F419331

General Info

Members Datasets Scaffolds Average Seq Length
353 179 706 555

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100042309|Ga0068857_1000423094
Length 644
Sequence MTMQAASHCSANTPRPLLTRRTYTAAIVSCACGVNSNEYVCDENNRDIPHLVSKRRQPRDLSQVEFRVAAWYHPAAMPRIIAPVSLALALLWAQDSSGPTPMPAVLRNYTPVTEARLRSPNDGDWMMNRRTYDGWGYSPLTQITPANVGRLKPVWSLSTGVINGHEAPPIVHDGVMFVATPGSQVIAIEAATGTVLWRYRRPLAPTVINRHPTTRGVGLLGDKVFLAASDAVLMALDARTGRTVWTTTVADNRSGHYMSLAPLVANGKVLVGTSGGELGIRGFIAAYDPDTGKELWRTYTVPAPGEPGSETWPKGGDQWKTGXGSVWVTANYDPETNLAYMGDQRPGDNLYTSSTIAIDVATGKIKGHFQYTPNESFDWDEVSPPILVDFQRNGRTIKGLVDVARDGYMWFLERGTGPIKFVQGLPYVRQNVFRSLDPVTGRPDLDPARKPGTGKLAEFCPSHWGGKNWPPIAFSPQTRLVYVPANENLCASMEGMPVTYSAGSAFTGARNVLSIVPGADHIGEVQAWNVDTGMRVWTHTFAKSSNWGPLMATGGGLVFGGGTSDRMFRAFDARTGKLLWEYPTNSGVIGQASSFTLNGRQYVAVQSGWGIDARGMQGRLNAIRPGEFPEVPEGGAVWMFALGE

