F419501

General Info

Members Datasets Scaffolds Average Seq Length
353 219 353 247

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0152824|Ga0495586_0152824_113_1006
Length 297
Sequence VFLELVWACISFAPLPSGTEDEPGRKVKVLDAGARLYFSYRSPDKKGPLKKKSMSKVLVVEDEQHLADGLRFNLEAEGYQVLVTDTGESALEALNADPSAFDVVVLDVMLPGKDGFSVMSEMRGAGQFVPTLMLTARGHPNDVLKGFAAGADDYLTKPFDLAILIARIRGLLRRREWLTKSLNPAATFTRAQDVFKFGDKSVDFDRLELHVREQTFPLTLMEANVLRYLIQHDGKPVSRKRMLEEVWNLHEDTDTRAIDNFIVRLRRYIENDPAKPRHVRTVRGVGYRFMSVPDKED

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
210 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 2.27
Rhizosphere 96.03
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10014473 3300005295 Unclassified 2182
2 Ga0070658_10324857 3300005327 Bacteria 1314
3 Ga0070683_100000886 3300005329 Bacteria 22228
4 Ga0070683_100003309 3300005329 Bacteria 13036
5 Ga0070690_100177025 3300005330 Bacteria 1472
6 Ga0070690_100427936 3300005330 Bacteria 977
7 Ga0068869_100108477 3300005334 Bacteria 2109
8 Ga0070680_100014592 3300005336 Bacteria 6145
9 Ga0070680_100094341 3300005336 Bacteria 2480
10 Ga0068868_100833643 3300005338 Bacteria 834
11 Ga0070660_100017810 3300005339 Bacteria 5182
12 Ga0070689_100057540 3300005340 Bacteria 3018
13 Ga0070689_100154428 3300005340 Bacteria 1853
14 Ga0070691_10001902 3300005341 Bacteria 9151
15 Ga0070661_100083585 3300005344 Bacteria 2358
16 Ga0070671_100401784 3300005355 Bacteria 1172
17 Ga0070674_100351218 3300005356 Bacteria 1191
18 Ga0070667_100334266 3300005367 Bacteria 1369
19 Ga0070703_10003954 3300005406 Bacteria 4197
20 Ga0070709_10079202 3300005434 Bacteria 2140
21 Ga0070714_100113653 3300005435 Bacteria 2401
22 Ga0070713_100157562 3300005436 Bacteria 2025
23 Ga0070713_100416867 3300005436 Bacteria 1256
24 Ga0070713_100479114 3300005436 Bacteria 1172
25 Ga0070711_100089363 3300005439 Bacteria 2216
26 Ga0070711_100106157 3300005439 Unclassified 2053
27 Ga0070711_100157408 3300005439 Bacteria 1719
28 Ga0070705_100042139 3300005440 Bacteria 2608
29 Ga0070694_100001356 3300005444 Bacteria 14294
30 Ga0070708_100000733 3300005445 Bacteria 24862
31 Ga0070681_10002242 3300005458 Bacteria 17633
32 Ga0070685_10232717 3300005466 Bacteria 1213
33 Ga0070706_100010227 3300005467 Bacteria 8723
34 Ga0070698_100002095 3300005471 Bacteria 22137
35 Ga0070699_100006036 3300005518 Bacteria 10593
36 Ga0070699_100568168 3300005518 Unclassified 1033
37 Ga0070679_100000951 3300005530 Bacteria 25171
38 Ga0070684_100004419 3300005535 Bacteria 10698
39 Ga0070684_100063447 3300005535 Bacteria 3239
40 Ga0070697_100000226 3300005536 Bacteria 46212
41 Ga0070695_100000982 3300005545 Bacteria 15526
42 Ga0070695_100090098 3300005545 Bacteria 2046
43 Ga0070696_100000919 3300005546 Bacteria 19147
44 Ga0070693_100000586 3300005547 Bacteria 16088
45 Ga0070693_100054519 3300005547 Bacteria 2300
46 Ga0070665_100002251 3300005548 Bacteria 21447
47 Ga0070704_100003873 3300005549 Bacteria 8614
48 Ga0068855_100009189 3300005563 Bacteria 11934
49 Ga0068855_100358305 3300005563 Bacteria 1605
50 Ga0070664_100135510 3300005564 Bacteria 2165
51 Ga0068857_100000213 3300005577 Bacteria 37993
52 Ga0068856_100000842 3300005614 Bacteria 33106
53 Ga0068856_100003072 3300005614 Bacteria 17044
54 Ga0068852_100001952 3300005616 Bacteria 14042
55 Ga0068859_100092775 3300005617 Bacteria 3071
56 Ga0068866_10023411 3300005718 Bacteria 2873
57 Ga0068861_100498047 3300005719 Bacteria 1101
58 Ga0068863_100022292 3300005841 Bacteria 6047
59 Ga0068863_100059052 3300005841 Bacteria 3629
60 Ga0068858_100039986 3300005842 Bacteria 4348
61 Ga0068858_100096841 3300005842 Bacteria 2750
62 Ga0068858_100270798 3300005842 Unclassified 1616
63 Ga0068860_100013658 3300005843 Bacteria 7961
64 Ga0081455_10098403 3300005937 Bacteria 2355
65 Ga0070715_10048885 3300006163 Bacteria 1810
66 Ga0070715_10192171 3300006163 Bacteria 1031
67 Ga0070716_100015302 3300006173 Bacteria 3940
68 Ga0070712_100017034 3300006175 Unclassified 4698
69 Ga0097621_100010043 3300006237 Bacteria 6903
70 Ga0097621_100056309 3300006237 Bacteria 3212
71 Ga0097621_100160031 3300006237 Bacteria 1935
72 Ga0068871_100020076 3300006358 Bacteria 5114
73 Ga0068871_100024020 3300006358 Bacteria 4724
74 Ga0075430_100116030 3300006846 Bacteria 2231
75 Ga0075431_100103636 3300006847 Bacteria 2936
76 Ga0075431_100123880 3300006847 Bacteria 2666
77 Ga0075433_10043697 3300006852 Bacteria 3891
78 Ga0075434_100003060 3300006871 Bacteria 14890
79 Ga0075434_100385917 3300006871 Bacteria 1421
80 Ga0075434_100646680 3300006871 Bacteria 1076
81 Ga0075429_100302470 3300006880 Bacteria 1400
82 Ga0068865_100314740 3300006881 Bacteria 1257
83 Ga0097620_100092776 3300006931 Bacteria 3071
84 Ga0099794_10002387 3300007265 Bacteria 6915
85 Ga0099794_10003416 3300007265 Bacteria 6053
86 Ga0099794_10003859 3300007265 Bacteria 5802
87 Ga0099794_10012269 3300007265 Unclassified 3691
88 Ga0099794_10023093 3300007265 Bacteria 2841
89 Ga0105240_10007135 3300009093 Bacteria 16275
90 Ga0105240_10029785 3300009093 Bacteria 7103
91 Ga0105240_10460447 3300009093 Bacteria 1421
