc:mga06r32_595827_c1 | 3300050510 | Unclassified | 1076 |
| 347 | nmdc:mga08y16_28509_c1 | 3300050511 | Bacteria | 5886 |
| 348 | nmdc:mga08y16_406117_c1 | 3300050511 | Bacteria | 1393 |
| 349 | nmdc:mga08y16_719284_c1 | 3300050511 | Bacteria | 997 |
| 350 | Ga0495595_0040672 | 3300053084 | Bacteria | 2125 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049517 | Ga0501294_013802 | Ga0501294_013802_82_615 | 177 |
| 2 | 3300035398 | Ga0316574_0067950 | Ga0316574_0067950_254_799 | 180 |
| 3 | 3300046517 | Ga0495630_0899819 | Ga0495630_0899819_53_598 | 180 |
| 4 | 3300046680 | Ga0495646_0388706 | Ga0495646_0388706_19_564 | 180 |
| 5 | 3300005530 | Ga0070679_100192879 | Ga0070679_1001928791 | 198 |
| 6 | 3300025921 | Ga0207652_10137928 | Ga0207652_101379282 | 198 |
| 7 | 3300035086 | Ga0373934_0153228 | Ga0373934_0153228_252_851 | 198 |
| 8 | 3300035111 | Ga0373923_0111242 | Ga0373923_0111242_541_1140 | 198 |
| 9 | 3300035116 | Ga0373945_0093200 | Ga0373945_0093200_103_702 | 198 |
| 10 | 3300035119 | Ga0373956_0119559 | Ga0373956_0119559_42_641 | 198 |
| 11 | 3300035172 | Ga0373955_0060068 | Ga0373955_0060068_269_868 | 198 |
| 12 | 3300035695 | Ga0373927_0199385 | Ga0373927_0199385_206_805 | 198 |
| 13 | 3300036401 | Ga0373937_0049928 | Ga0373937_0049928_1789_2388 | 198 |
| 14 | 3300037068 | Ga0373925_0175049 | Ga0373925_0175049_960_1559 | 198 |
| 15 | 3300046454 | Ga0495592_0108079 | Ga0495592_0108079_1319_1918 | 198 |
| 16 | 3300046462 | Ga0495651_0037256 | Ga0495651_0037256_1529_2128 | 198 |
| 17 | 3300046477 | Ga0495664_0250775 | Ga0495664_0250775_79_678 | 198 |
| 18 | 3300046511 | Ga0495608_0263954 | Ga0495608_0263954_171_770 | 198 |
| 19 | 3300046514 | Ga0495618_0061664 | Ga0495618_0061664_1178_1777 | 198 |
| 20 | 3300046516 | Ga0495628_0040970 | Ga0495628_0040970_1398_1997 | 198 |
| 21 | 3300046529 | Ga0495652_0068139 | Ga0495652_0068139_2329_2928 | 198 |
| 22 | 3300046533 | Ga0495640_0171654 | Ga0495640_0171654_207_806 | 198 |
| 23 | 3300046543 | Ga0495645_0179521 | Ga0495645_0179521_516_1115 | 198 |
| 24 | 3300046675 | Ga0495657_0365286 | Ga0495657_0365286_167_766 | 198 |
| 25 | 3300046678 | Ga0495599_0025399 | Ga0495599_0025399_2661_3260 | 198 |
| 26 | 3300046683 | Ga0495658_0272370 | Ga0495658_0272370_356_955 | 198 |
| 27 | 3300046689 | Ga0495613_0464227 | Ga0495613_0464227_59_658 | 198 |
| 28 | 3300047317 | Ga0495604_0229970 | Ga0495604_0229970_267_866 | 198 |
| 29 | 3300047319 | Ga0495674_0662581 | Ga0495674_0662581_184_783 | 198 |
| 30 | 3300047322 | Ga0495680_0075825 | Ga0495680_0075825_504_1103 | 198 |
| 31 | 3300047471 | Ga0495684_0096049 | Ga0495684_0096049_644_1243 | 198 |
| 32 | 3300048088 | Ga0495602_0230525 | Ga0495602_0230525_533_1132 | 198 |
| 33 | 3300053084 | Ga0495595_0040672 | Ga0495595_0040672_148_747 | 198 |
| 34 | 3300005458 | Ga0070681_10228102 | Ga0070681_102281022 | 201 |
| 35 | 3300005530 | Ga0070679_100346337 | Ga0070679_1003463372 | 201 |
| 36 | 3300025912 | Ga0207707_10068959 | Ga0207707_100689593 | 201 |
| 37 | 3300025921 | Ga0207652_10281724 | Ga0207652_102817242 | 201 |
| 38 | 3300037853 | Ga0436364_1536001 | Ga0436364_1536001_4016_4621 | 201 |
| 39 | 3300005366 | Ga0070659_100003342 | Ga0070659_1000033421 | 202 |
| 40 | 3300005834 | Ga0068851_10000364 | Ga0068851_100003643 | 202 |
| 41 | 3300009093 | Ga0105240_10044573 | Ga0105240_100445736 | 202 |
| 42 | 3300009545 | Ga0105237_10156214 | Ga0105237_101562142 | 202 |