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 3.12
Rhizosphere 96.03
Stem 0
Stem Tuber 0
Unclassified 6.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100042309 3300005577 Bacteria 4041
2 JGI25406J46586_10000103 3300003203 Bacteria 37801
3 JGI25406J46586_10000319 3300003203 Bacteria 21692
4 JGI25406J46586_10002368 3300003203 Bacteria 8910
5 Ga0065712_10068533 3300005290 Bacteria 10024
6 Ga0065712_10070346 3300005290 Bacteria 6088
7 Ga0065715_10012104 3300005293 Bacteria 2331
8 Ga0065707_10000646 3300005295 Bacteria 25221
9 Ga0070658_10089907 3300005327 Bacteria 2529
10 Ga0070676_10003947 3300005328 Bacteria 7786
11 Ga0070676_10036364 3300005328 Bacteria 2837
12 Ga0070676_10072387 3300005328 Bacteria 2072
13 Ga0068869_100011994 3300005334 Bacteria 5705
14 Ga0070666_10019794 3300005335 Bacteria 4347
15 Ga0070666_10041439 3300005335 Bacteria 3077
16 Ga0068868_100015455 3300005338 Bacteria 5646
17 Ga0068868_100038812 3300005338 Bacteria 3696
18 Ga0070660_100012848 3300005339 Bacteria 5988
19 Ga0070687_100007248 3300005343 Bacteria 4609
20 Ga0070687_100025671 3300005343 Bacteria 2829
21 Ga0070661_100084823 3300005344 Bacteria 2340
22 Ga0070669_100002933 3300005353 Bacteria 12294
23 Ga0070669_100005955 3300005353 Bacteria 8796
24 Ga0070669_100027098 3300005353 Bacteria 4125
25 Ga0070669_100065364 3300005353 Unclassified 2680
26 Ga0070675_100000739 3300005354 Bacteria 22817
27 Ga0070675_100001738 3300005354 Bacteria 16089
28 Ga0070675_100010516 3300005354 Bacteria 7227
29 Ga0070675_100031528 3300005354 Bacteria 4285
30 Ga0070675_100039363 3300005354 Bacteria 3857
31 Ga0070671_100010772 3300005355 Bacteria 7334
32 Ga0070671_100057593 3300005355 Bacteria 3234
33 Ga0070674_100001337 3300005356 Bacteria 13002
34 Ga0070688_100015216 3300005365 Bacteria 4370
35 Ga0070667_100042069 3300005367 Unclassified 3833
36 Ga0070709_10054446 3300005434 Bacteria 2522
37 Ga0070714_100138600 3300005435 Bacteria 2181
38 Ga0070713_100017188 3300005436 Bacteria 5464
39 Ga0070713_100049257 3300005436 Bacteria 3475
40 Ga0070710_10044500 3300005437 Bacteria 2463
41 Ga0070705_100000438 3300005440 Bacteria 23868
42 Ga0070694_100002771 3300005444 Bacteria 10400
43 Ga0070694_100031748 3300005444 Bacteria 3464
44 Ga0070678_100039926 3300005456 Bacteria 3317
45 Ga0070662_100043664 3300005457 Bacteria 3208
46 Ga0068867_100028438 3300005459 Bacteria 4025
47 Ga0068867_100030306 3300005459 Bacteria 3903
48 Ga0068867_100151871 3300005459 Bacteria 1820
49 Ga0070698_100026390 3300005471 Bacteria 6046
50 Ga0070698_100079678 3300005471 Bacteria 3271
51 Ga0070699_100010408 3300005518 Bacteria 8049
52 Ga0070697_100059316 3300005536 Bacteria 3116
53 Ga0068853_100194638 3300005539 Unclassified 1843
54 Ga0070686_100000571 3300005544 Bacteria 21949
55 Ga0070686_100035515 3300005544 Bacteria 3079
56 Ga0070695_100000626 3300005545 Bacteria 18747
57 Ga0070695_100073544 3300005545 Bacteria 2244
58 Ga0070696_100000265 3300005546 Bacteria 31638
59 Ga0070696_100028359 3300005546 Bacteria 3820
60 Ga0070665_100001799 3300005548 Bacteria 24308
61 Ga0070665_100002497 3300005548 Bacteria 20241
62 Ga0070665_100018534 3300005548 Bacteria 6975
63 Ga0070665_100080736 3300005548 Bacteria 3258
64 Ga0070665_100097250 3300005548 Unclassified 2949
65 Ga0070704_100004630 3300005549 Bacteria 7960
66 Ga0070704_100006586 3300005549 Bacteria 6852
67 Ga0070704_100025597 3300005549 Bacteria 3887
68 Ga0070704_100036467 3300005549 Bacteria 3351
69 Ga0070704_100059475 3300005549 Bacteria 2727
70 Ga0070704_100077290 3300005549 Bacteria 2438
71 Ga0068855_100008543 3300005563 Bacteria 12378
72 Ga0070664_100006141 3300005564 Bacteria 9719
73 Ga0070664_100080891 3300005564 Unclassified 2799
74 Ga0068856_100021692 3300005614 Bacteria 6241
75 Ga0068859_100011712 3300005617 Bacteria 8811
76 Ga0068859_100074815 3300005617 Bacteria 3426
77 Ga0068859_100077526 3300005617 Bacteria 3364
78 Ga0068864_100011513 3300005618 Bacteria 7308
79 Ga0068864_100089848 3300005618 Bacteria 2707
80 Ga0068861_100016307 3300005719 Bacteria 5254
81 Ga0068861_100032298 3300005719 Bacteria 3852
82 Ga0068870_10014023 3300005840 Bacteria 3778
83 Ga0068863_100003896 3300005841 Bacteria 14741
84 Ga0068863_100016701 3300005841 Bacteria 7042
85 Ga0068863_100033774 3300005841 Unclassified 4873