92 Ga0105245_10004558 3300009098 Bacteria 12229
93 Ga0105245_10034837 3300009098 Bacteria 4466
94 Ga0105247_10045734 3300009101 Bacteria 2687
95 Ga0114129_10957993 3300009147 Bacteria 1080
96 Ga0105243_10827637 3300009148 Bacteria 915
97 Ga0105241_10032572 3300009174 Bacteria 3909
98 Ga0105242_10043219 3300009176 Unclassified 3645
99 Ga0105242_10104610 3300009176 Bacteria 2403
100 Ga0105248_10007501 3300009177 Bacteria 11966
101 Ga0105248_10033383 3300009177 Bacteria 5749
102 Ga0105248_10098360 3300009177 Bacteria 3296
103 Ga0105248_10544744 3300009177 Bacteria 1309
104 Ga0105248_10680754 3300009177 Bacteria 1160
105 Ga0105237_10014284 3300009545 Bacteria 8313
106 Ga0105237_10134844 3300009545 Bacteria 2464
107 Ga0105237_10612239 3300009545 Bacteria 1096
108 Ga0105238_10001821 3300009551 Bacteria 21366
109 Ga0105238_10003161 3300009551 Bacteria 16429
110 Ga0105238_10669730 3300009551 Bacteria 1048
111 Ga0105249_10003880 3300009553 Bacteria 12913
112 Ga0105239_10003241 3300010375 Bacteria 20096
113 Ga0105239_10039657 3300010375 Bacteria 5159
114 Ga0105246_10181990 3300011119 Bacteria 1619
115 Ga0157370_10000946 3300013104 Bacteria 36859
116 Ga0157369_10006336 3300013105 Bacteria 13731
117 Ga0157369_10029471 3300013105 Bacteria 6064
118 Ga0157378_10000116 3300013297 Bacteria 76918
119 Ga0157378_10000550 3300013297 Bacteria 35646
120 Ga0157378_10593665 3300013297 Bacteria 1118
121 Ga0163162_10033546 3300013306 Bacteria 5102
122 Ga0163162_10690786 3300013306 Bacteria 1143
123 Ga0163162_10754885 3300013306 Bacteria 1092
124 Ga0157372_10041540 3300013307 Bacteria 5086
125 Ga0157372_10079917 3300013307 Bacteria 3699
126 Ga0157375_10003093 3300013308 Bacteria 14447
127 Ga0157375_10086171 3300013308 Bacteria 3191
128 Ga0157375_10126359 3300013308 Bacteria 2672
129 Ga0157375_10897357 3300013308 Unclassified 1030
130 Ga0163163_10028652 3300014325 Bacteria 5351
131 Ga0163163_10092426 3300014325 Bacteria 3041
132 Ga0163163_10728431 3300014325 Bacteria 1055
133 Ga0163163_10774638 3300014325 Bacteria 1023
134 Ga0157380_10338340 3300014326 Bacteria 1403
135 Ga0157377_10153818 3300014745 Bacteria 1424
136 Ga0157379_10041221 3300014968 Bacteria 4122
137 Ga0157376_10000016 3300014969 Bacteria 271570
138 Ga0213876_10006816 3300021384 Bacteria 6237
139 Ga0207653_10008994 3300025885 Bacteria 3117
140 Ga0207710_10070775 3300025900 Bacteria 1599
141 Ga0207685_10156808 3300025905 Bacteria 1036
142 Ga0207699_10037649 3300025906 Bacteria 2767
143 Ga0207699_10287669 3300025906 Bacteria 1144
144 Ga0207684_10005736 3300025910 Bacteria 11402
145 Ga0207654_10015918 3300025911 Bacteria 3911
146 Ga0207707_10002623 3300025912 Bacteria 16099
147 Ga0207695_10003796 3300025913 Bacteria 20951
148 Ga0207695_10015084 3300025913 Bacteria 9115
149 Ga0207671_10009101 3300025914 Bacteria 8343
150 Ga0207693_10027946 3300025915 Unclassified 4459
151 Ga0207660_10019521 3300025917 Bacteria 4532
152 Ga0207660_10255082 3300025917 Bacteria 1385
153 Ga0207657_10018719 3300025919 Bacteria 6600
154 Ga0207649_10110914 3300025920 Bacteria 1832
155 Ga0207652_10031528 3300025921 Bacteria 4453
156 Ga0207694_10002197 3300025924 Bacteria 16035
157 Ga0207694_10022772 3300025924 Bacteria 4752
158 Ga0207687_10004571 3300025927 Bacteria 9207
159 Ga0207687_10012908 3300025927 Bacteria 5458
160 Ga0207687_10029102 3300025927 Bacteria 3715
161 Ga0207687_10036250 3300025927 Bacteria 3359
162 Ga0207687_10313831 3300025927 Bacteria 1267
163 Ga0207700_10012535 3300025928 Bacteria 5473
164 Ga0207664_10099673 3300025929 Bacteria 2398
165 Ga0207644_10323183 3300025931 Bacteria 1248
166 Ga0207686_10044826 3300025934 Unclassified 2718
167 Ga0207686_10442001 3300025934 Bacteria 999
168 Ga0207670_10112749 3300025936 Bacteria 1963
169 Ga0207669_10313123 3300025937 Bacteria 1198
170 Ga0207704_10316674 3300025938 Bacteria 1202
171 Ga0207665_10019037 3300025939 Bacteria 4510
172 Ga0207711_10000490 3300025941 Bacteria 40819
173 Ga0207711_10587726 3300025941 Bacteria 1039
174 Ga0207689_10091703 3300025942 Bacteria 2496
175 Ga0207661_10050848 3300025944 Bacteria 3304
176 Ga0207661_10137536 3300025944 Bacteria 2099
177 Ga0207667_10000607 3300025949 Bacteria 46284
178 Ga0207667_10003394 3300025949 Bacteria 19653
179 Ga0207712_10107798 3300025961 Bacteria 2083
180 Ga0207658_10358747 3300025986 Bacteria 1271
181 Ga0207703_10036321 3300026035 Bacteria 3921
182 Ga0207703_10062674 3300026035 Bacteria 3046
183 Ga0207703_10391094 3300026035 Bacteria 1288
184 Ga0207702_10022860 3300026078 Bacteria 5188
185 Ga0207702_10039750 3300026078 Bacteria 3943
186 Ga0207702_10059971 3300026078 Bacteria 3243
187 Ga0207641_10009055 3300026088 Bacteria 8222
188 Ga0207641_10251291 3300026088 Bacteria 1651
189 Ga0207641_10636900 3300026088 Bacteria 1046
190 Ga0207648_10066357 3300026089 Bacteria 3147
191 Ga0207676_10221903 3300026095 Bacteria 1684
192 Ga0207674_10000109 3300026116 Bacteria 94920
193 Ga0207674_10266141 3300026116 Bacteria 1662
194 Ga0207675_100098809 3300026118 Bacteria 2749
195 Ga0207675_100461147 3300026118 Bacteria 1260
196 Ga0207698_10027396 3300026142 Bacteria 4045