| 43 | 3300048917 | Ga0496114_0533342 | Ga0496114_0533342_48_668 | 205 |
| 44 | iso_pu_bacteria | 2728369097 | 2729145331 | 207 |
| 45 | 3300025907 | Ga0207645_10018732 | Ga0207645_100187324 | 208 |
| 46 | 3300041411 | Ga0439466_0003187 | Ga0439466_0003187_4268_4915 | 210 |
| 47 | 3300005327 | Ga0070658_10010401 | Ga0070658_100104012 | 211 |
| 48 | 3300005331 | Ga0070670_100014220 | Ga0070670_1000142206 | 211 |
| 49 | 3300005331 | Ga0070670_100074495 | Ga0070670_1000744952 | 211 |
| 50 | 3300005333 | Ga0070677_10013334 | Ga0070677_100133344 | 211 |
| 51 | 3300005335 | Ga0070666_10027339 | Ga0070666_100273392 | 211 |
| 52 | 3300005344 | Ga0070661_100008060 | Ga0070661_1000080606 | 211 |
| 53 | 3300005367 | Ga0070667_100091421 | Ga0070667_1000914212 | 211 |
| 54 | 3300005434 | Ga0070709_10140780 | Ga0070709_101407802 | 211 |
| 55 | 3300005435 | Ga0070714_100000389 | Ga0070714_1000003896 | 211 |
| 56 | 3300005436 | Ga0070713_100018733 | Ga0070713_1000187334 | 211 |
| 57 | 3300005436 | Ga0070713_100588041 | Ga0070713_1005880412 | 211 |
| 58 | 3300005437 | Ga0070710_10065207 | Ga0070710_100652073 | 211 |
| 59 | 3300005439 | Ga0070711_100058017 | Ga0070711_1000580174 | 211 |
| 60 | 3300005458 | Ga0070681_10256164 | Ga0070681_102561642 | 211 |
| 61 | 3300005518 | Ga0070699_100233718 | Ga0070699_1002337182 | 211 |
| 62 | 3300005530 | Ga0070679_100060749 | Ga0070679_1000607493 | 211 |
| 63 | 3300005546 | Ga0070696_100018595 | Ga0070696_1000185955 | 211 |
| 64 | 3300005548 | Ga0070665_100017479 | Ga0070665_1000174799 | 211 |
| 65 | 3300005548 | Ga0070665_100483899 | Ga0070665_1004838992 | 211 |
| 66 | 3300005563 | Ga0068855_100145704 | Ga0068855_1001457042 | 211 |
| 67 | 3300005616 | Ga0068852_100001886 | Ga0068852_10000188612 | 211 |
| 68 | 3300005618 | Ga0068864_100003448 | Ga0068864_10000344813 | 211 |
| 69 | 3300005841 | Ga0068863_100008461 | Ga0068863_1000084611 | 211 |
| 70 | 3300005841 | Ga0068863_100049843 | Ga0068863_1000498432 | 211 |
| 71 | 3300005843 | Ga0068860_100145794 | Ga0068860_1001457943 | 211 |
| 72 | 3300006163 | Ga0070715_10151957 | Ga0070715_101519571 | 211 |
| 73 | 3300006237 | Ga0097621_100073034 | Ga0097621_1000730342 | 211 |
| 74 | 3300006358 | Ga0068871_100017336 | Ga0068871_1000173366 | 211 |
| 75 | 3300006844 | Ga0075428_100293334 | Ga0075428_1002933342 | 211 |
| 76 | 3300009093 | Ga0105240_10009562 | Ga0105240_100095626 | 211 |
| 77 | 3300009147 | Ga0114129_10309187 | Ga0114129_103091872 | 211 |
| 78 | 3300009148 | Ga0105243_11040919 | Ga0105243_110409191 | 211 |
| 79 | 3300009174 | Ga0105241_10729219 | Ga0105241_107292191 | 211 |
| 80 | 3300009177 | Ga0105248_10009560 | Ga0105248_100095609 | 211 |
| 81 | 3300009177 | Ga0105248_10193830 | Ga0105248_101938303 | 211 |
| 82 | 3300013102 | Ga0157371_10173845 | Ga0157371_101738452 | 211 |
| 83 | 3300013104 | Ga0157370_10015373 | Ga0157370_100153739 | 211 |
| 84 | 3300013296 | Ga0157374_10039116 | Ga0157374_100391166 | 211 |
| 85 | 3300013306 | Ga0163162_10208135 | Ga0163162_102081352 | 211 |
| 86 | 3300013306 | Ga0163162_10299557 | Ga0163162_102995572 | 211 |
| 87 | 3300013307 | Ga0157372_10038365 | Ga0157372_100383656 | 211 |
| 88 | 3300013307 | Ga0157372_10216452 | Ga0157372_102164522 | 211 |
| 89 | 3300013308 | Ga0157375_10052494 | Ga0157375_100524942 | 211 |
| 90 | 3300013308 | Ga0157375_10164124 | Ga0157375_101641242 | 211 |
| 91 | 3300014325 | Ga0163163_10005036 | Ga0163163_100050362 | 211 |