86 Ga0068863_100154543 3300005841 Bacteria 2196
87 Ga0068858_100011627 3300005842 Bacteria 8303
88 Ga0068858_100019908 3300005842 Bacteria 6273
89 Ga0068858_100021962 3300005842 Bacteria 5960
90 Ga0068858_100142320 3300005842 Bacteria 2252
91 Ga0068860_100048222 3300005843 Bacteria 4059
92 Ga0068862_100004199 3300005844 Bacteria 12198
93 Ga0068862_100014620 3300005844 Bacteria 6518
94 Ga0068862_100156615 3300005844 Bacteria 2031
95 Ga0081455_10048545 3300005937 Bacteria 3667
96 Ga0081540_1018754 3300005983 Bacteria 4231
97 Ga0081539_10000024 3300005985 Bacteria 354702
98 Ga0081539_10000047 3300005985 Bacteria 275235
99 Ga0081539_10000175 3300005985 Bacteria 150479
100 Ga0081539_10000228 3300005985 Bacteria 131823
101 Ga0081539_10006552 3300005985 Bacteria 11107
102 Ga0081539_10012588 3300005985 Bacteria 6494
103 Ga0075432_10022978 3300006058 Bacteria 2135
104 Ga0070716_100061842 3300006173 Bacteria 2169
105 Ga0070712_100048208 3300006175 Bacteria 2952
106 Ga0097621_100001087 3300006237 Bacteria 19017
107 Ga0097621_100003290 3300006237 Bacteria 11114
108 Ga0097621_100014828 3300006237 Bacteria 5846
109 Ga0097621_100095675 3300006237 Bacteria 2491
110 Ga0068871_100002201 3300006358 Bacteria 13250
111 Ga0068871_100010386 3300006358 Bacteria 6793
112 Ga0068871_100022264 3300006358 Bacteria 4886
113 Ga0068871_100032203 3300006358 Bacteria 4140
114 Ga0075428_100000004 3300006844 Bacteria 326694
115 Ga0075428_100000575 3300006844 Bacteria 37520
116 Ga0075430_100000443 3300006846 Bacteria 30826
117 Ga0075430_100001882 3300006846 Bacteria 17187
118 Ga0075430_100120339 3300006846 Bacteria 2189
119 Ga0075431_100001934 3300006847 Bacteria 19739
120 Ga0075433_10025319 3300006852 Bacteria 5014
121 Ga0075433_10044365 3300006852 Bacteria 3862
122 Ga0075434_100003106 3300006871 Bacteria 14792
123 Ga0075434_100006764 3300006871 Bacteria 10536
124 Ga0075434_100010483 3300006871 Bacteria 8689
125 Ga0075434_100011343 3300006871 Bacteria 8400
126 Ga0075434_100025243 3300006871 Bacteria 5815
127 Ga0075429_100025666 3300006880 Bacteria 5116
128 Ga0068865_100007229 3300006881 Bacteria 6821
129 Ga0075436_100018777 3300006914 Bacteria 4735
130 Ga0097620_100011713 3300006931 Bacteria 8811
131 Ga0097620_100074817 3300006931 Bacteria 3426
132 Ga0097620_100077526 3300006931 Bacteria 3364
133 Ga0075435_100015470 3300007076 Bacteria 5736
134 Ga0075435_100016717 3300007076 Bacteria 5535
135 Ga0105240_10002025 3300009093 Bacteria 33421
136 Ga0105240_10029563 3300009093 Bacteria 7135
137 Ga0105240_10147071 3300009093 Bacteria 2811
138 Ga0111539_10000005 3300009094 Bacteria 467342
139 Ga0111539_10004942 3300009094 Bacteria 17336
140 Ga0111539_10030131 3300009094 Bacteria 6599
141 Ga0111539_10081374 3300009094 Bacteria 3809
142 Ga0111539_10081848 3300009094 Bacteria 3797
143 Ga0105245_10005171 3300009098 Bacteria 11461
144 Ga0105245_10007846 3300009098 Bacteria 9345
145 Ga0105245_10020551 3300009098 Bacteria 5790
146 Ga0114129_10003140 3300009147 Bacteria 23183
147 Ga0114129_10004786 3300009147 Bacteria 19133
148 Ga0114129_10009447 3300009147 Bacteria 13899
149 Ga0114129_10019697 3300009147 Bacteria 9604
150 Ga0114129_10019828 3300009147 Bacteria 9569
151 Ga0114129_10021359 3300009147 Bacteria 9189
152 Ga0114129_10023530 3300009147 Bacteria 8731
153 Ga0114129_10026589 3300009147 Bacteria 8195
154 Ga0114129_10027321 3300009147 Bacteria 8080
155 Ga0114129_10033264 3300009147 Bacteria 7286
156 Ga0114129_10138761 3300009147 Bacteria 3334
157 Ga0105243_10053133 3300009148 Bacteria 3213
158 Ga0105241_10005595 3300009174 Bacteria 9280
159 Ga0105241_10044538 3300009174 Bacteria 3363
160 Ga0105242_10011624 3300009176 Bacteria 6770
161 Ga0105242_10012415 3300009176 Bacteria 6558
162 Ga0105242_10094444 3300009176 Bacteria 2523
163 Ga0105248_10006528 3300009177 Bacteria 12789
164 Ga0105248_10008003 3300009177 Bacteria 11611
165 Ga0105248_10012420 3300009177 Bacteria 9394
166 Ga0105248_10067816 3300009177 Bacteria 4005
167 Ga0105248_10092680 3300009177 Bacteria 3402
168 Ga0105248_10188089 3300009177 Unclassified 2327
169 Ga0105237_10044895 3300009545 Unclassified 4449
170 Ga0105238_10039798 3300009551 Unclassified 4766
171 Ga0105238_10063414 3300009551 Bacteria 3696
172 Ga0105238_10066407 3300009551 Unclassified 3609
173 Ga0105238_10099752 3300009551 Bacteria 2887