197 Ga0209588_1003789 3300027671 Unclassified 4216
198 Ga0209588_1022343 3300027671 Bacteria 1990
199 Ga0209588_1048675 3300027671 Bacteria 1372
200 Ga0265354_1000002 3300028016 Bacteria 39357
201 Ga0265354_1001235 3300028016 Unclassified 3854
202 Ga0268266_10000999 3300028379 Bacteria 35669
203 Ga0268265_10761093 3300028380 Bacteria 941
204 Ga0268264_10023662 3300028381 Bacteria 5009
205 Ga0265338_10079016 3300028800 Bacteria 2771
206 Ga0265338_10141109 3300028800 Bacteria 1887
207 Ga0265770_1003799 3300030878 Bacteria 2054
208 Ga0265765_1002733 3300030879 Unclassified 1730
209 Ga0265760_10017610 3300031090 Unclassified 2052
210 Ga0265330_10188128 3300031235 Bacteria 874
211 Ga0265325_10041217 3300031241 Bacteria 2420
212 Ga0265331_10005495 3300031250 Bacteria 7648
213 Ga0307408_100106679 3300031548 Bacteria 2144
214 Ga0307408_100135627 3300031548 Bacteria 1926
215 Ga0265314_10016518 3300031711 Bacteria 5823
216 Ga0307405_10140892 3300031731 Bacteria 1681
217 Ga0307410_10020240 3300031852 Bacteria 4066
218 Ga0307406_10069395 3300031901 Bacteria 2304
219 Ga0307406_10300312 3300031901 Bacteria 1233
220 Ga0307412_10564820 3300031911 Bacteria 958
221 Ga0307409_100118960 3300031995 Bacteria 2233
222 Ga0307409_100270992 3300031995 Bacteria 1563
223 Ga0307416_100067456 3300032002 Bacteria 2951
224 Ga0307416_100385895 3300032002 Bacteria 1433
225 Ga0307416_100788573 3300032002 Bacteria 1045
226 Ga0307411_10285675 3300032005 Bacteria 1315
227 Ga0307411_10381216 3300032005 Bacteria 1160
228 Ga0307415_100029032 3300032126 Bacteria 3529
229 Ga0316212_1004005 3300033547 Bacteria 2137
230 Ga0373926_0036433 3300035083 Bacteria 1748
231 Ga0373926_0114574 3300035083 Bacteria 1014
232 Ga0373926_0114852 3300035083 Bacteria 1013
233 Ga0373934_0000774 3300035086 Bacteria 11483
234 Ga0373934_0012586 3300035086 Bacteria 3193
235 Ga0373923_0014905 3300035111 Bacteria 2927
236 Ga0373953_0001133 3300035117 Bacteria 7566
237 Ga0373954_0002916 3300035118 Bacteria 7218
238 Ga0373954_0048964 3300035118 Bacteria 1981
239 Ga0373954_0065192 3300035118 Bacteria 1723
240 Ga0373943_0089944 3300035170 Bacteria 1589
241 Ga0373955_0012333 3300035172 Bacteria 4108
242 Ga0373935_0152142 3300035692 Bacteria 1571
243 Ga0373935_0166974 3300035692 Bacteria 1503
244 Ga0373935_0173013 3300035692 Bacteria 1478
245 Ga0373927_0002274 3300035695 Bacteria 14061
246 Ga0373927_0006876 3300035695 Bacteria 7730
247 Ga0373933_0253591 3300035724 Bacteria 1133
248 Ga0373947_0011922 3300035725 Eukaryota 4979
249 Ga0373947_0033742 3300035725 Bacteria 3024
250 Ga0373937_0008378 3300036401 Bacteria 8981
251 Ga0373937_0019088 3300036401 Bacteria 6135
252 Ga0373937_0029323 3300036401 Bacteria 4983
253 Ga0373937_0031374 3300036401 Bacteria 4815
254 Ga0373937_0120841 3300036401 Unclassified 2441
255 Ga0373925_0014481 3300037068 Bacteria 5700
256 Ga0373925_0032223 3300037068 Bacteria 3857
257 Ga0436365_1126070 3300039437 Bacteria 6871
258 Ga0436365_1410579 3300039437 Bacteria 1415
259 Ga0436363_0288022 3300039450 Bacteria 912
260 Ga0439448_0050416 3300042005 Bacteria 1362
261 Ga0439435_0016044 3300042436 Bacteria 1873
262 Ga0439464_0072543 3300042439 Bacteria 1020
263 Ga0495592_0287748 3300046454 Bacteria 1072
264 Ga0495603_0079591 3300046455 Bacteria 1921
265 Ga0495603_0342149 3300046455 Bacteria 858
266 Ga0495651_0021602 3300046462 Bacteria 5002
267 Ga0495653_0022962 3300046463 Eukaryota 5044
268 Ga0495653_0208829 3300046463 Bacteria 1320
269 Ga0495580_0005652 3300046472 Bacteria 10286
270 Ga0495580_0007235 3300046472 Bacteria 8925
271 Ga0495580_0055422 3300046472 Bacteria 2794
272 Ga0495580_0079864 3300046472 Bacteria 2281
273 Ga0495580_0080058 3300046472 Bacteria 2278
274 Ga0495580_0209253 3300046472 Bacteria 1342
275 Ga0495582_0000575 3300046473 Bacteria 20298
276 Ga0495664_0038635 3300046477 Bacteria 2818
277 Ga0495664_0148487 3300046477 Bacteria 1422
278 Ga0495608_0001652 3300046511 Bacteria 16045
279 Ga0495608_0147561 3300046511 Bacteria 1500
280 Ga0495618_0153991 3300046514 Bacteria 1468
281 Ga0495628_0129032 3300046516 Bacteria 1935
282 Ga0495630_0003173 3300046517 Bacteria 11420
283 Ga0495666_0004203 3300046526 Bacteria 7263
284 Ga0495652_0020877 3300046529 Eukaryota 5820
285 Ga0495652_0057378 3300046529 Bacteria 3302
286 Ga0495665_0007742 3300046531 Bacteria 5811
287 Ga0495665_0095181 3300046531 Bacteria 1564
288 Ga0495640_0421758 3300046533 Bacteria 817
289 Ga0495586_0000358 3300046535 Bacteria 28407
290 Ga0495586_0152824 3300046535 Bacteria 1299
291 Ga0495587_0001267 3300046536 Bacteria 16797
292 Ga0495587_0029402 3300046536 Bacteria 3335
293 Ga0495587_0071166 3300046536 Bacteria 2023
294 Ga0495587_0072626 3300046536 Bacteria 2000
295 Ga0495645_0004716 3300046543 Bacteria 9314
296 Ga0495645_0038681 3300046543 Bacteria 3480
297 Ga0495667_0018480 3300046559 Eukaryota 4710
298 Ga0495667_0028661 3300046559 Bacteria 3750
299 Ga0495667_0046121 3300046559 Bacteria 2883
300 Ga0495668_0004869 3300046616 Bacteria 9324
301 Ga0495635_0009940 3300046663 Bacteria 6651
302 Ga0495657_0015190 3300046675 Eukaryota 5638
303 Ga0495599_0022708 3300046678 Bacteria 3917