| 92 | 3300014745 | Ga0157377_10244145 | Ga0157377_102441452 | 211 |
| 93 | 3300017792 | Ga0163161_10025983 | Ga0163161_100259835 | 211 |
| 94 | 3300025893 | Ga0207682_10000696 | Ga0207682_100006967 | 211 |
| 95 | 3300025898 | Ga0207692_10080376 | Ga0207692_100803761 | 211 |
| 96 | 3300025903 | Ga0207680_10003849 | Ga0207680_100038496 | 211 |
| 97 | 3300025906 | Ga0207699_10134542 | Ga0207699_101345423 | 211 |
| 98 | 3300025909 | Ga0207705_10159568 | Ga0207705_101595682 | 211 |
| 99 | 3300025912 | Ga0207707_10294992 | Ga0207707_102949922 | 211 |
| 100 | 3300025913 | Ga0207695_10029541 | Ga0207695_100295412 | 211 |
| 101 | 3300025916 | Ga0207663_10101871 | Ga0207663_101018713 | 211 |
| 102 | 3300025917 | Ga0207660_10502887 | Ga0207660_105028871 | 211 |
| 103 | 3300025917 | Ga0207660_10561095 | Ga0207660_105610952 | 211 |
| 104 | 3300025920 | Ga0207649_10014459 | Ga0207649_100144595 | 211 |
| 105 | 3300025921 | Ga0207652_10081892 | Ga0207652_100818923 | 211 |
| 106 | 3300025923 | Ga0207681_10082783 | Ga0207681_100827832 | 211 |
| 107 | 3300025923 | Ga0207681_10211771 | Ga0207681_102117712 | 211 |
| 108 | 3300025925 | Ga0207650_10001400 | Ga0207650_100014007 | 211 |
| 109 | 3300025925 | Ga0207650_10010912 | Ga0207650_100109127 | 211 |
| 110 | 3300025925 | Ga0207650_10043367 | Ga0207650_100433675 | 211 |
| 111 | 3300025925 | Ga0207650_10083976 | Ga0207650_100839763 | 211 |
| 112 | 3300025926 | Ga0207659_10026264 | Ga0207659_100262644 | 211 |
| 113 | 3300025928 | Ga0207700_10042285 | Ga0207700_100422853 | 211 |
| 114 | 3300025928 | Ga0207700_10465697 | Ga0207700_104656971 | 211 |
| 115 | 3300025929 | Ga0207664_10000411 | Ga0207664_100004112 | 211 |
| 116 | 3300025929 | Ga0207664_10119642 | Ga0207664_101196422 | 211 |
| 117 | 3300025931 | Ga0207644_10014425 | Ga0207644_100144255 | 211 |
| 118 | 3300025931 | Ga0207644_10033514 | Ga0207644_100335145 | 211 |
| 119 | 3300025931 | Ga0207644_10104241 | Ga0207644_101042412 | 211 |
| 120 | 3300025932 | Ga0207690_10055395 | Ga0207690_100553953 | 211 |
| 121 | 3300025932 | Ga0207690_10076542 | Ga0207690_100765422 | 211 |
| 122 | 3300025933 | Ga0207706_10093142 | Ga0207706_100931422 | 211 |
| 123 | 3300025936 | Ga0207670_10095655 | Ga0207670_100956552 | 211 |
| 124 | 3300025936 | Ga0207670_10633477 | Ga0207670_106334771 | 211 |
| 125 | 3300025940 | Ga0207691_10033687 | Ga0207691_100336875 | 211 |
| 126 | 3300025941 | Ga0207711_10008586 | Ga0207711_100085865 | 211 |
| 127 | 3300025942 | Ga0207689_10001066 | Ga0207689_1000106617 | 211 |
| 128 | 3300025945 | Ga0207679_10015538 | Ga0207679_100155382 | 211 |
| 129 | 3300025949 | Ga0207667_10121645 | Ga0207667_101216453 | 211 |
| 130 | 3300025960 | Ga0207651_10059047 | Ga0207651_100590471 | 211 |
| 131 | 3300026023 | Ga0207677_10880161 | Ga0207677_108801611 | 211 |
| 132 | 3300026041 | Ga0207639_10384914 | Ga0207639_103849141 | 211 |
| 133 | 3300026088 | Ga0207641_10017974 | Ga0207641_100179745 | 211 |
| 134 | 3300026089 | Ga0207648_10001872 | Ga0207648_100018729 | 211 |
| 135 | 3300026095 | Ga0207676_10008388 | Ga0207676_100083887 | 211 |
| 136 | 3300026095 | Ga0207676_10018746 | Ga0207676_100187465 | 211 |
| 137 | 3300026095 | Ga0207676_10726666 | Ga0207676_107266662 | 211 |
| 138 | 3300026116 | Ga0207674_10006474 | Ga0207674_1000647417 | 211 |
| 139 | 3300026116 | Ga0207674_10287022 | Ga0207674_102870221 | 211 |
| 140 | 3300026118 | Ga0207675_100070599 | Ga0207675_1000705995 | 211 |