174 Ga0105249_10021354 3300009553 Bacteria 5796
175 Ga0105239_10119481 3300010375 Bacteria 2925
176 Ga0105239_10129252 3300010375 Bacteria 2808
177 Ga0105246_10017344 3300011119 Unclassified 4574
178 Ga0157370_10004747 3300013104 Bacteria 15474
179 Ga0157374_10005475 3300013296 Bacteria 10655
180 Ga0157374_10241964 3300013296 Bacteria 1774
181 Ga0157378_10000390 3300013297 Bacteria 43243
182 Ga0157378_10009110 3300013297 Bacteria 8639
183 Ga0157378_10026407 3300013297 Bacteria 5119
184 Ga0163162_10149629 3300013306 Bacteria 2451
185 Ga0163162_10165576 3300013306 Bacteria 2334
186 Ga0157375_10020904 3300013308 Bacteria 5991
187 Ga0157375_10066385 3300013308 Bacteria 3602
188 Ga0157375_10187371 3300013308 Bacteria 2223
189 Ga0163163_10006881 3300014325 Bacteria 9984
190 Ga0163163_10015996 3300014325 Bacteria 6953
191 Ga0163163_10022382 3300014325 Bacteria 5983
192 Ga0163163_10176027 3300014325 Bacteria 2186
193 Ga0157380_10001453 3300014326 Bacteria 15501
194 Ga0157380_10008510 3300014326 Bacteria 7331
195 Ga0157380_10026045 3300014326 Bacteria 4439
196 Ga0157380_10035645 3300014326 Bacteria 3844
197 Ga0157377_10011097 3300014745 Bacteria 4485
198 Ga0157379_10025355 3300014968 Bacteria 5266
199 Ga0157379_10045015 3300014968 Bacteria 3939
200 Ga0157376_10008319 3300014969 Bacteria 7480
201 Ga0157376_10025813 3300014969 Bacteria 4633
202 Ga0163161_10015352 3300017792 Bacteria 5339
203 Ga0213875_10000067 3300021388 Bacteria 127481
204 Ga0207697_10003492 3300025315 Bacteria 7762
205 Ga0207682_10000515 3300025893 Bacteria 17793
206 Ga0207688_10002847 3300025901 Bacteria 9398
207 Ga0207680_10005700 3300025903 Bacteria 5964
208 Ga0207680_10017302 3300025903 Unclassified 3807
209 Ga0207645_10008534 3300025907 Bacteria 7143
210 Ga0207643_10002270 3300025908 Bacteria 10469
211 Ga0207705_10019641 3300025909 Bacteria 4831
212 Ga0207654_10007777 3300025911 Bacteria 5410
213 Ga0207654_10017012 3300025911 Bacteria 3795
214 Ga0207707_10015443 3300025912 Bacteria 6652
215 Ga0207695_10010512 3300025913 Bacteria 11320
216 Ga0207695_10012009 3300025913 Bacteria 10420
217 Ga0207695_10018599 3300025913 Bacteria 8027
218 Ga0207695_10019162 3300025913 Bacteria 7884
219 Ga0207695_10075433 3300025913 Bacteria 3431
220 Ga0207693_10056006 3300025915 Bacteria 3092
221 Ga0207662_10031275 3300025918 Bacteria 3092
222 Ga0207657_10036527 3300025919 Bacteria 4396
223 Ga0207649_10061499 3300025920 Bacteria 2364
224 Ga0207646_10091550 3300025922 Bacteria 2722
225 Ga0207646_10201798 3300025922 Bacteria 1796
226 Ga0207694_10003505 3300025924 Bacteria 12466
227 Ga0207659_10000642 3300025926 Bacteria 20752
228 Ga0207659_10007020 3300025926 Bacteria 6916
229 Ga0207659_10011389 3300025926 Bacteria 5616
230 Ga0207659_10026214 3300025926 Bacteria 3930
231 Ga0207687_10017130 3300025927 Unclassified 4764
232 Ga0207687_10017333 3300025927 Bacteria 4740
233 Ga0207687_10043290 3300025927 Bacteria 3102
234 Ga0207700_10143762 3300025928 Bacteria 1963
235 Ga0207664_10094184 3300025929 Bacteria 2461
236 Ga0207644_10044282 3300025931 Bacteria 3161
237 Ga0207706_10011275 3300025933 Bacteria 8145
238 Ga0207686_10013782 3300025934 Bacteria 4484
239 Ga0207686_10019723 3300025934 Unclassified 3841
240 Ga0207709_10018101 3300025935 Bacteria 3941
241 Ga0207669_10088746 3300025937 Unclassified 2006
242 Ga0207704_10058573 3300025938 Bacteria 2373
243 Ga0207665_10056849 3300025939 Bacteria 2642
244 Ga0207691_10006792 3300025940 Bacteria 11034
245 Ga0207711_10008370 3300025941 Bacteria 8654
246 Ga0207711_10037581 3300025941 Bacteria 4114
247 Ga0207711_10047916 3300025941 Bacteria 3655
248 Ga0207711_10059869 3300025941 Bacteria 3280
249 Ga0207711_10141058 3300025941 Bacteria 2168
250 Ga0207679_10040409 3300025945 Unclassified 3339
251 Ga0207667_10012552 3300025949 Bacteria 9748
252 Ga0207667_10074704 3300025949 Bacteria 3520
253 Ga0207651_10092818 3300025960 Bacteria 2215
254 Ga0207712_10039976 3300025961 Bacteria 3216
255 Ga0207640_10028635 3300025981 Bacteria 3408
256 Ga0207703_10004837 3300026035 Bacteria 10963
257 Ga0207703_10005003 3300026035 Bacteria 10753
258 Ga0207703_10015192 3300026035 Bacteria 6007
259 Ga0207703_10115011 3300026035 Bacteria 2301
260 Ga0207639_10052317 3300026041 Unclassified 3112
261 Ga0207702_10020551 3300026078 Bacteria 5466
262 Ga0207641_10001397 3300026088 Bacteria 23777