304 Ga0495623_0009681 3300046679 Bacteria 6255
305 Ga0495623_0038540 3300046679 Bacteria 3056
306 Ga0495646_0001125 3300046680 Bacteria 15589
307 Ga0495658_0476468 3300046683 Bacteria 798
308 Ga0495613_0098325 3300046689 Bacteria 2115
309 Ga0495613_0326888 3300046689 Bacteria 1057
310 Ga0495624_0000570 3300046690 Bacteria 28989
311 Ga0495604_0014608 3300047317 Eukaryota 6258
312 Ga0495604_0033908 3300047317 Bacteria 4040
313 Ga0495604_0215456 3300047317 Bacteria 1325
314 Ga0495674_0008802 3300047319 Bacteria 9602
315 Ga0495674_0101755 3300047319 Bacteria 2444
316 Ga0495674_0329230 3300047319 Bacteria 1243
317 Ga0495674_0567098 3300047319 Bacteria 902
318 Ga0495675_0001500 3300047444 Bacteria 14125
319 Ga0495675_0115431 3300047444 Bacteria 1674
320 Ga0495684_0016188 3300047471 Bacteria 5741
321 Ga0495684_0018533 3300047471 Bacteria 5363
322 Ga0495684_0178150 3300047471 Bacteria 1577
323 Ga0495684_0366248 3300047471 Bacteria 1020
324 Ga0495684_0420914 3300047471 Bacteria 934
325 Ga0495593_0004492 3300047673 Bacteria 8286
326 Ga0495602_0023721 3300048088 Bacteria 5970
327 Ga0495602_0034464 3300048088 Bacteria 4735
328 Ga0495602_0080570 3300048088 Bacteria 2742
329 Ga0495602_0129943 3300048088 Bacteria 2011
330 Ga0495614_0007429 3300048089 Bacteria 4879
331 Ga0496102_0146361 3300048905 Bacteria 2218
332 Ga0496104_0165008 3300048907 Bacteria 2124
333 Ga0496104_0400383 3300048907 Bacteria 1285
334 Ga0496106_0075085 3300048909 Bacteria 2589
335 Ga0496112_0165450 3300048915 Bacteria 2178
336 Ga0496112_0573161 3300048915 Unclassified 1062
337 Ga0496114_0030767 3300048917 Bacteria 4417
338 Ga0496115_0025070 3300048918 Bacteria 4640
339 Ga0501041_0035323 3300049577 Bacteria 3029
340 Ga0501073_0067674 3300049589 Bacteria 2490
341 Ga0501076_0060896 3300049592 Bacteria 3004
342 Ga0501233_031447 3300049668 Bacteria 1202
343 Ga0501283_012222 3300049779 Bacteria 1288
344 nmdc:mga0qj67_49733_c1 3300050509 Bacteria 3313
345 nmdc:mga06r32_71997_c1 3300050510 Bacteria 3346
346 nmdc:mga0n895_13029_c1 3300050512 Bacteria 7481
347 nmdc:mga0n895_73829_c1 3300050512 Bacteria 3387
348 nmdc:mga0rr50_10810_c1 3300050513 Bacteria 5817
349 nmdc:mga0a205_199038_c1 3300050515 Bacteria 1894
350 Ga0495612_0001951 3300053078 Bacteria 8495
351 Ga0495619_0372651 3300053085 Bacteria 987
352 Ga0500568_0002633 3300053139 Bacteria 10429
353 Ga0501082_0743792 3300060353 Bacteria 858

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046683 Ga0495658_0476468 Ga0495658_0476468_128_787 209
2 3300009098 Ga0105245_10004558 Ga0105245_100045582 236
3 3300005617 Ga0068859_100092775 Ga0068859_1000927754 238
4 3300006931 Ga0097620_100092776 Ga0097620_1000927764 238
5 3300025906 Ga0207699_10287669 Ga0207699_102876692 238
6 3300026089 Ga0207648_10066357 Ga0207648_100663575 238
7 3300026118 Ga0207675_100098809 Ga0207675_1000988094 238
8 3300026118 Ga0207675_100461147 Ga0207675_1004611472 238
9 3300031548 Ga0307408_100135627 Ga0307408_1001356272 238
10 3300031901 Ga0307406_10069395 Ga0307406_100693952 238
11 3300031911 Ga0307412_10564820 Ga0307412_105648201 238
12 3300032002 Ga0307416_100788573 Ga0307416_1007885731 238
13 3300049577 Ga0501041_0035323 Ga0501041_0035323_448_1170 238
14 3300049589 Ga0501073_0067674 Ga0501073_0067674_1092_1820 238
15 3300049592 Ga0501076_0060896 Ga0501076_0060896_71_793 238
16 3300060353 Ga0501082_0743792 Ga0501082_0743792_125_847 238
17 3300005518 Ga0070699_100568168 Ga0070699_1005681682 239
18 3300005841 Ga0068863_100022292 Ga0068863_1000222924 239
19 3300005842 Ga0068858_100096841 Ga0068858_1000968413 239
20 3300006173 Ga0070716_100015302 Ga0070716_1000153022 239
21 3300006871 Ga0075434_100385917 Ga0075434_1003859172 239
22 3300006871 Ga0075434_100646680 Ga0075434_1006466802 239
23 3300009177 Ga0105248_10680754 Ga0105248_106807542 239
24 3300009545 Ga0105237_10134844 Ga0105237_101348441 239
25 3300013297 Ga0157378_10593665 Ga0157378_105936652 239
26 3300014325 Ga0163163_10728431 Ga0163163_107284311 239
27 3300014968 Ga0157379_10041221 Ga0157379_100412213 239
28 3300021384 Ga0213876_10006816 Ga0213876_100068165 239
29 3300025939 Ga0207665_10019037 Ga0207665_100190373 239
30 3300025941 Ga0207711_10587726 Ga0207711_105877262 239
31 3300026035 Ga0207703_10062674 Ga0207703_100626742 239
32 3300026088 Ga0207641_10009055 Ga0207641_100090553 239
33 3300031548 Ga0307408_100106679 Ga0307408_1001066792 239
34 3300031731 Ga0307405_10140892 Ga0307405_101408922 239
35 3300031852 Ga0307410_10020240 Ga0307410_100202403 239
36 3300031901 Ga0307406_10300312 Ga0307406_103003122 239
37 3300031995 Ga0307409_100118960 Ga0307409_1001189602 239
38 3300031995 Ga0307409_100270992 Ga0307409_1002709922 239
39 3300032002 Ga0307416_100067456 Ga0307416_1000674563 239
40 3300032005 Ga0307411_10285675 Ga0307411_102856752 239
41 3300032005 Ga0307411_10381216 Ga0307411_103812162 239
42 3300032126 Ga0307415_100029032 Ga0307415_1000290323 239
43 3300035170 Ga0373943_0089944 Ga0373943_0089944_835_1557 239
44 3300039437 Ga0436365_1126070 Ga0436365_1126070_1303_2073 239
45 3300042436 Ga0439435_0016044 Ga0439435_0016044_711_1433 239