| 141 | 3300026118 | Ga0207675_100133216 | Ga0207675_1001332162 | 211 |
| 142 | 3300026121 | Ga0207683_10006222 | Ga0207683_100062228 | 211 |
| 143 | 3300026142 | Ga0207698_10107909 | Ga0207698_101079092 | 211 |
| 144 | 3300027526 | Ga0209968_1011942 | Ga0209968_10119422 | 211 |
| 145 | 3300027682 | Ga0209971_1013211 | Ga0209971_10132112 | 211 |
| 146 | 3300027695 | Ga0209966_1027732 | Ga0209966_10277321 | 211 |
| 147 | 3300027907 | Ga0207428_10014978 | Ga0207428_100149783 | 211 |
| 148 | 3300028379 | Ga0268266_10069890 | Ga0268266_100698902 | 211 |
| 149 | 3300035083 | Ga0373926_0154185 | Ga0373926_0154185_211_858 | 211 |
| 150 | 3300035170 | Ga0373943_0178122 | Ga0373943_0178122_465_1112 | 211 |
| 151 | 3300035170 | Ga0373943_0198032 | Ga0373943_0198032_30_677 | 211 |
| 152 | 3300041512 | Ga0451853_0884497 | Ga0451853_0884497_311_958 | 211 |
| 153 | 3300045836 | Ga0466958_0086891 | Ga0466958_0086891_810_1460 | 211 |
| 154 | 3300045976 | Ga0466967_0013563 | Ga0466967_0013563_1376_2017 | 211 |
| 155 | 3300046681 | Ga0495647_0029676 | Ga0495647_0029676_1235_1882 | 211 |
| 156 | 3300046683 | Ga0495658_0204185 | Ga0495658_0204185_359_1006 | 211 |
| 157 | 3300048903 | Ga0496100_0815508 | Ga0496100_0815508_56_703 | 211 |
| 158 | 3300048907 | Ga0496104_0994671 | Ga0496104_0994671_10_645 | 211 |
| 159 | 3300048909 | Ga0496106_0120789 | Ga0496106_0120789_1327_1974 | 211 |
| 160 | 3300048909 | Ga0496106_0456155 | Ga0496106_0456155_125_772 | 211 |
| 161 | 3300048911 | Ga0496108_0691251 | Ga0496108_0691251_46_681 | 211 |
| 162 | 3300048913 | Ga0496110_0154028 | Ga0496110_0154028_1192_1827 | 211 |
| 163 | 3300048915 | Ga0496112_0779338 | Ga0496112_0779338_213_863 | 211 |
| 164 | 3300050507 | nmdc:mga05p37_393366_c1 | nmdc:mga05p37_393366_c1_460_1107 | 211 |
| 165 | 3300050511 | nmdc:mga08y16_406117_c1 | nmdc:mga08y16_406117_c1_631_1266 | 211 |
| 166 | 3300005288 | Ga0065714_10002361 | Ga0065714_1000236129 | 212 |
| 167 | 3300005327 | Ga0070658_10072046 | Ga0070658_100720462 | 212 |
| 168 | 3300005328 | Ga0070676_10005638 | Ga0070676_100056389 | 212 |
| 169 | 3300005331 | Ga0070670_100050599 | Ga0070670_1000505993 | 212 |
| 170 | 3300005333 | Ga0070677_10001405 | Ga0070677_100014058 | 212 |
| 171 | 3300005335 | Ga0070666_10355733 | Ga0070666_103557331 | 212 |
| 172 | 3300005338 | Ga0068868_100042177 | Ga0068868_1000421773 | 212 |
| 173 | 3300005347 | Ga0070668_100003054 | Ga0070668_10000305412 | 212 |
| 174 | 3300005347 | Ga0070668_100023224 | Ga0070668_1000232247 | 212 |
| 175 | 3300005347 | Ga0070668_100047798 | Ga0070668_1000477982 | 212 |
| 176 | 3300005347 | Ga0070668_100827731 | Ga0070668_1008277311 | 212 |
| 177 | 3300005354 | Ga0070675_100001486 | Ga0070675_10000148611 | 212 |
| 178 | 3300005354 | Ga0070675_100028788 | Ga0070675_1000287883 | 212 |
| 179 | 3300005355 | Ga0070671_100003732 | Ga0070671_1000037327 | 212 |
| 180 | 3300005355 | Ga0070671_100108365 | Ga0070671_1001083652 | 212 |
| 181 | 3300005355 | Ga0070671_100325729 | Ga0070671_1003257292 | 212 |
| 182 | 3300005356 | Ga0070674_100001820 | Ga0070674_1000018205 | 212 |
| 183 | 3300005356 | Ga0070674_100051552 | Ga0070674_1000515522 | 212 |
| 184 | 3300005356 | Ga0070674_100657201 | Ga0070674_1006572012 | 212 |
| 185 | 3300005364 | Ga0070673_100000369 | Ga0070673_10000036911 | 212 |
| 186 | 3300005364 | Ga0070673_100295694 | Ga0070673_1002956942 | 212 |
| 187 | 3300005367 | Ga0070667_100036242 | Ga0070667_1000362422 | 212 |