263 Ga0207641_10008437 3300026088 Bacteria 8518
264 Ga0207641_10017307 3300026088 Bacteria 5900
265 Ga0207648_10002546 3300026089 Bacteria 19547
266 Ga0207648_10012779 3300026089 Bacteria 7844
267 Ga0207648_10082467 3300026089 Bacteria 2804
268 Ga0207674_10003148 3300026116 Bacteria 20339
269 Ga0207674_10063104 3300026116 Bacteria 3741
270 Ga0207675_100005019 3300026118 Bacteria 12752
271 Ga0207675_100020546 3300026118 Bacteria 6154
272 Ga0207683_10017525 3300026121 Bacteria 6105
273 Ga0207683_10072079 3300026121 Bacteria 3055
274 Ga0207428_10000039 3300027907 Bacteria 213218
275 Ga0207428_10010046 3300027907 Bacteria 8471
276 Ga0268266_10001066 3300028379 Bacteria 34388
277 Ga0268266_10019575 3300028379 Bacteria 5767
278 Ga0268265_10008502 3300028380 Bacteria 6938
279 Ga0268265_10044965 3300028380 Bacteria 3291
280 Ga0268265_10079826 3300028380 Bacteria 2578
281 Ga0268264_10010100 3300028381 Bacteria 7812
282 Ga0268264_10050833 3300028381 Bacteria 3452
283 Ga0265314_10002954 3300031711 Bacteria 16839
284 Ga0373941_0031437 3300035115 Unclassified 1582
285 Ga0373927_0001788 3300035695 Bacteria 16049
286 Ga0373927_0030861 3300035695 Bacteria 3496
287 Ga0373937_0049093 3300036401 Bacteria 3865
288 Ga0373925_0012699 3300037068 Bacteria 6101
289 Ga0373925_0148306 3300037068 Unclassified 1840
290 Ga0436364_0410392 3300037853 Bacteria 19971
291 Ga0495651_0000630 3300046462 Bacteria 27291
292 Ga0495580_0003719 3300046472 Bacteria 12924
293 Ga0495580_0048933 3300046472 Bacteria 2991
294 Ga0495630_0064094 3300046517 Bacteria 2761
295 Ga0495643_0000823 3300046522 Bacteria 33811
296 Ga0495640_0043381 3300046533 Unclassified 3133
297 Ga0495667_0020406 3300046559 Bacteria 4472
298 Ga0495634_0018951 3300046642 Unclassified 4893
299 Ga0495658_0004728 3300046683 Bacteria 6687
300 Ga0495658_0012368 3300046683 Bacteria 4321
301 Ga0495675_0010009 3300047444 Bacteria 5914
302 Ga0495684_0037855 3300047471 Bacteria 3700
303 Ga0496101_0002362 3300048904 Bacteria 11578
304 Ga0496102_0039931 3300048905 Bacteria 4243
305 Ga0496104_0012415 3300048907 Bacteria 7659
306 Ga0496104_0021900 3300048907 Bacteria 5870
307 Ga0496104_0127875 3300048907 Bacteria 2440
308 Ga0496106_0031324 3300048909 Bacteria 3963
309 Ga0496106_0108649 3300048909 Bacteria 2157
310 Ga0496108_0051956 3300048911 Bacteria 3434
311 Ga0496112_0043943 3300048915 Bacteria 4375
312 Ga0496113_0062134 3300048916 Bacteria 2820
313 Ga0496114_0011339 3300048917 Bacteria 7120
314 Ga0501047_0015806 3300049581 Bacteria 7193
315 Ga0501048_0035492 3300049582 Bacteria 3590
316 Ga0501249_002504 3300049679 Bacteria 3711
317 Ga0501079_0107132 3300049741 Bacteria 2169
318 Ga0501268_001394 3300049765 Bacteria 3011
319 Ga0501044_0005941 3300049823 Bacteria 13519
320 Ga0501045_0101758 3300049824 Bacteria 2127
321 nmdc:mga05p37_149685_c1 3300050507 Bacteria 2856
322 nmdc:mga05p37_2403_c1 3300050507 Bacteria 21790
323 nmdc:mga05p37_26383_c1 3300050507 Bacteria 7066
324 nmdc:mga05p37_26710_c1 3300050507 Bacteria 7022
325 nmdc:mga05p37_28487_c1 3300050507 Bacteria 6810
326 nmdc:mga05p37_30509_c1 3300050507 Bacteria 6578
327 nmdc:mga05p37_47067_c1 3300050507 Bacteria 5304
328 nmdc:mga0qj67_33248_c1 3300050509 Bacteria 4024
329 nmdc:mga0qj67_94297_c1 3300050509 Bacteria 2407
330 nmdc:mga06r32_1414_c1 3300050510 Bacteria 21664
331 nmdc:mga08y16_25368_c1 3300050511 Bacteria 6251
332 nmdc:mga08y16_65181_c1 3300050511 Unclassified 3803
333 nmdc:mga08y16_6_c1 3300050511 Bacteria 622294
334 nmdc:mga08y16_87483_c1 3300050511 Bacteria 3247
335 nmdc:mga08y16_88219_c1 3300050511 Bacteria 3232
336 nmdc:mga0n895_24_c1 3300050512 Bacteria 92082
337 nmdc:mga0n895_29931_c1 3300050512 Bacteria 5198
338 nmdc:mga0n895_38482_c1 3300050512 Bacteria 4634
339 nmdc:mga0rr50_1632_c1 3300050513 Bacteria 12337
340 nmdc:mga0rr50_17836_c1 3300050513 Bacteria 4753
341 nmdc:mga0rr50_41922_c1 3300050513 Bacteria 3339
342 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
343 nmdc:mga08x19_1577_c1 3300050514 Bacteria 14139
344 nmdc:mga08x19_356_c1 3300050514 Bacteria 32856
345 nmdc:mga08x19_74285_c1 3300050514 Bacteria 2221
346 nmdc:mga0a205_149232_c1 3300050515 Bacteria 2238
347 nmdc:mga0a205_160512_c1 3300050515 Bacteria 2145
348 nmdc:mga0a205_164589_c1 3300050515 Bacteria 2114
349 nmdc:mga0a205_27018_c1 3300050515 Bacteria 5479