46 3300042439 Ga0439464_0072543 Ga0439464_0072543_75_809 239
47 3300046455 Ga0495603_0079591 Ga0495603_0079591_581_1324 239
48 3300046455 Ga0495603_0342149 Ga0495603_0342149_59_802 239
49 3300046472 Ga0495580_0005652 Ga0495580_0005652_5590_6333 239
50 3300046473 Ga0495582_0000575 Ga0495582_0000575_7024_7767 239
51 3300046536 Ga0495587_0029402 Ga0495587_0029402_2039_2794 239
52 3300049668 Ga0501233_031447 Ga0501233_031447_443_1174 239
53 3300049779 Ga0501283_012222 Ga0501283_012222_282_1013 239
54 3300050512 nmdc:mga0n895_73829_c1 nmdc:mga0n895_73829_c1_2480_3223 239
55 3300050513 nmdc:mga0rr50_10810_c1 nmdc:mga0rr50_10810_c1_2672_3415 239
56 3300005330 Ga0070690_100427936 Ga0070690_1004279361 240
57 3300005336 Ga0070680_100094341 Ga0070680_1000943412 240
58 3300005406 Ga0070703_10003954 Ga0070703_100039542 240
59 3300005436 Ga0070713_100479114 Ga0070713_1004791142 240
60 3300005439 Ga0070711_100106157 Ga0070711_1001061573 240
61 3300005439 Ga0070711_100157408 Ga0070711_1001574082 240
62 3300005440 Ga0070705_100042139 Ga0070705_1000421393 240
63 3300005444 Ga0070694_100001356 Ga0070694_1000013563 240
64 3300005445 Ga0070708_100000733 Ga0070708_10000073319 240
65 3300005467 Ga0070706_100010227 Ga0070706_1000102275 240
66 3300005471 Ga0070698_100002095 Ga0070698_10000209528 240
67 3300005518 Ga0070699_100006036 Ga0070699_1000060363 240
68 3300005536 Ga0070697_100000226 Ga0070697_10000022612 240
69 3300005545 Ga0070695_100000982 Ga0070695_10000098210 240
70 3300005545 Ga0070695_100090098 Ga0070695_1000900982 240
71 3300005546 Ga0070696_100000919 Ga0070696_10000091916 240
72 3300005547 Ga0070693_100000586 Ga0070693_1000005868 240
73 3300005547 Ga0070693_100054519 Ga0070693_1000545192 240
74 3300005548 Ga0070665_100002251 Ga0070665_1000022519 240
75 3300005549 Ga0070704_100003873 Ga0070704_1000038733 240
76 3300006163 Ga0070715_10048885 Ga0070715_100488852 240
77 3300006163 Ga0070715_10192171 Ga0070715_101921712 240
78 3300006175 Ga0070712_100017034 Ga0070712_1000170344 240
79 3300006237 Ga0097621_100010043 Ga0097621_1000100433 240
80 3300006358 Ga0068871_100020076 Ga0068871_1000200762 240
81 3300006846 Ga0075430_100116030 Ga0075430_1001160301 240
82 3300006847 Ga0075431_100103636 Ga0075431_1001036364 240
83 3300006880 Ga0075429_100302470 Ga0075429_1003024702 240
84 3300006881 Ga0068865_100314740 Ga0068865_1003147402 240
85 3300007265 Ga0099794_10002387 Ga0099794_100023873 240
86 3300007265 Ga0099794_10003416 Ga0099794_100034163 240
87 3300007265 Ga0099794_10003859 Ga0099794_100038593 240
88 3300007265 Ga0099794_10012269 Ga0099794_100122694 240
89 3300007265 Ga0099794_10023093 Ga0099794_100230932 240
90 3300009101 Ga0105247_10045734 Ga0105247_100457343 240
91 3300009147 Ga0114129_10957993 Ga0114129_109579931 240
92 3300009545 Ga0105237_10612239 Ga0105237_106122391 240
93 3300014325 Ga0163163_10092426 Ga0163163_100924263 240
94 3300014969 Ga0157376_10000016 Ga0157376_1000001645 240
95 3300025885 Ga0207653_10008994 Ga0207653_100089943 240
96 3300025900 Ga0207710_10070775 Ga0207710_100707752 240
97 3300025905 Ga0207685_10156808 Ga0207685_101568081 240
98 3300025910 Ga0207684_10005736 Ga0207684_100057365 240
99 3300025915 Ga0207693_10027946 Ga0207693_100279464 240
100 3300025917 Ga0207660_10255082 Ga0207660_102550821 240
101 3300025938 Ga0207704_10316674 Ga0207704_103166742 240
102 3300027671 Ga0209588_1003789 Ga0209588_10037893 240
103 3300027671 Ga0209588_1022343 Ga0209588_10223433 240
104 3300027671 Ga0209588_1048675 Ga0209588_10486752 240
105 3300028379 Ga0268266_10000999 Ga0268266_1000099912 240
106 3300032002 Ga0307416_100385895 Ga0307416_1003858952 240
107 3300035083 Ga0373926_0114852 Ga0373926_0114852_79_837 240
108 3300046472 Ga0495580_0055422 Ga0495580_0055422_1934_2689 240
109 3300046516 Ga0495628_0129032 Ga0495628_0129032_704_1453 240
110 3300046543 Ga0495645_0038681 Ga0495645_0038681_1009_1758 240
111 3300046616 Ga0495668_0004869 Ga0495668_0004869_3932_4660 240
112 3300048917 Ga0496114_0030767 Ga0496114_0030767_2714_3454 240
113 3300048918 Ga0496115_0025070 Ga0496115_0025070_1339_2079 240
114 3300050509 nmdc:mga0qj67_49733_c1 nmdc:mga0qj67_49733_c1_1458_2189 240
115 3300050510 nmdc:mga06r32_71997_c1 nmdc:mga06r32_71997_c1_2082_2813 240
116 3300005330 Ga0070690_100177025 Ga0070690_1001770252 241
117 3300005340 Ga0070689_100057540 Ga0070689_1000575403 241
118 3300005435 Ga0070714_100113653 Ga0070714_1001136532 241
119 3300005719 Ga0068861_100498047 Ga0068861_1004980472 241
120 3300005937 Ga0081455_10098403 Ga0081455_100984033 241
121 3300006237 Ga0097621_100056309 Ga0097621_1000563093 241
122 3300006358 Ga0068871_100024020 Ga0068871_1000240204 241
123 3300009176 Ga0105242_10104610 Ga0105242_101046103 241
124 3300025929 Ga0207664_10099673 Ga0207664_100996732 241
125 3300025934 Ga0207686_10442001 Ga0207686_104420011 241
126 3300025936 Ga0207670_10112749 Ga0207670_101127492 241
127 3300039437 Ga0436365_1410579 Ga0436365_1410579_382_1128 241
128 3300046536 Ga0495587_0001267 Ga0495587_0001267_2214_2945 241
129 3300047319 Ga0495674_0567098 Ga0495674_0567098_127_861 241