| 188 | 3300005367 | Ga0070667_100060915 | Ga0070667_1000609151 | 212 |
| 189 | 3300005441 | Ga0070700_100109959 | Ga0070700_1001099593 | 212 |
| 190 | 3300005455 | Ga0070663_100049206 | Ga0070663_1000492062 | 212 |
| 191 | 3300005456 | Ga0070678_100005428 | Ga0070678_1000054285 | 212 |
| 192 | 3300005456 | Ga0070678_100213917 | Ga0070678_1002139172 | 212 |
| 193 | 3300005456 | Ga0070678_100706546 | Ga0070678_1007065461 | 212 |
| 194 | 3300005457 | Ga0070662_100070344 | Ga0070662_1000703443 | 212 |
| 195 | 3300005457 | Ga0070662_100143780 | Ga0070662_1001437802 | 212 |
| 196 | 3300005458 | Ga0070681_10234071 | Ga0070681_102340712 | 212 |
| 197 | 3300005459 | Ga0068867_100003972 | Ga0068867_1000039729 | 212 |
| 198 | 3300005459 | Ga0068867_100005139 | Ga0068867_1000051399 | 212 |
| 199 | 3300005466 | Ga0070685_10095298 | Ga0070685_100952981 | 212 |
| 200 | 3300005539 | Ga0068853_100031444 | Ga0068853_1000314444 | 212 |
| 201 | 3300005543 | Ga0070672_100000746 | Ga0070672_1000007462 | 212 |
| 202 | 3300005543 | Ga0070672_100028426 | Ga0070672_1000284265 | 212 |
| 203 | 3300005543 | Ga0070672_100061830 | Ga0070672_1000618302 | 212 |
| 204 | 3300005548 | Ga0070665_100006570 | Ga0070665_1000065705 | 212 |
| 205 | 3300005548 | Ga0070665_100062880 | Ga0070665_1000628804 | 212 |
| 206 | 3300005549 | Ga0070704_100325412 | Ga0070704_1003254122 | 212 |
| 207 | 3300005564 | Ga0070664_100164216 | Ga0070664_1001642162 | 212 |
| 208 | 3300005577 | Ga0068857_100454359 | Ga0068857_1004543592 | 212 |
| 209 | 3300005614 | Ga0068856_100504643 | Ga0068856_1005046431 | 212 |
| 210 | 3300005616 | Ga0068852_100005100 | Ga0068852_1000051006 | 212 |
| 211 | 3300005616 | Ga0068852_100216530 | Ga0068852_1002165303 | 212 |
| 212 | 3300005616 | Ga0068852_100366796 | Ga0068852_1003667962 | 212 |
| 213 | 3300005616 | Ga0068852_100594214 | Ga0068852_1005942142 | 212 |
| 214 | 3300005618 | Ga0068864_100039778 | Ga0068864_1000397785 | 212 |
| 215 | 3300005618 | Ga0068864_100107671 | Ga0068864_1001076712 | 212 |
| 216 | 3300005618 | Ga0068864_100224640 | Ga0068864_1002246402 | 212 |
| 217 | 3300005719 | Ga0068861_100043825 | Ga0068861_1000438253 | 212 |
| 218 | 3300005719 | Ga0068861_100057966 | Ga0068861_1000579663 | 212 |
| 219 | 3300005719 | Ga0068861_100426578 | Ga0068861_1004265781 | 212 |
| 220 | 3300005834 | Ga0068851_10006087 | Ga0068851_100060873 | 212 |
| 221 | 3300005834 | Ga0068851_10133462 | Ga0068851_101334622 | 212 |
| 222 | 3300005840 | Ga0068870_10003447 | Ga0068870_100034472 | 212 |
| 223 | 3300005841 | Ga0068863_100006241 | Ga0068863_1000062412 | 212 |
| 224 | 3300005841 | Ga0068863_100187810 | Ga0068863_1001878102 | 212 |
| 225 | 3300005842 | Ga0068858_100027945 | Ga0068858_1000279454 | 212 |
| 226 | 3300005843 | Ga0068860_100014090 | Ga0068860_1000140905 | 212 |
| 227 | 3300005843 | Ga0068860_100311569 | Ga0068860_1003115692 | 212 |
| 228 | 3300005844 | Ga0068862_100381090 | Ga0068862_1003810901 | 212 |
| 229 | 3300006163 | Ga0070715_10047649 | Ga0070715_100476492 | 212 |
| 230 | 3300006237 | Ga0097621_100023484 | Ga0097621_1000234842 | 212 |
| 231 | 3300006358 | Ga0068871_100037829 | Ga0068871_1000378294 | 212 |
| 232 | 3300006358 | Ga0068871_100148214 | Ga0068871_1001482142 | 212 |
| 233 | 3300006358 | Ga0068871_100369598 | Ga0068871_1003695982 | 212 |
| 234 | 3300006881 | Ga0068865_100015150 | Ga0068865_1000151507 | 212 |
| 235 | 3300006881 | Ga0068865_100027856 | Ga0068865_1000278564 | 212 |