350 nmdc:mga0a205_50062_c1 3300050515 Bacteria 4034
351 Ga0495619_0039272 3300053085 Bacteria 3090
352 Ga0500641_0004071 3300053096 Bacteria 5161
353 Ga0501084_0033083 3300054114 Bacteria 4325
354 Ga0068857_100042309
355 JGI25406J46586_10000103
356 JGI25406J46586_10000319
357 JGI25406J46586_10002368
358 Ga0065712_10068533
359 Ga0065712_10070346
360 Ga0065715_10012104
361 Ga0065707_10000646
362 Ga0070658_10089907
363 Ga0070676_10003947
364 Ga0070676_10036364
365 Ga0070676_10072387
366 Ga0068869_100011994
367 Ga0070666_10019794
368 Ga0070666_10041439
369 Ga0068868_100015455
370 Ga0068868_100038812
371 Ga0070660_100012848
372 Ga0070687_100007248
373 Ga0070687_100025671
374 Ga0070661_100084823
375 Ga0070669_100002933
376 Ga0070669_100005955
377 Ga0070669_100027098
378 Ga0070669_100065364
379 Ga0070675_100000739
380 Ga0070675_100001738
381 Ga0070675_100010516
382 Ga0070675_100031528
383 Ga0070675_100039363
384 Ga0070671_100010772
385 Ga0070671_100057593
386 Ga0070674_100001337
387 Ga0070688_100015216
388 Ga0070667_100042069
389 Ga0070709_10054446
390 Ga0070714_100138600
391 Ga0070713_100017188
392 Ga0070713_100049257
393 Ga0070710_10044500
394 Ga0070705_100000438
395 Ga0070694_100002771
396 Ga0070694_100031748
397 Ga0070678_100039926
398 Ga0070662_100043664
399 Ga0068867_100028438
400 Ga0068867_100030306
401 Ga0068867_100151871
402 Ga0070698_100026390
403 Ga0070698_100079678
404 Ga0070699_100010408
405 Ga0070697_100059316
406 Ga0068853_100194638
407 Ga0070686_100000571
408 Ga0070686_100035515
409 Ga0070695_100000626
410 Ga0070695_100073544
411 Ga0070696_100000265
412 Ga0070696_100028359
413 Ga0070665_100001799
414 Ga0070665_100002497
415 Ga0070665_100018534
416 Ga0070665_100080736
417 Ga0070665_100097250
418 Ga0070704_100004630
419 Ga0070704_100006586
420 Ga0070704_100025597
421 Ga0070704_100036467
422 Ga0070704_100059475
423 Ga0070704_100077290
424 Ga0068855_100008543
425 Ga0070664_100006141
426 Ga0070664_100080891
427 Ga0068856_100021692
428 Ga0068859_100011712
429 Ga0068859_100074815
430 Ga0068859_100077526
431 Ga0068864_100011513
432 Ga0068864_100089848
433 Ga0068861_100016307
434 Ga0068861_100032298
435 Ga0068870_10014023
436 Ga0068863_100003896
437 Ga0068863_100016701
438 Ga0068863_100033774
439 Ga0068863_100154543
440 Ga0068858_100011627
441 Ga0068858_100019908
442 Ga0068858_100021962
443 Ga0068858_100142320
444 Ga0068860_100048222
445 Ga0068862_100004199
446 Ga0068862_100014620
447 Ga0068862_100156615
448 Ga0081455_10048545
449 Ga0081540_1018754
450 Ga0081539_10000024
451 Ga0081539_10000047
452 Ga0081539_10000175
453 Ga0081539_10000228
454 Ga0081539_10006552
455 Ga0081539_10012588
456 Ga0075432_10022978
457 Ga0070716_100061842
458 Ga0070712_100048208
459 Ga0097621_100001087
460 Ga0097621_100003290
461 Ga0097621_100014828
462 Ga0097621_100095675
463 Ga0068871_100002201
464 Ga0068871_100010386
465 Ga0068871_100022264
466 Ga0068871_100032203
467 Ga0075428_100000004
468 Ga0075428_100000575
469 Ga0075430_100000443
470 Ga0075430_100001882
471 Ga0075430_100120339
472 Ga0075431_100001934
473 Ga0075433_10025319
474 Ga0075433_10044365
475 Ga0075434_100003106
476 Ga0075434_100006764
477 Ga0075434_100010483
478 Ga0075434_100011343
479 Ga0075434_100025243
480 Ga0075429_100025666
481 Ga0068865_100007229
482 Ga0075436_100018777
483 Ga0097620_100011713
484 Ga0097620_100074817
485 Ga0097620_100077526
486 Ga0075435_100015470
487 Ga0075435_100016717
488 Ga0105240_10002025
489 Ga0105240_10029563
490 Ga0105240_10147071
491 Ga0111539_10000005
492 Ga0111539_10004942
493 Ga0111539_10030131
494 Ga0111539_10081374
495 Ga0111539_10081848
496 Ga0105245_10005171
497 Ga0105245_10007846
498 Ga0105245_10020551
499 Ga0114129_10003140
500 Ga0114129_10004786
501 Ga0114129_10009447
502 Ga0114129_10019697
503 Ga0114129_10019828
504 Ga0114129_10021359
505 Ga0114129_10023530
506 Ga0114129_10026589
507 Ga0114129_10027321
508 Ga0114129_10033264
509 Ga0114129_10138761
510 Ga0105243_10053133
511 Ga0105241_10005595
512 Ga0105241_10044538
513 Ga0105242_10011624
514 Ga0105242_10012415
515 Ga0105242_10094444
516 Ga0105248_10006528
517 Ga0105248_10008003
518 Ga0105248_10012420
519 Ga0105248_10067816
520 Ga0105248_10092680
521 Ga0105248_10188089
522 Ga0105237_10044895
523 Ga0105238_10039798
524 Ga0105238_10063414
525 Ga0105238_10066407