130 3300048088 Ga0495602_0023721 Ga0495602_0023721_2167_2898 241
131 3300005295 Ga0065707_10014473 Ga0065707_100144734 242
132 3300005327 Ga0070658_10324857 Ga0070658_103248572 242
133 3300005329 Ga0070683_100000886 Ga0070683_1000008864 242
134 3300005329 Ga0070683_100003309 Ga0070683_10000330911 242
135 3300005334 Ga0068869_100108477 Ga0068869_1001084772 242
136 3300005336 Ga0070680_100014592 Ga0070680_1000145923 242
137 3300005338 Ga0068868_100833643 Ga0068868_1008336431 242
138 3300005339 Ga0070660_100017810 Ga0070660_1000178104 242
139 3300005340 Ga0070689_100154428 Ga0070689_1001544282 242
140 3300005341 Ga0070691_10001902 Ga0070691_100019029 242
141 3300005344 Ga0070661_100083585 Ga0070661_1000835852 242
142 3300005355 Ga0070671_100401784 Ga0070671_1004017841 242
143 3300005356 Ga0070674_100351218 Ga0070674_1003512182 242
144 3300005367 Ga0070667_100334266 Ga0070667_1003342661 242
145 3300005434 Ga0070709_10079202 Ga0070709_100792024 242
146 3300005436 Ga0070713_100157562 Ga0070713_1001575622 242
147 3300005436 Ga0070713_100416867 Ga0070713_1004168672 242
148 3300005439 Ga0070711_100089363 Ga0070711_1000893632 242
149 3300005458 Ga0070681_10002242 Ga0070681_1000224212 242
150 3300005466 Ga0070685_10232717 Ga0070685_102327172 242
151 3300005530 Ga0070679_100000951 Ga0070679_10000095112 242
152 3300005535 Ga0070684_100004419 Ga0070684_1000044196 242
153 3300005535 Ga0070684_100063447 Ga0070684_1000634474 242
154 3300005563 Ga0068855_100009189 Ga0068855_1000091896 242
155 3300005563 Ga0068855_100358305 Ga0068855_1003583052 242
156 3300005564 Ga0070664_100135510 Ga0070664_1001355102 242
157 3300005577 Ga0068857_100000213 Ga0068857_10000021319 242
158 3300005614 Ga0068856_100000842 Ga0068856_10000084215 242
159 3300005614 Ga0068856_100003072 Ga0068856_10000307214 242
160 3300005616 Ga0068852_100001952 Ga0068852_1000019523 242
161 3300005718 Ga0068866_10023411 Ga0068866_100234112 242
162 3300005841 Ga0068863_100059052 Ga0068863_1000590524 242
163 3300005842 Ga0068858_100039986 Ga0068858_1000399862 242
164 3300005842 Ga0068858_100270798 Ga0068858_1002707982 242
165 3300005843 Ga0068860_100013658 Ga0068860_1000136585 242
166 3300006237 Ga0097621_100160031 Ga0097621_1001600312 242
167 3300006847 Ga0075431_100123880 Ga0075431_1001238802 242
168 3300006852 Ga0075433_10043697 Ga0075433_100436972 242
169 3300006871 Ga0075434_100003060 Ga0075434_10000306011 242
170 3300009093 Ga0105240_10007135 Ga0105240_100071356 242
171 3300009093 Ga0105240_10029785 Ga0105240_100297851 242
172 3300009093 Ga0105240_10460447 Ga0105240_104604472 242
173 3300009098 Ga0105245_10034837 Ga0105245_100348373 242
174 3300009148 Ga0105243_10827637 Ga0105243_108276371 242
175 3300009174 Ga0105241_10032572 Ga0105241_100325722 242
176 3300009176 Ga0105242_10043219 Ga0105242_100432194 242
177 3300009177 Ga0105248_10007501 Ga0105248_1000750111 242
178 3300009177 Ga0105248_10033383 Ga0105248_100333834 242
179 3300009177 Ga0105248_10098360 Ga0105248_100983605 242
180 3300009177 Ga0105248_10544744 Ga0105248_105447442 242
181 3300009545 Ga0105237_10014284 Ga0105237_100142843 242
182 3300009551 Ga0105238_10001821 Ga0105238_100018214 242
183 3300009551 Ga0105238_10003161 Ga0105238_1000316114 242
184 3300009551 Ga0105238_10669730 Ga0105238_106697301 242
185 3300009553 Ga0105249_10003880 Ga0105249_100038806 242
186 3300010375 Ga0105239_10003241 Ga0105239_1000324115 242
187 3300010375 Ga0105239_10039657 Ga0105239_100396574 242
188 3300011119 Ga0105246_10181990 Ga0105246_101819902 242
189 3300013104 Ga0157370_10000946 Ga0157370_100009462 242
190 3300013105 Ga0157369_10006336 Ga0157369_1000633613 242
191 3300013105 Ga0157369_10029471 Ga0157369_100294713 242
192 3300013297 Ga0157378_10000116 Ga0157378_1000011645 242
193 3300013297 Ga0157378_10000550 Ga0157378_1000055026 242
194 3300013306 Ga0163162_10033546 Ga0163162_100335466 242
195 3300013306 Ga0163162_10690786 Ga0163162_106907862 242
196 3300013306 Ga0163162_10754885 Ga0163162_107548852 242
197 3300013307 Ga0157372_10041540 Ga0157372_100415404 242
198 3300013307 Ga0157372_10079917 Ga0157372_100799172 242
199 3300013308 Ga0157375_10003093 Ga0157375_100030937 242
200 3300013308 Ga0157375_10086171 Ga0157375_100861713 242
201 3300013308 Ga0157375_10126359 Ga0157375_101263593 242
202 3300013308 Ga0157375_10897357 Ga0157375_108973571 242
203 3300014325 Ga0163163_10028652 Ga0163163_100286525 242
204 3300014325 Ga0163163_10774638 Ga0163163_107746382 242
205 3300014326 Ga0157380_10338340 Ga0157380_103383402 242
206 3300014745 Ga0157377_10153818 Ga0157377_101538181 242
207 3300025906 Ga0207699_10037649 Ga0207699_100376492 242
208 3300025911 Ga0207654_10015918 Ga0207654_100159182 242
209 3300025912 Ga0207707_10002623 Ga0207707_100026236 242
210 3300025913 Ga0207695_10003796 Ga0207695_1000379614 242
211 3300025913 Ga0207695_10015084 Ga0207695_100150848 242
212 3300025914 Ga0207671_10009101 Ga0207671_100091014 242
213 3300025917 Ga0207660_10019521 Ga0207660_100195213 242
214 3300025919 Ga0207657_10018719 Ga0207657_100187195 242
215 3300025920 Ga0207649_10110914 Ga0207649_101109143 242