| 236 | 3300006881 | Ga0068865_100406747 | Ga0068865_1004067472 | 212 |
| 237 | 3300009094 | Ga0111539_10302442 | Ga0111539_103024422 | 212 |
| 238 | 3300009094 | Ga0111539_10462570 | Ga0111539_104625702 | 212 |
| 239 | 3300013100 | Ga0157373_10003717 | Ga0157373_100037178 | 212 |
| 240 | 3300013296 | Ga0157374_10189367 | Ga0157374_101893672 | 212 |
| 241 | 3300013296 | Ga0157374_10234469 | Ga0157374_102344692 | 212 |
| 242 | 3300013297 | Ga0157378_10705527 | Ga0157378_107055271 | 212 |
| 243 | 3300013308 | Ga0157375_10035881 | Ga0157375_100358816 | 212 |
| 244 | 3300013308 | Ga0157375_11004425 | Ga0157375_110044252 | 212 |
| 245 | 3300014325 | Ga0163163_10131734 | Ga0163163_101317341 | 212 |
| 246 | 3300014326 | Ga0157380_10119592 | Ga0157380_101195922 | 212 |
| 247 | 3300014326 | Ga0157380_10430873 | Ga0157380_104308732 | 212 |
| 248 | 3300014326 | Ga0157380_10461287 | Ga0157380_104612872 | 212 |
| 249 | 3300014968 | Ga0157379_10061512 | Ga0157379_100615123 | 212 |
| 250 | 3300017792 | Ga0163161_10001536 | Ga0163161_100015367 | 212 |
| 251 | 3300017792 | Ga0163161_10031468 | Ga0163161_100314685 | 212 |
| 252 | 3300017792 | Ga0163161_10064872 | Ga0163161_100648724 | 212 |
| 253 | 3300021441 | Ga0213871_10000168 | Ga0213871_1000016812 | 212 |
| 254 | 3300025315 | Ga0207697_10031128 | Ga0207697_100311283 | 212 |
| 255 | 3300025321 | Ga0207656_10051501 | Ga0207656_100515012 | 212 |
| 256 | 3300025321 | Ga0207656_10059692 | Ga0207656_100596921 | 212 |
| 257 | 3300025893 | Ga0207682_10001581 | Ga0207682_100015817 | 212 |
| 258 | 3300025899 | Ga0207642_10029203 | Ga0207642_100292032 | 212 |
| 259 | 3300025899 | Ga0207642_10238225 | Ga0207642_102382252 | 212 |
| 260 | 3300025903 | Ga0207680_10051668 | Ga0207680_100516682 | 212 |
| 261 | 3300025907 | Ga0207645_10000077 | Ga0207645_1000007741 | 212 |
| 262 | 3300025908 | Ga0207643_10003908 | Ga0207643_100039089 | 212 |
| 263 | 3300025923 | Ga0207681_10012240 | Ga0207681_100122401 | 212 |
| 264 | 3300025923 | Ga0207681_10118027 | Ga0207681_101180273 | 212 |
| 265 | 3300025925 | Ga0207650_10037114 | Ga0207650_100371143 | 212 |
| 266 | 3300025925 | Ga0207650_10529010 | Ga0207650_105290101 | 212 |
| 267 | 3300025926 | Ga0207659_10024632 | Ga0207659_100246322 | 212 |
| 268 | 3300025926 | Ga0207659_10028496 | Ga0207659_100284961 | 212 |
| 269 | 3300025926 | Ga0207659_10330331 | Ga0207659_103303312 | 212 |
| 270 | 3300025931 | Ga0207644_10033615 | Ga0207644_100336154 | 212 |
| 271 | 3300025931 | Ga0207644_10062602 | Ga0207644_100626023 | 212 |
| 272 | 3300025933 | Ga0207706_10012482 | Ga0207706_100124822 | 212 |
| 273 | 3300025933 | Ga0207706_10073326 | Ga0207706_100733262 | 212 |
| 274 | 3300025933 | Ga0207706_10079150 | Ga0207706_100791504 | 212 |
| 275 | 3300025934 | Ga0207686_10137541 | Ga0207686_101375412 | 212 |
| 276 | 3300025935 | Ga0207709_10204297 | Ga0207709_102042972 | 212 |
| 277 | 3300025937 | Ga0207669_10008596 | Ga0207669_100085965 | 212 |
| 278 | 3300025937 | Ga0207669_10080622 | Ga0207669_100806222 | 212 |
| 279 | 3300025938 | Ga0207704_10018467 | Ga0207704_100184674 | 212 |
| 280 | 3300025938 | Ga0207704_10060076 | Ga0207704_100600762 | 212 |
| 281 | 3300025940 | Ga0207691_10000499 | Ga0207691_1000049927 | 212 |
| 282 | 3300025940 | Ga0207691_10002200 | Ga0207691_1000220013 | 212 |
| 283 | 3300025940 | Ga0207691_10020442 | Ga0207691_100204427 | 212 |
| 284 | 3300025941 | Ga0207711_10340745 | Ga0207711_103407452 | 212 |