526 Ga0105238_10099752
527 Ga0105249_10021354
528 Ga0105239_10119481
529 Ga0105239_10129252
530 Ga0105246_10017344
531 Ga0157370_10004747
532 Ga0157374_10005475
533 Ga0157374_10241964
534 Ga0157378_10000390
535 Ga0157378_10009110
536 Ga0157378_10026407
537 Ga0163162_10149629
538 Ga0163162_10165576
539 Ga0157375_10020904
540 Ga0157375_10066385
541 Ga0157375_10187371
542 Ga0163163_10006881
543 Ga0163163_10015996
544 Ga0163163_10022382
545 Ga0163163_10176027
546 Ga0157380_10001453
547 Ga0157380_10008510
548 Ga0157380_10026045
549 Ga0157380_10035645
550 Ga0157377_10011097
551 Ga0157379_10025355
552 Ga0157379_10045015
553 Ga0157376_10008319
554 Ga0157376_10025813
555 Ga0163161_10015352
556 Ga0213875_10000067
557 Ga0207697_10003492
558 Ga0207682_10000515
559 Ga0207688_10002847
560 Ga0207680_10005700
561 Ga0207680_10017302
562 Ga0207645_10008534
563 Ga0207643_10002270
564 Ga0207705_10019641
565 Ga0207654_10007777
566 Ga0207654_10017012
567 Ga0207707_10015443
568 Ga0207695_10010512
569 Ga0207695_10012009
570 Ga0207695_10018599
571 Ga0207695_10019162
572 Ga0207695_10075433
573 Ga0207693_10056006
574 Ga0207662_10031275
575 Ga0207657_10036527
576 Ga0207649_10061499
577 Ga0207646_10091550
578 Ga0207646_10201798
579 Ga0207694_10003505
580 Ga0207659_10000642
581 Ga0207659_10007020
582 Ga0207659_10011389
583 Ga0207659_10026214
584 Ga0207687_10017130
585 Ga0207687_10017333
586 Ga0207687_10043290
587 Ga0207700_10143762
588 Ga0207664_10094184
589 Ga0207644_10044282
590 Ga0207706_10011275
591 Ga0207686_10013782
592 Ga0207686_10019723
593 Ga0207709_10018101
594 Ga0207669_10088746
595 Ga0207704_10058573
596 Ga0207665_10056849
597 Ga0207691_10006792
598 Ga0207711_10008370
599 Ga0207711_10037581
600 Ga0207711_10047916
601 Ga0207711_10059869
602 Ga0207711_10141058
603 Ga0207679_10040409
604 Ga0207667_10012552
605 Ga0207667_10074704
606 Ga0207651_10092818
607 Ga0207712_10039976
608 Ga0207640_10028635
609 Ga0207703_10004837
610 Ga0207703_10005003
611 Ga0207703_10015192
612 Ga0207703_10115011
613 Ga0207639_10052317
614 Ga0207702_10020551
615 Ga0207641_10001397
616 Ga0207641_10008437
617 Ga0207641_10017307
618 Ga0207648_10002546
619 Ga0207648_10012779
620 Ga0207648_10082467
621 Ga0207674_10003148
622 Ga0207674_10063104
623 Ga0207675_100005019
624 Ga0207675_100020546
625 Ga0207683_10017525
626 Ga0207683_10072079
627 Ga0207428_10000039
628 Ga0207428_10010046
629 Ga0268266_10001066
630 Ga0268266_10019575
631 Ga0268265_10008502
632 Ga0268265_10044965
633 Ga0268265_10079826
634 Ga0268264_10010100
635 Ga0268264_10050833
636 Ga0265314_10002954
637 Ga0373941_0031437
638 Ga0373927_0001788
639 Ga0373927_0030861
640 Ga0373937_0049093
641 Ga0373925_0012699
642 Ga0373925_0148306
643 Ga0436364_0410392
644 Ga0495651_0000630
645 Ga0495580_0003719
646 Ga0495580_0048933
647 Ga0495630_0064094
648 Ga0495643_0000823
649 Ga0495640_0043381
650 Ga0495667_0020406
651 Ga0495634_0018951
652 Ga0495658_0004728
653 Ga0495658_0012368
654 Ga0495675_0010009
655 Ga0495684_0037855
656 Ga0496101_0002362
657 Ga0496102_0039931
658 Ga0496104_0012415
659 Ga0496104_0021900
660 Ga0496104_0127875
661 Ga0496106_0031324
662 Ga0496106_0108649
663 Ga0496108_0051956
664 Ga0496112_0043943
665 Ga0496113_0062134
666 Ga0496114_0011339
667 Ga0501047_0015806
668 Ga0501048_0035492
669 Ga0501249_002504
670 Ga0501079_0107132
671 Ga0501268_001394
672 Ga0501044_0005941
673 Ga0501045_0101758
674 nmdc:mga05p37_149685_c1
675 nmdc:mga05p37_2403_c1
676 nmdc:mga05p37_26383_c1
677 nmdc:mga05p37_26710_c1
678 nmdc:mga05p37_28487_c1
679 nmdc:mga05p37_30509_c1
680 nmdc:mga05p37_47067_c1
681 nmdc:mga0qj67_33248_c1
682 nmdc:mga0qj67_94297_c1
683 nmdc:mga06r32_1414_c1
684 nmdc:mga08y16_25368_c1
685 nmdc:mga08y16_65181_c1
686 nmdc:mga08y16_6_c1
687 nmdc:mga08y16_87483_c1
688 nmdc:mga08y16_88219_c1
689 nmdc:mga0n895_24_c1
690 nmdc:mga0n895_29931_c1
691 nmdc:mga0n895_38482_c1
692 nmdc:mga0rr50_1632_c1
693 nmdc:mga0rr50_17836_c1
694 nmdc:mga0rr50_41922_c1
695 nmdc:mga0rr50_5_c1
696 nmdc:mga08x19_1577_c1
697 nmdc:mga08x19_356_c1
698 nmdc:mga08x19_74285_c1
699 nmdc:mga0a205_149232_c1
700 nmdc:mga0a205_160512_c1
701 nmdc:mga0a205_164589_c1
702 nmdc:mga0a205_27018_c1
703 nmdc:mga0a205_50062_c1
704 Ga0495619_0039272
705 Ga0500641_0004071
706 Ga0501084_0033083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01011