216 3300025921 Ga0207652_10031528 Ga0207652_100315284 242
217 3300025924 Ga0207694_10002197 Ga0207694_100021973 242
218 3300025924 Ga0207694_10022772 Ga0207694_100227722 242
219 3300025927 Ga0207687_10004571 Ga0207687_100045718 242
220 3300025927 Ga0207687_10012908 Ga0207687_100129085 242
221 3300025927 Ga0207687_10029102 Ga0207687_100291024 242
222 3300025927 Ga0207687_10036250 Ga0207687_100362503 242
223 3300025927 Ga0207687_10313831 Ga0207687_103138312 242
224 3300025928 Ga0207700_10012535 Ga0207700_100125355 242
225 3300025931 Ga0207644_10323183 Ga0207644_103231832 242
226 3300025934 Ga0207686_10044826 Ga0207686_100448263 242
227 3300025937 Ga0207669_10313123 Ga0207669_103131232 242
228 3300025941 Ga0207711_10000490 Ga0207711_1000049025 242
229 3300025942 Ga0207689_10091703 Ga0207689_100917032 242
230 3300025944 Ga0207661_10050848 Ga0207661_100508483 242
231 3300025944 Ga0207661_10137536 Ga0207661_101375362 242
232 3300025949 Ga0207667_10000607 Ga0207667_1000060715 242
233 3300025949 Ga0207667_10003394 Ga0207667_1000339416 242
234 3300025961 Ga0207712_10107798 Ga0207712_101077982 242
235 3300025986 Ga0207658_10358747 Ga0207658_103587472 242
236 3300026035 Ga0207703_10036321 Ga0207703_100363215 242
237 3300026035 Ga0207703_10391094 Ga0207703_103910942 242
238 3300026078 Ga0207702_10022860 Ga0207702_100228606 242
239 3300026078 Ga0207702_10039750 Ga0207702_100397504 242
240 3300026078 Ga0207702_10059971 Ga0207702_100599712 242
241 3300026088 Ga0207641_10251291 Ga0207641_102512911 242
242 3300026088 Ga0207641_10636900 Ga0207641_106369001 242
243 3300026095 Ga0207676_10221903 Ga0207676_102219032 242
244 3300026116 Ga0207674_10000109 Ga0207674_1000010971 242
245 3300026116 Ga0207674_10266141 Ga0207674_102661412 242
246 3300026142 Ga0207698_10027396 Ga0207698_100273964 242
247 3300028016 Ga0265354_1000002 Ga0265354_10000024 242
248 3300028016 Ga0265354_1001235 Ga0265354_10012355 242
249 3300028380 Ga0268265_10761093 Ga0268265_107610932 242
250 3300028381 Ga0268264_10023662 Ga0268264_100236625 242
251 3300028800 Ga0265338_10079016 Ga0265338_100790162 242
252 3300028800 Ga0265338_10141109 Ga0265338_101411091 242
253 3300030878 Ga0265770_1003799 Ga0265770_10037992 242
254 3300030879 Ga0265765_1002733 Ga0265765_10027331 242
255 3300031090 Ga0265760_10017610 Ga0265760_100176102 242
256 3300031235 Ga0265330_10188128 Ga0265330_101881281 242
257 3300031241 Ga0265325_10041217 Ga0265325_100412172 242
258 3300031250 Ga0265331_10005495 Ga0265331_100054954 242
259 3300031711 Ga0265314_10016518 Ga0265314_100165186 242
260 3300033547 Ga0316212_1004005 Ga0316212_10040052 242
261 3300035083 Ga0373926_0036433 Ga0373926_0036433_280_1047 242
262 3300035083 Ga0373926_0114574 Ga0373926_0114574_98_850 242
263 3300035086 Ga0373934_0000774 Ga0373934_0000774_8865_9608 242
264 3300035086 Ga0373934_0012586 Ga0373934_0012586_1072_1839 242
265 3300035111 Ga0373923_0014905 Ga0373923_0014905_790_1557 242
266 3300035117 Ga0373953_0001133 Ga0373953_0001133_1787_2530 242
267 3300035118 Ga0373954_0002916 Ga0373954_0002916_2904_3671 242
268 3300035118 Ga0373954_0048964 Ga0373954_0048964_960_1721 242
269 3300035118 Ga0373954_0065192 Ga0373954_0065192_787_1530 242
270 3300035172 Ga0373955_0012333 Ga0373955_0012333_742_1503 242
271 3300035692 Ga0373935_0152142 Ga0373935_0152142_168_911 242
272 3300035692 Ga0373935_0166974 Ga0373935_0166974_375_1142 242
273 3300035692 Ga0373935_0173013 Ga0373935_0173013_531_1283 242
274 3300035695 Ga0373927_0002274 Ga0373927_0002274_7374_8126 242
275 3300035695 Ga0373927_0006876 Ga0373927_0006876_5142_5909 242
276 3300035724 Ga0373933_0253591 Ga0373933_0253591_122_865 242
277 3300035725 Ga0373947_0011922 Ga0373947_0011922_3059_3811 242
278 3300035725 Ga0373947_0033742 Ga0373947_0033742_2207_2974 242
279 3300036401 Ga0373937_0008378 Ga0373937_0008378_7935_8669 242
280 3300036401 Ga0373937_0019088 Ga0373937_0019088_3250_4017 242
281 3300036401 Ga0373937_0029323 Ga0373937_0029323_672_1424 242
282 3300036401 Ga0373937_0031374 Ga0373937_0031374_2536_3279 242
283 3300036401 Ga0373937_0120841 Ga0373937_0120841_500_1261 242
284 3300037068 Ga0373925_0014481 Ga0373925_0014481_3751_4518 242
285 3300037068 Ga0373925_0032223 Ga0373925_0032223_1608_2363 242
286 3300039450 Ga0436363_0288022 Ga0436363_0288022_139_882 242
287 3300042005 Ga0439448_0050416 Ga0439448_0050416_48_782 242
288 3300046454 Ga0495592_0287748 Ga0495592_0287748_126_878 242
289 3300046462 Ga0495651_0021602 Ga0495651_0021602_3361_4113 242
290 3300046463 Ga0495653_0022962 Ga0495653_0022962_395_1147 242
291 3300046463 Ga0495653_0208829 Ga0495653_0208829_548_1282 242
292 3300046472 Ga0495580_0007235 Ga0495580_0007235_375_1142 242
293 3300046472 Ga0495580_0079864 Ga0495580_0079864_605_1357 242
294 3300046472 Ga0495580_0080058 Ga0495580_0080058_132_887 242
295 3300046472 Ga0495580_0209253 Ga0495580_0209253_352_1107 242
296 3300046477 Ga0495664_0038635 Ga0495664_0038635_434_1171 242
297 3300046477 Ga0495664_0148487 Ga0495664_0148487_455_1189 242
298 3300046511 Ga0495608_0001652 Ga0495608_0001652_6074_6826 242
299 3300046511 Ga0495608_0147561 Ga0495608_0147561_602_1339 242