| 285 | 3300025960 | Ga0207651_10010025 | Ga0207651_100100255 | 212 |
| 286 | 3300025960 | Ga0207651_10018238 | Ga0207651_100182382 | 212 |
| 287 | 3300025960 | Ga0207651_10229935 | Ga0207651_102299352 | 212 |
| 288 | 3300025960 | Ga0207651_10387929 | Ga0207651_103879292 | 212 |
| 289 | 3300025961 | Ga0207712_10142286 | Ga0207712_101422864 | 212 |
| 290 | 3300025972 | Ga0207668_10006140 | Ga0207668_100061405 | 212 |
| 291 | 3300025972 | Ga0207668_10018793 | Ga0207668_100187934 | 212 |
| 292 | 3300025972 | Ga0207668_10305462 | Ga0207668_103054622 | 212 |
| 293 | 3300025972 | Ga0207668_10495473 | Ga0207668_104954732 | 212 |
| 294 | 3300025981 | Ga0207640_10016355 | Ga0207640_100163555 | 212 |
| 295 | 3300025981 | Ga0207640_10445984 | Ga0207640_104459842 | 212 |
| 296 | 3300025986 | Ga0207658_10040272 | Ga0207658_100402722 | 212 |
| 297 | 3300026023 | Ga0207677_10171016 | Ga0207677_101710162 | 212 |
| 298 | 3300026023 | Ga0207677_10280384 | Ga0207677_102803842 | 212 |
| 299 | 3300026035 | Ga0207703_10511524 | Ga0207703_105115242 | 212 |
| 300 | 3300026041 | Ga0207639_10032160 | Ga0207639_100321605 | 212 |
| 301 | 3300026067 | Ga0207678_10014734 | Ga0207678_100147341 | 212 |
| 302 | 3300026067 | Ga0207678_10237336 | Ga0207678_102373362 | 212 |
| 303 | 3300026075 | Ga0207708_10257001 | Ga0207708_102570012 | 212 |
| 304 | 3300026078 | Ga0207702_10424728 | Ga0207702_104247282 | 212 |
| 305 | 3300026088 | Ga0207641_10012469 | Ga0207641_100124697 | 212 |
| 306 | 3300026088 | Ga0207641_10085839 | Ga0207641_100858393 | 212 |
| 307 | 3300026088 | Ga0207641_10108211 | Ga0207641_101082112 | 212 |
| 308 | 3300026088 | Ga0207641_10699389 | Ga0207641_106993892 | 212 |
| 309 | 3300026089 | Ga0207648_10000589 | Ga0207648_1000058913 | 212 |
| 310 | 3300026089 | Ga0207648_10024655 | Ga0207648_100246552 | 212 |
| 311 | 3300026095 | Ga0207676_10035610 | Ga0207676_100356102 | 212 |
| 312 | 3300026095 | Ga0207676_10188978 | Ga0207676_101889783 | 212 |
| 313 | 3300026118 | Ga0207675_100026138 | Ga0207675_1000261385 | 212 |
| 314 | 3300026118 | Ga0207675_100041498 | Ga0207675_1000414983 | 212 |
| 315 | 3300026118 | Ga0207675_100097755 | Ga0207675_1000977552 | 212 |
| 316 | 3300026121 | Ga0207683_10000280 | Ga0207683_1000028027 | 212 |
| 317 | 3300026121 | Ga0207683_10160497 | Ga0207683_101604973 | 212 |
| 318 | 3300026142 | Ga0207698_10037926 | Ga0207698_100379264 | 212 |
| 319 | 3300026142 | Ga0207698_10133354 | Ga0207698_101333542 | 212 |
| 320 | 3300026142 | Ga0207698_10283810 | Ga0207698_102838102 | 212 |
| 321 | 3300028379 | Ga0268266_10012687 | Ga0268266_100126877 | 212 |
| 322 | 3300028380 | Ga0268265_10128898 | Ga0268265_101288982 | 212 |
| 323 | 3300028380 | Ga0268265_10156762 | Ga0268265_101567622 | 212 |
| 324 | 3300028381 | Ga0268264_10032305 | Ga0268264_100323052 | 212 |
| 325 | 3300028381 | Ga0268264_10100821 | Ga0268264_101008212 | 212 |
| 326 | 3300028381 | Ga0268264_10672590 | Ga0268264_106725902 | 212 |
| 327 | 3300031251 | Ga0265327_10173294 | Ga0265327_101732941 | 212 |
| 328 | 3300031691 | Ga0316579_10063727 | Ga0316579_100637272 | 212 |
| 329 | 3300031727 | Ga0316576_10069782 | Ga0316576_100697822 | 212 |
| 330 | 3300031731 | Ga0307405_10263485 | Ga0307405_102634852 | 212 |
| 331 | 3300036647 | Ga0316582_0442418 | Ga0316582_0442418_104_760 | 212 |
| 332 | 3300036712 | Ga0316584_0032417 | Ga0316584_0032417_2153_2809 | 212 |