PQQ

PQQ enzyme repeat

556

593

0.88

PF13570

PQQ_3

PQQ-like domain

524

575

0.8

PF13360

PQQ_2

PQQ-like domain

521

617

0.79

PF13360

PQQ_2

PQQ-like domain

152

366

0.49

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zcv-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.9057 41 561
6fkw-assembly2.cif.gz_B europium-containing methanol dehydrogenase 0.9056 43 560
6zcw-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.9052 39 561
1flg-assembly1.cif.gz_B crystal structure of the quinoprotein ethanol dehydrogenase from pseudomonas aeruginosa 0.9019 39 561
2ad8-assembly1.cif.gz_A crystal structure of methanol dehydrogenase from m. w3a1 (form c) in the presence of ethanol 0.8965 44 560
ID Description Score Start End Superfamily
1flgA00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.9043 39 561 2.140.10.10
af_Q5RG49_936_1023_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8929 441 515 2.40.128.630
6damA00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.8797 43 561 2.140.10.10
4tqoD00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.8765 45 560 2.140.10.10
1flgA00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.8438 39 561 2.140.10.10
ID Description Score Start End GO Terms
AF-A0A2V8D3B2-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family 0.9566 38 193 GO:0016491
AF-A0A0R2TB58-F1-model_v4 Alcohol dehydrogenase 0.9518 270 561 GO:0016491
AF-A0A349Z239-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family 0.9504 36 561 GO:0005509
GO:0016020
GO:0016614
AF-A0A352VMG5-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family 0.9466 64 561 GO:0005509
GO:0016020
GO:0016614
AF-A0A2V9CT36-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family 0.9456 16 561 GO:0005509
GO:0016020
GO:0016614

Map