300 3300046514 Ga0495618_0153991 Ga0495618_0153991_588_1325 242
301 3300046517 Ga0495630_0003173 Ga0495630_0003173_3337_4089 242
302 3300046526 Ga0495666_0004203 Ga0495666_0004203_6444_7196 242
303 3300046529 Ga0495652_0020877 Ga0495652_0020877_1115_1867 242
304 3300046529 Ga0495652_0057378 Ga0495652_0057378_479_1216 242
305 3300046531 Ga0495665_0007742 Ga0495665_0007742_1523_2275 242
306 3300046531 Ga0495665_0095181 Ga0495665_0095181_534_1301 242
307 3300046533 Ga0495640_0421758 Ga0495640_0421758_53_790 242
308 3300046535 Ga0495586_0000358 Ga0495586_0000358_23538_24290 242
309 3300046535 Ga0495586_0152824 Ga0495586_0152824_113_1006 242
310 3300046536 Ga0495587_0071166 Ga0495587_0071166_618_1355 242
311 3300046536 Ga0495587_0072626 Ga0495587_0072626_980_1717 242
312 3300046543 Ga0495645_0004716 Ga0495645_0004716_4483_5235 242
313 3300046559 Ga0495667_0018480 Ga0495667_0018480_3272_4024 242
314 3300046559 Ga0495667_0028661 Ga0495667_0028661_700_1467 242
315 3300046559 Ga0495667_0046121 Ga0495667_0046121_176_919 242
316 3300046663 Ga0495635_0009940 Ga0495635_0009940_1289_2041 242
317 3300046675 Ga0495657_0015190 Ga0495657_0015190_3946_4698 242
318 3300046678 Ga0495599_0022708 Ga0495599_0022708_1148_1885 242
319 3300046679 Ga0495623_0009681 Ga0495623_0009681_4141_4893 242
320 3300046679 Ga0495623_0038540 Ga0495623_0038540_990_1727 242
321 3300046680 Ga0495646_0001125 Ga0495646_0001125_3929_4681 242
322 3300046689 Ga0495613_0098325 Ga0495613_0098325_974_1717 242
323 3300046689 Ga0495613_0326888 Ga0495613_0326888_96_848 242
324 3300046690 Ga0495624_0000570 Ga0495624_0000570_10158_10910 242
325 3300047317 Ga0495604_0014608 Ga0495604_0014608_956_1708 242
326 3300047317 Ga0495604_0033908 Ga0495604_0033908_1959_2696 242
327 3300047317 Ga0495604_0215456 Ga0495604_0215456_562_1305 242
328 3300047319 Ga0495674_0008802 Ga0495674_0008802_7895_8647 242
329 3300047319 Ga0495674_0101755 Ga0495674_0101755_1697_2434 242
330 3300047319 Ga0495674_0329230 Ga0495674_0329230_140_907 242
331 3300047444 Ga0495675_0001500 Ga0495675_0001500_3981_4733 242
332 3300047444 Ga0495675_0115431 Ga0495675_0115431_732_1469 242
333 3300047471 Ga0495684_0016188 Ga0495684_0016188_1843_2610 242
334 3300047471 Ga0495684_0018533 Ga0495684_0018533_3424_4167 242
335 3300047471 Ga0495684_0178150 Ga0495684_0178150_254_997 242
336 3300047471 Ga0495684_0366248 Ga0495684_0366248_63_815 242
337 3300047471 Ga0495684_0420914 Ga0495684_0420914_109_846 242
338 3300047673 Ga0495593_0004492 Ga0495593_0004492_7279_8031 242
339 3300048088 Ga0495602_0034464 Ga0495602_0034464_955_1707 242
340 3300048088 Ga0495602_0080570 Ga0495602_0080570_1961_2728 242
341 3300048088 Ga0495602_0129943 Ga0495602_0129943_1114_1851 242
342 3300048089 Ga0495614_0007429 Ga0495614_0007429_2823_3575 242
343 3300048905 Ga0496102_0146361 Ga0496102_0146361_252_1013 242
344 3300048907 Ga0496104_0165008 Ga0496104_0165008_852_1595 242
345 3300048907 Ga0496104_0400383 Ga0496104_0400383_356_1117 242
346 3300048909 Ga0496106_0075085 Ga0496106_0075085_683_1444 242
347 3300048915 Ga0496112_0165450 Ga0496112_0165450_551_1312 242
348 3300048915 Ga0496112_0573161 Ga0496112_0573161_242_982 242
349 3300050512 nmdc:mga0n895_13029_c1 nmdc:mga0n895_13029_c1_326_1054 242
350 3300050515 nmdc:mga0a205_199038_c1 nmdc:mga0a205_199038_c1_886_1614 242
351 3300053078 Ga0495612_0001951 Ga0495612_0001951_420_1172 242
352 3300053085 Ga0495619_0372651 Ga0495619_0372651_190_933 242
353 3300053139 Ga0500568_0002633 Ga0500568_0002633_565_1296 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

57

169

0.97

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

213

289

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9686 2 121
3nnn-assembly1.cif.gz_B bef3 activated drrd receiver domain 0.9648 1 120
5uic-assembly1.cif.gz_A structure of the francisella response regulator receiver domain, qseb 0.9645 1 121
2pl1-assembly1.cif.gz_A berrylium fluoride activated receiver domain of e.coli phop 0.9634 3 122
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9628 1 123
ID Description Score Start End Superfamily
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9668 1 83 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.966 1 83 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.962 3 83 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9607 3 83 3.40.50.2300
af_P23836_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9598 3 83 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0H3AL92-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9537 2 120 GO:0000155
GO:0004721
GO:0005524
GO:0005886
AF-A0A536SKJ8-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9527 2 118 GO:0000155
GO:0016020
AF-A0A7C4IG96-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9514 2 119 GO:0000155
GO:0005886
GO:0009927
AF-A0A507ZU98-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9487 2 120 GO:0000155
GO:0016020
AF-A0A3A4RBU0-F1-model_v4 Response regulator 0.9472 3 121 GO:0000160

Feature Viewer

pLDDT pTM Quality
85.42 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map