| 333 | 3300037853 | Ga0436364_1418610 | Ga0436364_1418610_2706_3356 | 212 |
| 334 | 3300039438 | Ga0436360_0726393 | Ga0436360_0726393_19818_20489 | 212 |
| 335 | 3300039453 | Ga0436362_0312415 | Ga0436362_0312415_233_883 | 212 |
| 336 | 3300044712 | Ga0453684_0989252 | Ga0453684_0989252_168_812 | 212 |
| 337 | 3300044765 | Ga0466970_0075111 | Ga0466970_0075111_449_1099 | 212 |
| 338 | 3300045051 | Ga0451576_0000020 | Ga0451576_0000020_408163_408813 | 212 |
| 339 | 3300050511 | nmdc:mga08y16_719284_c1 | nmdc:mga08y16_719284_c1_251_901 | 212 |
| 340 | iso_pu_bacteria | 2738543023 | 2739303986 | 212 |
| 341 | iso_pu_bacteria | 2852627209 | 2852627317 | 212 |
| 342 | iso_pu_bacteria | 3003233435 | 3003233948 | 212 |
| 343 | 3300003316 | rootH1_10001619 | rootH1_100016198 | 213 |
| 344 | 3300003320 | rootH2_10021864 | rootH2_100218645 | 213 |
| 345 | 3300003322 | rootL2_10042221 | rootL2_100422213 | 213 |
| 346 | 3300006844 | Ga0075428_100036856 | Ga0075428_1000368565 | 213 |
| 347 | 3300009094 | Ga0111539_10005241 | Ga0111539_1000524116 | 213 |
| 348 | 3300009094 | Ga0111539_10009709 | Ga0111539_100097095 | 213 |
| 349 | 3300013104 | Ga0157370_10042224 | Ga0157370_100422242 | 213 |
| 350 | 3300014326 | Ga0157380_10000443 | Ga0157380_100004439 | 213 |
| 351 | 3300027907 | Ga0207428_10068166 | Ga0207428_100681663 | 213 |
| 352 | 3300049674 | Ga0501242_013138 | Ga0501242_013138_234_875 | 213 |
| 353 | 3300050510 | nmdc:mga06r32_595827_c1 | nmdc:mga06r32_595827_c1_64_705 | 213 |
| 354 | 3300050511 | nmdc:mga08y16_28509_c1 | nmdc:mga08y16_28509_c1_3145_3786 | 213 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jnw-assembly1.cif.gz_A-2 | active site structure of e. coli pyridoxine 5'-phosphate oxidase | 0.9658 | 1 | 213 |
| 1ci0-assembly1.cif.gz_B | pnp oxidase from saccharomyces cerevisiae | 0.9627 | 15 | 213 |
| 1jnw-assembly1.cif.gz_A-2 | active site structure of e. coli pyridoxine 5'-phosphate oxidase | 0.957 | 1 | 213 |
| 1dnl-assembly1.cif.gz_A | x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution | 0.9533 | 14 | 213 |
| 1dnl-assembly1.cif.gz_A | x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution | 0.9487 | 14 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LTX3_323_519_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9745 | 11 | 203 | 2.30.110.10 |
| af_A0A1R3LXN8_584_738_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9733 | 11 | 164 | 2.30.110.10 |
| 1g78A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9642 | 14 | 213 | 2.30.110.10 |
| af_A0A1R3LXN8_584_738_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9611 | 11 | 164 | 2.30.110.10 |
| 1g78A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9594 | 14 | 213 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6M1NTA4-F1-model_v4 | Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) | 0.9881 | 4 | 213 |
GO:0004733
GO:0008615 GO:0010181 |
| AF-A0A838F021-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) | 0.9856 | 4 | 213 |
GO:0004733
GO:0008615 GO:0010181 |
| AF-A0A4R7HWV7-F1-model_v4 | Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) | 0.9831 | 4 | 213 |
GO:0004733
GO:0008615 GO:0010181 |
| AF-W9C9M7-F1-model_v4 | pyridoxal 5'-phosphate synthase (EC 1.4.3.5) | 0.9806 | 8 | 213 |
GO:0004733
GO:0008615 GO:0010181 |
| AF-A0A3N5KEF8-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) | 0.9806 | 3 | 196 |
GO:0004733
GO:0008615 GO:0010181 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar