F419279

General Info

Members Datasets Scaffolds Average Seq Length
353 188 344 289

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10142807|Ga0070691_101428071
Length 313
Sequence VGGADVNRREFLVSLPVAGTLSSLSLADARRAGAQTQAGAKTTRIKHGATRQLFGANRPLEDCFRLGAELGFKAFDFISNPADWPLLKKYGLTGSLHRISFGGGVSGGRPPDGPPGWEAIGLKGEGTAPYLAALHEGIDVAAANGFPNILLQAGARSATLSYEQGADNAVAFCNAVKSHAEDKNVTLCIEYLNPKGLQSPVNSMFDHMAWGVDVLKRVGSPRVKILYDIYHAQISEGYIVQTIRDNIQYIGHIHTGGVPGRHELDETQELNYRFIAQAIADVKFTGFVTHEWSPAPGNDPIASIKKSLAIMDV

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
115 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
116 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
117 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
118 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
122 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 0.85
Rhizosphere 98.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100081068 3300005329 Bacteria 3038
2 Ga0070690_100030894 3300005330 Bacteria 3333
3 Ga0070677_10099702 3300005333 Bacteria 1278
4 Ga0068869_100187630 3300005334 Bacteria 1624
5 Ga0070666_10250558 3300005335 Bacteria 1254
6 Ga0070660_100252739 3300005339 Bacteria 1438
7 Ga0070689_100003316 3300005340 Bacteria 10688
8 Ga0070691_10142807 3300005341 Unclassified 1221
9 Ga0070687_100021024 3300005343 Bacteria 3060
10 Ga0070687_100039380 3300005343 Bacteria 2375
11 Ga0070661_100320836 3300005344 Bacteria 1210
12 Ga0070668_100196561 3300005347 Bacteria 1654
13 Ga0070669_100114339 3300005353 Bacteria 2052
14 Ga0070675_100000097 3300005354 Bacteria 50764
15 Ga0070675_100048484 3300005354 Unclassified 3483
16 Ga0070675_100192798 3300005354 Unclassified 1766
17 Ga0070671_100004132 3300005355 Bacteria 11463
18 Ga0070671_100116621 3300005355 Unclassified 2245
19 Ga0070674_100001325 3300005356 Bacteria 13036
20 Ga0070674_100040757 3300005356 Bacteria 3144
21 Ga0070674_100149241 3300005356 Bacteria 1762
22 Ga0070688_100014462 3300005365 Unclassified 4472
23 Ga0070659_100066745 3300005366 Bacteria 2852
24 Ga0070659_100367372 3300005366 Bacteria 1210
25 Ga0070714_100074252 3300005435 Bacteria 2948
26 Ga0070701_10104715 3300005438 Bacteria 1572
27 Ga0070705_100351395 3300005440 Bacteria 1075
28 Ga0070694_100022102 3300005444 Bacteria 4073
29 Ga0070694_100170813 3300005444 Bacteria 1602
30 Ga0070708_100069023 3300005445 Unclassified 3178
31 Ga0070678_100184722 3300005456 Bacteria 1710
32 Ga0070678_100416718 3300005456 Bacteria 1170
33 Ga0070662_100075977 3300005457 Bacteria 2489
34 Ga0070662_100387843 3300005457 Bacteria 1151
35 Ga0068867_100034357 3300005459 Unclassified 3675
36 Ga0070698_100036025 3300005471 Bacteria 5114
37 Ga0070698_100156906 3300005471 Bacteria 2221
38 Ga0070699_100007438 3300005518 Bacteria 9531
39 Ga0070699_100023613 3300005518 Bacteria 5297
40 Ga0070684_100349901 3300005535 Bacteria 1359
41 Ga0070697_100033191 3300005536 Bacteria 4157
42 Ga0070697_100293465 3300005536 Bacteria 1397
43 Ga0070697_100297190 3300005536 Bacteria 1388
44 Ga0070672_100010590 3300005543 Bacteria 6399
45 Ga0070672_100013170 3300005543 Bacteria 5833
46 Ga0070672_100273049 3300005543 Bacteria 1428
47 Ga0070686_100001482 3300005544 Bacteria 13230
48 Ga0070695_100008283 3300005545 Bacteria 6169
49 Ga0070696_100001683 3300005546 Bacteria 14485
50 Ga0070696_100106614 3300005546 Bacteria 2014
51 Ga0070704_100002439 3300005549 Bacteria 10431
52 Ga0070704_100002968 3300005549 Bacteria 9642
53 Ga0070704_100019886 3300005549 Bacteria 4321
54 Ga0070704_100235626 3300005549 Bacteria 1495
55 Ga0070704_100386413 3300005549 Bacteria 1191
56 Ga0070664_100006000 3300005564 Bacteria 9821
57 Ga0070664_100209832 3300005564 Unclassified 1740
58 Ga0068857_100172467 3300005577 Bacteria 1966
59 Ga0068856_100095586 3300005614 Bacteria 2959
60 Ga0068852_100217348 3300005616 Bacteria 1816
61 Ga0068859_100001043 3300005617 Bacteria 28397
62 Ga0068859_100022803 3300005617 Bacteria 6276
63 Ga0068859_100486079 3300005617 Bacteria 1330
64 Ga0068864_100123651 3300005618 Unclassified 2316
65 Ga0068864_100230819 3300005618 Bacteria 1711
66 Ga0068866_10022105 3300005718 Bacteria 2940
67 Ga0068861_100093624 3300005719 Bacteria 2376
68 Ga0068861_100164078 3300005719 Bacteria 1835
69 Ga0068863_100017768 3300005841 Bacteria 6807
70 Ga0068863_100183343 3300005841 Bacteria 2010
71 Ga0068858_100018281 3300005842 Bacteria 6563
72 Ga0068858_100119223 3300005842 Bacteria 2467
73 Ga0068858_100454367 3300005842 Bacteria 1235
74 Ga0068860_100003528 3300005843 Bacteria 16087
75 Ga0068862_100000476 3300005844 Bacteria 43274
76 Ga0068862_100092697 3300005844 Bacteria 2633
77 Ga0081455_10070303 3300005937 Bacteria 2907
78 Ga0081455_10129941 3300005937 Bacteria 1971
79 Ga0070717_10045774 3300006028 Bacteria 3578
80 Ga0070716_100189646 3300006173 Bacteria 1357
81 Ga0097621_100068599 3300006237 Bacteria 2925
82 Ga0097621_100107084 3300006237 Unclassified 2358
83 Ga0097621_100358856 3300006237 Bacteria 1298
84 Ga0097621_100359486 3300006237 Unclassified 1297
85 Ga0068871_100090563 3300006358 Bacteria 2548
86 Ga0075428_100048657 3300006844 Bacteria 4653
87 Ga0075428_100107671 3300006844 Unclassified 3038
88 Ga0075428_100680424 3300006844 Bacteria 1096
89 Ga0075431_100015600 3300006847 Bacteria 7700
90 Ga0075433_10013480 3300006852 Bacteria 6646
91 Ga0075433_10028047 3300006852 Bacteria 4783
92 Ga0075433_10101995 3300006852 Unclassified 2541
93 Ga0075433_10198206 3300006852 Bacteria 1785
94 Ga0075433_10392816 3300006852 Unclassified 1224
95 Ga0075434_100002528 3300006871 Bacteria 16140
96 Ga0075434_100006325 3300006871 Bacteria 10858
97 Ga0075434_100061210 3300006871 Bacteria 3745
98 Ga0075434_100090554 3300006871 Bacteria 3060
99 Ga0075434_100097845 3300006871 Bacteria 2939
100 Ga0075434_100200265 3300006871 Bacteria 2016
101 Ga0075434_100230887 3300006871 Bacteria 1870
102 Ga0075434_100804763 3300006871 Bacteria 956
103 Ga0075429_100068949 3300006880 Bacteria 3078
104 Ga0075429_100591115 3300006880 Bacteria 972
105 Ga0068865_100038321 3300006881 Bacteria 3244
106 Ga0068865_100363755 3300006881 Bacteria 1175
107 Ga0075436_100001119 3300006914 Bacteria 18126
108 Ga0075436_100165658 3300006914 Bacteria 1559
109 Ga0097620_100001043 3300006931 Bacteria 28397
110 Ga0097620_100022801 3300006931 Bacteria 6276
111 Ga0097620_100486019 3300006931 Bacteria 1330
112 Ga0075435_100001156 3300007076 Bacteria 16854
113 Ga0075435_100002022 3300007076 Bacteria 13263
114 Ga0075435_100008104 3300007076 Bacteria 7524
115 Ga0075435_100015014 3300007076 Bacteria 5811
116 Ga0075435_100015245 3300007076 Bacteria 5774
117 Ga0075435_100015898 3300007076 Bacteria 5665
118 Ga0075435_100020990 3300007076 Bacteria 5017
119 Ga0075435_100217812 3300007076 Bacteria 1621
120 Ga0075435_100241312 3300007076 Bacteria 1537
121 Ga0075435_100501177 3300007076 Bacteria 1050
122 Ga0105240_10020493 3300009093 Bacteria 8816
123 Ga0105240_10057913 3300009093 Bacteria 4838
124 Ga0105240_10252204 3300009093 Bacteria 2040
125 Ga0111539_10037004 3300009094 Bacteria 5898
126 Ga0111539_10324024 3300009094 Bacteria 1793
127 Ga0111539_10443878 3300009094 Unclassified 1511
128 Ga0105245_10475732 3300009098 Bacteria 1262
129 Ga0114129_10002003 3300009147 Bacteria 27888
130 Ga0114129_10004550 3300009147 Bacteria 19577
131 Ga0114129_10034786 3300009147 Bacteria 7118
132 Ga0114129_10074603 3300009147 Bacteria 4725
133 Ga0114129_10096506 3300009147 Bacteria 4092
134 Ga0114129_10096615 3300009147 Bacteria 4090
135 Ga0114129_10114919 3300009147 Unclassified 3711
136 Ga0105242_10069475 3300009176 Bacteria 2917
137 Ga0105248_10067696 3300009177 Bacteria 4009
138 Ga0105237_10009584 3300009545 Bacteria 10368
139 Ga0105249_10037159 3300009553 Bacteria 4420
140 Ga0105249_10078633 3300009553 Bacteria 3061
141 Ga0105249_10874612 3300009553 Bacteria 965
142 Ga0105239_10431315 3300010375 Bacteria 1494
143 Ga0105239_10461618 3300010375 Bacteria 1441
144 Ga0157373_10252022 3300013100 Bacteria 1249
145 Ga0157371_10055968 3300013102 Bacteria 2798
146 Ga0157369_10048733 3300013105 Bacteria 4596
147 Ga0157374_10203324 3300013296 Bacteria 1940
148 Ga0157378_10089520 3300013297 Bacteria 2795
149 Ga0157378_10298035 3300013297 Bacteria 1559
150 Ga0157378_10386137 3300013297 Bacteria 1376
151 Ga0163162_10023451 3300013306 Bacteria 6090
152 Ga0157372_10291467 3300013307 Bacteria 1898
153 Ga0157372_10579547 3300013307 Bacteria 1308
154 Ga0157375_10053578 3300013308 Unclassified 3970
155 Ga0157375_10062471 3300013308 Unclassified 3701
156 Ga0157375_10069960 3300013308 Bacteria 3517
157 Ga0163163_10014343 3300014325 Bacteria 7284
158 Ga0157380_10009037 3300014326 Bacteria 7120
159 Ga0157380_10010989 3300014326 Bacteria 6528
160 Ga0157380_10041198 3300014326 Bacteria 3602
161 Ga0157377_10032035 3300014745 Bacteria 2860
162 Ga0157377_10034792 3300014745 Bacteria 2758
163 Ga0157379_10151890 3300014968 Bacteria 2089
164 Ga0157379_10226130 3300014968 Bacteria 1696
165 Ga0157376_10023590 3300014969 Bacteria 4817
166 Ga0157376_10361571 3300014969 Bacteria 1392
167 Ga0157376_10408581 3300014969 Bacteria 1314
168 Ga0207682_10143852 3300025893 Bacteria 1071
169 Ga0207680_10014160 3300025903 Bacteria 4118
170 Ga0207643_10006367 3300025908 Bacteria 6324
171 Ga0207671_10011589 3300025914 Bacteria 7160
172 Ga0207649_10322709 3300025920 Bacteria 1135
173 Ga0207646_10027484 3300025922 Bacteria 5189
174 Ga0207681_10015705 3300025923 Bacteria 4726
175 Ga0207650_10033507 3300025925 Bacteria 3721
176 Ga0207659_10000251 3300025926 Bacteria 32708
177 Ga0207659_10033413 3300025926 Unclassified 3541
178 Ga0207659_10175831 3300025926 Bacteria 1692
179 Ga0207644_10311473 3300025931 Unclassified 1271
180 Ga0207690_10042775 3300025932 Bacteria 2978
181 Ga0207706_10051995 3300025933 Bacteria 3617
182 Ga0207706_10173750 3300025933 Bacteria 1893
183 Ga0207686_10136694 3300025934 Bacteria 1688
184 Ga0207709_10032768 3300025935 Bacteria 3045
185 Ga0207670_10001631 3300025936 Bacteria 11703
186 Ga0207670_10302340 3300025936 Bacteria 1253
187 Ga0207669_10004571 3300025937 Bacteria 6103
188 Ga0207669_10016830 3300025937 Unclassified 3731
189 Ga0207669_10030555 3300025937 Bacteria 2995
190 Ga0207669_10246059 3300025937 Bacteria 1328
191 Ga0207704_10021037 3300025938 Bacteria 3466
192 Ga0207704_10029603 3300025938 Bacteria 3057
193 Ga0207704_10216176 3300025938 Bacteria 1415
194 Ga0207691_10023592 3300025940 Bacteria 5793
195 Ga0207691_10047184 3300025940 Unclassified 3954
196 Ga0207689_10174389 3300025942 Bacteria 1773
197 Ga0207689_10319213 3300025942 Bacteria 1289
198 Ga0207679_10051206 3300025945 Bacteria 3022
199 Ga0207679_10337858 3300025945 Unclassified 1309
200 Ga0207667_10137785 3300025949 Bacteria 2513
201 Ga0207703_10096262 3300026035 Bacteria 2499
202 Ga0207703_10150046 3300026035 Bacteria 2032
203 Ga0207641_10016079 3300026088 Bacteria 6129
204 Ga0207641_10131989 3300026088 Bacteria 2244
205 Ga0207648_10004146 3300026089 Bacteria 15002
206 Ga0207648_10192469 3300026089 Bacteria 1808
207 Ga0207676_10079054 3300026095 Bacteria 2666
208 Ga0207674_10101558 3300026116 Bacteria 2857
209 Ga0207674_10200686 3300026116 Bacteria 1944
210 Ga0207675_100024495 3300026118 Bacteria 5611
211 Ga0207675_100141247 3300026118 Bacteria 2288
212 Ga0207698_10347230 3300026142 Bacteria 1400
213 Ga0207428_10005179 3300027907 Bacteria 12208
214 Ga0207428_10054925 3300027907 Bacteria 3169
215 Ga0268265_10001173 3300028380 Bacteria 22937
216 Ga0268265_10070363 3300028380 Bacteria 2720
217 Ga0268265_10320302 3300028380 Bacteria 1404
218 Ga0268264_10007109 3300028381 Bacteria 9382
219 Ga0373930_0021362 3300034816 Unclassified 1270
220 Ga0373950_0006372 3300034818 Bacteria 1796
221 Ga0373958_0000989 3300034819 Bacteria 3707
222 Ga0373928_0001730 3300035084 Bacteria 4240
223 Ga0373929_0000850 3300035085 Bacteria 5946
224 Ga0373934_0030412 3300035086 Unclassified 2111
225 Ga0373934_0094262 3300035086 Bacteria 1208
226 Ga0373940_0003154 3300035088 Bacteria 3327
227 Ga0373949_0001821 3300035090 Bacteria 5826
228 Ga0373951_0002041 3300035091 Bacteria 5170
229 Ga0373952_0002576 3300035092 Bacteria 3264
230 Ga0373932_0003567 3300035112 Bacteria 3730
231 Ga0373939_0004685 3300035114 Bacteria 3242
232 Ga0373941_0002117 3300035115 Bacteria 4320
233 Ga0373960_0000157 3300035121 Bacteria 11707
234 Ga0373955_0108038 3300035172 Unclassified 1606
235 Ga0373955_0121467 3300035172 Bacteria 1519
236 Ga0373942_0001187 3300035207 Bacteria 6879
237 Ga0373961_0000783 3300035241 Bacteria 10916
238 Ga0373962_0004555 3300035242 Bacteria 3353
239 Ga0373931_0004129 3300035691 Bacteria 6588
240 Ga0373933_0063646 3300035724 Bacteria 2230
241 Ga0373933_0229339 3300035724 Bacteria 1193
242 Ga0373937_0132629 3300036401 Bacteria 2327
243 Ga0373925_0192389 3300037068 Bacteria 1619
244 Ga0395900_0400119 3300037418 Bacteria 1338
245 Ga0395905_0364155 3300037471 Bacteria 1338
246 Ga0439453_0010386 3300041408 Bacteria 1534
247 Ga0495592_0130160 3300046454 Bacteria 1761
248 Ga0495651_0033951 3300046462 Unclassified 3978
249 Ga0495651_0144757 3300046462 Bacteria 1719
250 Ga0495651_0232560 3300046462 Bacteria 1268
251 Ga0495653_0411598 3300046463 Bacteria 857
252 Ga0495580_0005932 3300046472 Bacteria 10018
253 Ga0495582_0074493 3300046473 Bacteria 1880
254 Ga0495664_0019117 3300046477 Bacteria 3935
255 Ga0495584_0024359 3300046491 Bacteria 3069
256 Ga0495606_0005649 3300046507 Bacteria 11853
257 Ga0495628_0022634 3300046516 Bacteria 5161
258 Ga0495628_0150695 3300046516 Bacteria 1772
259 Ga0495630_0323274 3300046517 Bacteria 1179
260 Ga0495652_0123088 3300046529 Bacteria 2065
261 Ga0495652_0140658 3300046529 Bacteria 1898
262 Ga0495665_0046058 3300046531 Bacteria 2317
263 Ga0495665_0051359 3300046531 Bacteria 2184
264 Ga0495640_0054907 3300046533 Bacteria 2727
265 Ga0495640_0162443 3300046533 Bacteria 1430
266 Ga0495586_0370145 3300046535 Bacteria 824
267 Ga0495587_0151998 3300046536 Bacteria 1319
268 Ga0495645_0010807 3300046543 Bacteria 6412
269 Ga0495645_0064829 3300046543 Bacteria 2643
270 Ga0495667_0009381 3300046559 Bacteria 6626
271 Ga0495667_0066016 3300046559 Bacteria 2366
272 Ga0495667_0258634 3300046559 Bacteria 1107
273 Ga0495634_0055152 3300046642 Bacteria 2658
274 Ga0495635_0068241 3300046663 Bacteria 2439
275 Ga0495635_0310589 3300046663 Bacteria 1056
276 Ga0495661_0010868 3300046665 Bacteria 6190
277 Ga0495613_0194045 3300046689 Bacteria 1434
278 Ga0495613_0330384 3300046689 Bacteria 1051
279 Ga0495604_0115849 3300047317 Bacteria 1946
280 Ga0495674_0002845 3300047319 Bacteria 16803
281 Ga0495680_0126157 3300047322 Bacteria 1885
282 Ga0495687_000016 3300047443 Bacteria 359237
283 Ga0495675_0054042 3300047444 Bacteria 2549
284 Ga0495675_0118670 3300047444 Unclassified 1648
285 Ga0495684_0001491 3300047471 Bacteria 18727
286 Ga0495684_0023926 3300047471 Bacteria 4698
287 Ga0495684_0028800 3300047471 Bacteria 4263
288 Ga0495602_0026545 3300048088 Bacteria 5583
289 Ga0495602_0054226 3300048088 Bacteria 3542
290 Ga0495602_0111686 3300048088 Bacteria 2219
291 Ga0496107_0320739 3300048910 Bacteria 1153
292 Ga0496112_0366503 3300048915 Bacteria 1382
293 Ga0496114_0001915 3300048917 Bacteria 15845
294 Ga0501033_0082164 3300049570 Bacteria 2363
295 Ga0501036_0352395 3300049572 Bacteria 1229
296 Ga0501041_0112288 3300049577 Bacteria 1691
297 Ga0501046_0030580 3300049580 Bacteria 4369
298 Ga0501072_0068038 3300049588 Bacteria 2811
299 Ga0501077_0032324 3300049593 Bacteria 3331
300 Ga0501081_0029731 3300049743 Bacteria 3694
301 Ga0501045_0046627 3300049824 Bacteria 3156
302 nmdc:mga05p37_113711_c1 3300050507 Bacteria 3328
303 nmdc:mga05p37_114963_c1 3300050507 Bacteria 3308
304 nmdc:mga05p37_13277_c2 3300050507 Bacteria 6381
305 nmdc:mga05p37_185793_c1 3300050507 Bacteria 2527
306 nmdc:mga05p37_204765_c1 3300050507 Bacteria 2387
307 nmdc:mga05p37_299897_c1 3300050507 Bacteria 1910
308 nmdc:mga05p37_510853_c1 3300050507 Unclassified 1377
309 nmdc:mga09592_96738_c1 3300050508 Bacteria 2526
310 nmdc:mga08y16_284625_c1 3300050511 Bacteria 1705
311 nmdc:mga0n895_118013_c1 3300050512 Bacteria 2673
312 nmdc:mga0n895_240038_c1 3300050512 Bacteria 1839
313 nmdc:mga0n895_29727_c1 3300050512 Bacteria 5215
314 nmdc:mga0n895_59891_c1 3300050512 Bacteria 3757
315 nmdc:mga0n895_64422_c1 3300050512 Bacteria 3625
316 nmdc:mga0n895_686008_c1 3300050512 Bacteria 1021
317 nmdc:mga0n895_73729_c1 3300050512 Bacteria 3389
318 nmdc:mga0n895_86727_c1 3300050512 Bacteria 3127
319 nmdc:mga0n895_93_c1 3300050512 Bacteria 52210
320 nmdc:mga0rr50_10_c1 3300050513 Bacteria 218067
321 nmdc:mga0rr50_140382_c1 3300050513 Bacteria 1943
322 nmdc:mga0rr50_15425_c1 3300050513 Bacteria 5044
323 nmdc:mga0rr50_193550_c1 3300050513 Unclassified 1668
324 nmdc:mga0rr50_353669_c1 3300050513 Bacteria 1236
325 nmdc:mga0rr50_557_c1 3300050513 Bacteria 20014
326 nmdc:mga0rr50_91670_c1 3300050513 Bacteria 2368
327 nmdc:mga08x19_209_c1 3300050514 Bacteria 44732
328 nmdc:mga08x19_26336_c1 3300050514 Bacteria 3628
329 nmdc:mga08x19_49753_c1 3300050514 Bacteria 2689
330 nmdc:mga08x19_76469_c1 3300050514 Bacteria 2191
331 nmdc:mga08x19_93833_c1 3300050514 Bacteria 1984
332 nmdc:mga0a205_118416_c1 3300050515 Bacteria 2547
333 nmdc:mga0a205_15081_c1 3300050515 Bacteria 7216
334 nmdc:mga0a205_157314_c1 3300050515 Unclassified 2171
335 nmdc:mga0a205_259528_c1 3300050515 Bacteria 1615
336 nmdc:mga0a205_294970_c1 3300050515 Unclassified 1495
337 nmdc:mga0a205_379543_c1 3300050515 Unclassified 1279
338 nmdc:mga0a205_400548_c1 3300050515 Bacteria 1236
339 nmdc:mga0a205_43539_c1 3300050515 Unclassified 4328
340 nmdc:mga0a205_88323_c1 3300050515 Bacteria 2996
341 Ga0495601_0116331 3300053077 Bacteria 1734
342 Ga0495619_0196988 3300053085 Bacteria 1395
343 Ga0500568_0008775 3300053139 Unclassified 4846
344 Ga0501084_0007008 3300054114 Bacteria 9291

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100015600 Ga0075431_1000156002 230
2 3300046535 Ga0495586_0370145 Ga0495586_0370145_92_796 234
3 3300005445 Ga0070708_100069023 Ga0070708_1000690233 243
4 3300005549 Ga0070704_100386413 Ga0070704_1003864131 243
5 3300006914 Ga0075436_100165658 Ga0075436_1001656582 243
6 3300007076 Ga0075435_100217812 Ga0075435_1002178122 243
7 3300009094 Ga0111539_10324024 Ga0111539_103240241 245
8 3300009094 Ga0111539_10443878 Ga0111539_104438782 251
9 3300035086 Ga0373934_0094262 Ga0373934_0094262_265_1023 251
10 3300046454 Ga0495592_0130160 Ga0495592_0130160_145_903 251
11 3300046462 Ga0495651_0144757 Ga0495651_0144757_276_1034 251
12 3300046463 Ga0495653_0411598 Ga0495653_0411598_68_826 251
13 3300046477 Ga0495664_0019117 Ga0495664_0019117_2685_3443 251
14 3300046516 Ga0495628_0022634 Ga0495628_0022634_2171_2929 251
15 3300046517 Ga0495630_0323274 Ga0495630_0323274_51_809 251
16 3300046529 Ga0495652_0140658 Ga0495652_0140658_744_1502 251
17 3300046533 Ga0495640_0162443 Ga0495640_0162443_46_804 251
18 3300046536 Ga0495587_0151998 Ga0495587_0151998_369_1127 251
19 3300046543 Ga0495645_0010807 Ga0495645_0010807_403_1161 251
20 3300046559 Ga0495667_0066016 Ga0495667_0066016_1078_1836 251
21 3300046642 Ga0495634_0055152 Ga0495634_0055152_1232_1990 251
22 3300046663 Ga0495635_0068241 Ga0495635_0068241_1077_1835 251
23 3300046689 Ga0495613_0330384 Ga0495613_0330384_149_907 251
24 3300047322 Ga0495680_0126157 Ga0495680_0126157_870_1628 251
25 3300053085 Ga0495619_0196988 Ga0495619_0196988_586_1344 251
26 3300005618 Ga0068864_100123651 Ga0068864_1001236512 254
27 3300026095 Ga0207676_10079054 Ga0207676_100790543 254
28 3300050515 nmdc:mga0a205_400548_c1 nmdc:mga0a205_400548_c1_40_915 254
29 3300006871 Ga0075434_100006325 Ga0075434_1000063255 256
30 3300006914 Ga0075436_100001119 Ga0075436_1000011194 256
31 3300007076 Ga0075435_100002022 Ga0075435_10000202212 256
32 3300050512 nmdc:mga0n895_93_c1 nmdc:mga0n895_93_c1_3759_4640 256
33 3300050513 nmdc:mga0rr50_10_c1 nmdc:mga0rr50_10_c1_117629_118510 256
34 3300050514 nmdc:mga08x19_209_c1 nmdc:mga08x19_209_c1_7915_8796 256
35 3300005444 Ga0070694_100170813 Ga0070694_1001708131 257
36 3300005842 Ga0068858_100018281 Ga0068858_1000182815 257
37 3300005937 Ga0081455_10129941 Ga0081455_101299412 257
38 3300035172 Ga0373955_0121467 Ga0373955_0121467_135_1046 257
39 3300035724 Ga0373933_0063646 Ga0373933_0063646_1210_2121 257
40 3300036401 Ga0373937_0132629 Ga0373937_0132629_99_1010 257
41 3300050507 nmdc:mga05p37_185793_c1 nmdc:mga05p37_185793_c1_737_1612 257
42 3300050514 nmdc:mga08x19_93833_c1 nmdc:mga08x19_93833_c1_532_1434 257
43 3300005456 Ga0070678_100184722 Ga0070678_1001847222 258
44 3300005616 Ga0068852_100217348 Ga0068852_1002173482 258
45 3300026142 Ga0207698_10347230 Ga0207698_103472302 258
46 3300048910 Ga0496107_0320739 Ga0496107_0320739_19_831 258
47 3300049580 Ga0501046_0030580 Ga0501046_0030580_1612_2403 258
48 3300049593 Ga0501077_0032324 Ga0501077_0032324_1858_2649 258
49 3300049743 Ga0501081_0029731 Ga0501081_0029731_2455_3246 258
50 3300049824 Ga0501045_0046627 Ga0501045_0046627_1742_2533 258
51 3300053139 Ga0500568_0008775 Ga0500568_0008775_2533_3345 258
52 3300054114 Ga0501084_0007008 Ga0501084_0007008_1201_1992 258
53 3300025942 Ga0207689_10174389 Ga0207689_101743892 259
54 3300035172 Ga0373955_0108038 Ga0373955_0108038_98_1000 259
55 3300005339 Ga0070660_100252739 Ga0070660_1002527391 260
56 3300005356 Ga0070674_100149241 Ga0070674_1001492411 260
57 3300005366 Ga0070659_100066745 Ga0070659_1000667454 260
58 3300005536 Ga0070697_100297190 Ga0070697_1002971903 260
59 3300005549 Ga0070704_100235626 Ga0070704_1002356261 260
60 3300007076 Ga0075435_100241312 Ga0075435_1002413122 260
61 3300013100 Ga0157373_10252022 Ga0157373_102520221 260
62 3300013102 Ga0157371_10055968 Ga0157371_100559682 260
63 3300013105 Ga0157369_10048733 Ga0157369_100487334 260
64 3300013296 Ga0157374_10203324 Ga0157374_102033242 260
65 3300013297 Ga0157378_10298035 Ga0157378_102980351 260
66 3300013307 Ga0157372_10579547 Ga0157372_105795472 260
67 3300025933 Ga0207706_10173750 Ga0207706_101737502 260
68 3300048915 Ga0496112_0366503 Ga0496112_0366503_362_1159 260
69 3300050514 nmdc:mga08x19_49753_c1 nmdc:mga08x19_49753_c1_1062_1949 260
70 3300006844 Ga0075428_100107671 Ga0075428_1001076711 261
71 3300005618 Ga0068864_100230819 Ga0068864_1002308192 262
72 3300006852 Ga0075433_10013480 Ga0075433_100134805 263
73 3300006871 Ga0075434_100097845 Ga0075434_1000978452 263
74 3300006871 Ga0075434_100230887 Ga0075434_1002308873 263
75 3300007076 Ga0075435_100001156 Ga0075435_10000115611 263
76 3300009147 Ga0114129_10004550 Ga0114129_1000455013 263
77 3300013297 Ga0157378_10089520 Ga0157378_100895203 263
78 3300050507 nmdc:mga05p37_299897_c1 nmdc:mga05p37_299897_c1_924_1790 263
79 3300050512 nmdc:mga0n895_64422_c1 nmdc:mga0n895_64422_c1_1951_2817 263
80 3300050512 nmdc:mga0n895_86727_c1 nmdc:mga0n895_86727_c1_1176_2069 263
81 3300050513 nmdc:mga0rr50_557_c1 nmdc:mga0rr50_557_c1_8957_9850 263
82 3300050515 nmdc:mga0a205_88323_c1 nmdc:mga0a205_88323_c1_1258_2124 263
83 3300025937 Ga0207669_10016830 Ga0207669_100168302 264
84 3300005937 Ga0081455_10070303 Ga0081455_100703033 265
85 3300006852 Ga0075433_10198206 Ga0075433_101982062 265
86 3300006871 Ga0075434_100200265 Ga0075434_1002002652 265
87 3300050512 nmdc:mga0n895_118013_c1 nmdc:mga0n895_118013_c1_110_1051 265
88 3300005340 Ga0070689_100003316 Ga0070689_1000033162 266
89 3300005543 Ga0070672_100013170 Ga0070672_1000131705 266
90 3300005617 Ga0068859_100001043 Ga0068859_10000104315 266
91 3300005843 Ga0068860_100003528 Ga0068860_1000035286 266
92 3300006931 Ga0097620_100001043 Ga0097620_10000104315 266
93 3300013308 Ga0157375_10069960 Ga0157375_100699602 266
94 3300014745 Ga0157377_10034792 Ga0157377_100347922 266
95 3300014969 Ga0157376_10408581 Ga0157376_104085811 266
96 3300025926 Ga0207659_10000251 Ga0207659_100002512 266
97 3300025936 Ga0207670_10001631 Ga0207670_100016312 266
98 3300046665 Ga0495661_0010868 Ga0495661_0010868_2092_3033 266
99 3300050512 nmdc:mga0n895_240038_c1 nmdc:mga0n895_240038_c1_83_982 266
100 3300050513 nmdc:mga0rr50_353669_c1 nmdc:mga0rr50_353669_c1_186_1085 266
101 3300053077 Ga0495601_0116331 Ga0495601_0116331_619_1440 266
102 3300005841 Ga0068863_100183343 Ga0068863_1001833431 269
103 3300005842 Ga0068858_100454367 Ga0068858_1004543671 269
104 3300006173 Ga0070716_100189646 Ga0070716_1001896461 269
105 3300006871 Ga0075434_100002528 Ga0075434_1000025282 269
106 3300007076 Ga0075435_100015014 Ga0075435_1000150143 269
107 3300007076 Ga0075435_100015898 Ga0075435_1000158983 269
108 3300009147 Ga0114129_10096506 Ga0114129_100965062 269
109 3300009177 Ga0105248_10067696 Ga0105248_100676964 269
110 3300010375 Ga0105239_10431315 Ga0105239_104313152 269
111 3300013306 Ga0163162_10023451 Ga0163162_100234516 269
112 3300014325 Ga0163163_10014343 Ga0163163_100143438 269
113 3300014968 Ga0157379_10226130 Ga0157379_102261302 269
114 3300014969 Ga0157376_10361571 Ga0157376_103615712 269
115 3300026088 Ga0207641_10131989 Ga0207641_101319892 269
116 3300035724 Ga0373933_0229339 Ga0373933_0229339_183_992 269
117 3300037068 Ga0373925_0192389 Ga0373925_0192389_61_870 269
118 3300041408 Ga0439453_0010386 Ga0439453_0010386_442_1320 269
119 3300046491 Ga0495584_0024359 Ga0495584_0024359_501_1442 269
120 3300046507 Ga0495606_0005649 Ga0495606_0005649_4790_5731 269
121 3300046516 Ga0495628_0150695 Ga0495628_0150695_518_1327 269
122 3300046531 Ga0495665_0046058 Ga0495665_0046058_35_844 269
123 3300046531 Ga0495665_0051359 Ga0495665_0051359_191_1000 269
124 3300046533 Ga0495640_0054907 Ga0495640_0054907_1070_1879 269
125 3300046543 Ga0495645_0064829 Ga0495645_0064829_1330_2139 269
126 3300047317 Ga0495604_0115849 Ga0495604_0115849_115_924 269
127 3300047319 Ga0495674_0002845 Ga0495674_0002845_15_824 269
128 3300047443 Ga0495687_000016 Ga0495687_000016_165585_166526 269
129 3300047444 Ga0495675_0054042 Ga0495675_0054042_226_1035 269
130 3300050507 nmdc:mga05p37_113711_c1 nmdc:mga05p37_113711_c1_1152_2027 269
131 3300050512 nmdc:mga0n895_59891_c1 nmdc:mga0n895_59891_c1_1414_2289 269
132 3300050513 nmdc:mga0rr50_91670_c1 nmdc:mga0rr50_91670_c1_1240_2115 269
133 3300050514 nmdc:mga08x19_26336_c1 nmdc:mga08x19_26336_c1_292_1167 269
134 3300005333 Ga0070677_10099702 Ga0070677_100997022 270
135 3300005356 Ga0070674_100001325 Ga0070674_10000132512 270
136 3300005356 Ga0070674_100040757 Ga0070674_1000407572 270
137 3300005438 Ga0070701_10104715 Ga0070701_101047152 270
138 3300005456 Ga0070678_100416718 Ga0070678_1004167181 270
139 3300005457 Ga0070662_100387843 Ga0070662_1003878432 270
140 3300005617 Ga0068859_100486079 Ga0068859_1004860792 270
141 3300005718 Ga0068866_10022105 Ga0068866_100221053 270
142 3300005719 Ga0068861_100164078 Ga0068861_1001640782 270
143 3300005844 Ga0068862_100092697 Ga0068862_1000926973 270
144 3300006931 Ga0097620_100486019 Ga0097620_1004860192 270
145 3300009093 Ga0105240_10020493 Ga0105240_100204936 270
146 3300009094 Ga0111539_10037004 Ga0111539_100370044 270
147 3300009176 Ga0105242_10069475 Ga0105242_100694752 270
148 3300009545 Ga0105237_10009584 Ga0105237_100095844 270
149 3300009553 Ga0105249_10078633 Ga0105249_100786333 270
150 3300014326 Ga0157380_10010989 Ga0157380_100109895 270
151 3300025893 Ga0207682_10143852 Ga0207682_101438521 270
152 3300025923 Ga0207681_10015705 Ga0207681_100157053 270
153 3300025934 Ga0207686_10136694 Ga0207686_101366942 270
154 3300025937 Ga0207669_10004571 Ga0207669_100045713 270
155 3300025937 Ga0207669_10030555 Ga0207669_100305552 270
156 3300025938 Ga0207704_10216176 Ga0207704_102161761 270
157 3300027907 Ga0207428_10054925 Ga0207428_100549253 270
158 3300028380 Ga0268265_10070363 Ga0268265_100703633 270
159 3300050511 nmdc:mga08y16_284625_c1 nmdc:mga08y16_284625_c1_574_1449 270
160 3300005330 Ga0070690_100030894 Ga0070690_1000308942 271
161 3300005335 Ga0070666_10250558 Ga0070666_102505581 271
162 3300005366 Ga0070659_100367372 Ga0070659_1003673721 271
163 3300005518 Ga0070699_100007438 Ga0070699_1000074389 271
164 3300005536 Ga0070697_100033191 Ga0070697_1000331912 271
165 3300005544 Ga0070686_100001482 Ga0070686_1000014826 271
166 3300005545 Ga0070695_100008283 Ga0070695_1000082834 271
167 3300005549 Ga0070704_100002968 Ga0070704_1000029689 271
168 3300005614 Ga0068856_100095586 Ga0068856_1000955862 271
169 3300005719 Ga0068861_100093624 Ga0068861_1000936243 271
170 3300005842 Ga0068858_100119223 Ga0068858_1001192232 271
171 3300006237 Ga0097621_100107084 Ga0097621_1001070842 271
172 3300006852 Ga0075433_10101995 Ga0075433_101019952 271
173 3300006871 Ga0075434_100804763 Ga0075434_1008047631 271
174 3300007076 Ga0075435_100015245 Ga0075435_1000152454 271
175 3300007076 Ga0075435_100020990 Ga0075435_1000209906 271
176 3300007076 Ga0075435_100501177 Ga0075435_1005011771 271
177 3300009093 Ga0105240_10057913 Ga0105240_100579133 271
178 3300009093 Ga0105240_10252204 Ga0105240_102522042 271
179 3300009098 Ga0105245_10475732 Ga0105245_104757321 271
180 3300009147 Ga0114129_10002003 Ga0114129_1000200323 271
181 3300009147 Ga0114129_10034786 Ga0114129_100347868 271
182 3300009147 Ga0114129_10074603 Ga0114129_100746035 271
183 3300009147 Ga0114129_10096615 Ga0114129_100966153 271
184 3300009553 Ga0105249_10874612 Ga0105249_108746121 271
185 3300010375 Ga0105239_10461618 Ga0105239_104616182 271
186 3300013307 Ga0157372_10291467 Ga0157372_102914671 271
187 3300025903 Ga0207680_10014160 Ga0207680_100141602 271
188 3300025922 Ga0207646_10027484 Ga0207646_100274846 271
189 3300025932 Ga0207690_10042775 Ga0207690_100427752 271
190 3300025949 Ga0207667_10137785 Ga0207667_101377852 271
191 3300026035 Ga0207703_10096262 Ga0207703_100962622 271
192 3300026118 Ga0207675_100141247 Ga0207675_1001412473 271
193 3300034816 Ga0373930_0021362 Ga0373930_0021362_199_1074 271
194 3300034818 Ga0373950_0006372 Ga0373950_0006372_152_1027 271
195 3300034819 Ga0373958_0000989 Ga0373958_0000989_1365_2240 271
196 3300035084 Ga0373928_0001730 Ga0373928_0001730_174_1049 271
197 3300035085 Ga0373929_0000850 Ga0373929_0000850_4973_5848 271
198 3300035088 Ga0373940_0003154 Ga0373940_0003154_1305_2180 271
199 3300035090 Ga0373949_0001821 Ga0373949_0001821_1763_2638 271
200 3300035091 Ga0373951_0002041 Ga0373951_0002041_1656_2531 271
201 3300035092 Ga0373952_0002576 Ga0373952_0002576_1831_2706 271
202 3300035112 Ga0373932_0003567 Ga0373932_0003567_2365_3240 271
203 3300035114 Ga0373939_0004685 Ga0373939_0004685_1682_2557 271
204 3300035115 Ga0373941_0002117 Ga0373941_0002117_2324_3199 271
205 3300035121 Ga0373960_0000157 Ga0373960_0000157_2135_3010 271
206 3300035207 Ga0373942_0001187 Ga0373942_0001187_1284_2159 271
207 3300035241 Ga0373961_0000783 Ga0373961_0000783_8392_9267 271
208 3300035242 Ga0373962_0004555 Ga0373962_0004555_625_1500 271
209 3300035691 Ga0373931_0004129 Ga0373931_0004129_1188_2063 271
210 3300049570 Ga0501033_0082164 Ga0501033_0082164_674_1525 271
211 3300049577 Ga0501041_0112288 Ga0501041_0112288_786_1637 271
212 3300050507 nmdc:mga05p37_114963_c1 nmdc:mga05p37_114963_c1_1475_2350 271
213 3300050507 nmdc:mga05p37_13277_c2 nmdc:mga05p37_13277_c2_462_1349 271
214 3300050507 nmdc:mga05p37_204765_c1 nmdc:mga05p37_204765_c1_896_1768 271
215 3300050507 nmdc:mga05p37_510853_c1 nmdc:mga05p37_510853_c1_52_930 271
216 3300050512 nmdc:mga0n895_686008_c1 nmdc:mga0n895_686008_c1_71_946 271
217 3300050513 nmdc:mga0rr50_140382_c1 nmdc:mga0rr50_140382_c1_494_1369 271
218 3300050513 nmdc:mga0rr50_15425_c1 nmdc:mga0rr50_15425_c1_1560_2441 271
219 3300050514 nmdc:mga08x19_76469_c1 nmdc:mga08x19_76469_c1_571_1698 271
220 3300050515 nmdc:mga0a205_118416_c1 nmdc:mga0a205_118416_c1_1274_2149 271
221 3300050515 nmdc:mga0a205_379543_c1 nmdc:mga0a205_379543_c1_319_1197 271
222 3300050515 nmdc:mga0a205_43539_c1 nmdc:mga0a205_43539_c1_1496_2371 271
223 3300005334 Ga0068869_100187630 Ga0068869_1001876302 272
224 3300005340 Ga0070689_100003316 Ga0070689_1000033165 272
225 3300005341 Ga0070691_10142807 Ga0070691_101428071 272
226 3300005343 Ga0070687_100021024 Ga0070687_1000210242 272
227 3300005343 Ga0070687_100039380 Ga0070687_1000393803 272
228 3300005344 Ga0070661_100320836 Ga0070661_1003208361 272
229 3300005347 Ga0070668_100196561 Ga0070668_1001965612 272
230 3300005353 Ga0070669_100114339 Ga0070669_1001143391 272
231 3300005354 Ga0070675_100000097 Ga0070675_10000009712 272
232 3300005354 Ga0070675_100000097 Ga0070675_1000000979 272
233 3300005354 Ga0070675_100048484 Ga0070675_1000484844 272
234 3300005355 Ga0070671_100004132 Ga0070671_1000041322 272
235 3300005355 Ga0070671_100116621 Ga0070671_1001166212 272
236 3300005365 Ga0070688_100014462 Ga0070688_1000144622 272
237 3300005440 Ga0070705_100351395 Ga0070705_1003513951 272
238 3300005444 Ga0070694_100022102 Ga0070694_1000221023 272
239 3300005457 Ga0070662_100075977 Ga0070662_1000759772 272
240 3300005459 Ga0068867_100034357 Ga0068867_1000343574 272
241 3300005471 Ga0070698_100156906 Ga0070698_1001569062 272
242 3300005535 Ga0070684_100349901 Ga0070684_1003499012 272
243 3300005543 Ga0070672_100010590 Ga0070672_1000105904 272
244 3300005543 Ga0070672_100013170 Ga0070672_1000131702 272
245 3300005543 Ga0070672_100273049 Ga0070672_1002730492 272
246 3300005546 Ga0070696_100106614 Ga0070696_1001066142 272
247 3300005549 Ga0070704_100019886 Ga0070704_1000198862 272
248 3300005564 Ga0070664_100006000 Ga0070664_1000060002 272
249 3300005564 Ga0070664_100209832 Ga0070664_1002098322 272
250 3300005577 Ga0068857_100172467 Ga0068857_1001724672 272
251 3300005617 Ga0068859_100001043 Ga0068859_10000104318 272
252 3300005617 Ga0068859_100022803 Ga0068859_1000228035 272
253 3300005841 Ga0068863_100017768 Ga0068863_1000177684 272
254 3300005842 Ga0068858_100018281 Ga0068858_1000182812 272
255 3300005843 Ga0068860_100003528 Ga0068860_1000035289 272
256 3300005844 Ga0068862_100000476 Ga0068862_10000047630 272
257 3300006237 Ga0097621_100068599 Ga0097621_1000685992 272
258 3300006237 Ga0097621_100358856 Ga0097621_1003588562 272
259 3300006358 Ga0068871_100090563 Ga0068871_1000905632 272
260 3300006844 Ga0075428_100048657 Ga0075428_1000486574 272
261 3300006852 Ga0075433_10028047 Ga0075433_100280473 272
262 3300006852 Ga0075433_10392816 Ga0075433_103928162 272
263 3300006871 Ga0075434_100061210 Ga0075434_1000612102 272
264 3300006880 Ga0075429_100068949 Ga0075429_1000689493 272
265 3300006881 Ga0068865_100038321 Ga0068865_1000383212 272
266 3300006881 Ga0068865_100363755 Ga0068865_1003637551 272
267 3300006931 Ga0097620_100001043 Ga0097620_10000104318 272
268 3300006931 Ga0097620_100022801 Ga0097620_1000228015 272
269 3300007076 Ga0075435_100008104 Ga0075435_1000081044 272
270 3300009147 Ga0114129_10114919 Ga0114129_101149192 272
271 3300009553 Ga0105249_10037159 Ga0105249_100371591 272
272 3300013297 Ga0157378_10386137 Ga0157378_103861372 272
273 3300013308 Ga0157375_10053578 Ga0157375_100535781 272
274 3300013308 Ga0157375_10062471 Ga0157375_100624712 272
275 3300014326 Ga0157380_10041198 Ga0157380_100411982 272
276 3300014745 Ga0157377_10032035 Ga0157377_100320352 272
277 3300014968 Ga0157379_10151890 Ga0157379_101518902 272
278 3300025908 Ga0207643_10006367 Ga0207643_100063676 272
279 3300025920 Ga0207649_10322709 Ga0207649_103227092 272
280 3300025925 Ga0207650_10033507 Ga0207650_100335073 272
281 3300025926 Ga0207659_10000251 Ga0207659_100002515 272
282 3300025926 Ga0207659_10033413 Ga0207659_100334134 272
283 3300025926 Ga0207659_10175831 Ga0207659_101758312 272
284 3300025931 Ga0207644_10311473 Ga0207644_103114732 272
285 3300025933 Ga0207706_10051995 Ga0207706_100519953 272
286 3300025935 Ga0207709_10032768 Ga0207709_100327682 272
287 3300025936 Ga0207670_10001631 Ga0207670_100016315 272
288 3300025936 Ga0207670_10302340 Ga0207670_103023402 272
289 3300025937 Ga0207669_10246059 Ga0207669_102460591 272
290 3300025938 Ga0207704_10021037 Ga0207704_100210372 272
291 3300025938 Ga0207704_10029603 Ga0207704_100296033 272
292 3300025940 Ga0207691_10023592 Ga0207691_100235924 272
293 3300025940 Ga0207691_10047184 Ga0207691_100471842 272
294 3300025942 Ga0207689_10319213 Ga0207689_103192132 272
295 3300025945 Ga0207679_10051206 Ga0207679_100512063 272
296 3300025945 Ga0207679_10337858 Ga0207679_103378582 272
297 3300026035 Ga0207703_10150046 Ga0207703_101500462 272
298 3300026088 Ga0207641_10016079 Ga0207641_100160793 272
299 3300026089 Ga0207648_10004146 Ga0207648_100041466 272
300 3300026116 Ga0207674_10101558 Ga0207674_101015584 272
301 3300026116 Ga0207674_10200686 Ga0207674_102006862 272
302 3300026118 Ga0207675_100024495 Ga0207675_1000244954 272
303 3300027907 Ga0207428_10005179 Ga0207428_100051794 272
304 3300028380 Ga0268265_10001173 Ga0268265_100011736 272
305 3300028381 Ga0268264_10007109 Ga0268264_100071094 272
306 3300035086 Ga0373934_0030412 Ga0373934_0030412_231_1082 272
307 3300046462 Ga0495651_0033951 Ga0495651_0033951_1323_2174 272
308 3300046462 Ga0495651_0232560 Ga0495651_0232560_137_988 272
309 3300046529 Ga0495652_0123088 Ga0495652_0123088_1092_1943 272
310 3300046559 Ga0495667_0009381 Ga0495667_0009381_2755_3606 272
311 3300046559 Ga0495667_0258634 Ga0495667_0258634_131_982 272
312 3300046663 Ga0495635_0310589 Ga0495635_0310589_78_929 272
313 3300046689 Ga0495613_0194045 Ga0495613_0194045_294_1145 272
314 3300047444 Ga0495675_0118670 Ga0495675_0118670_445_1296 272
315 3300047471 Ga0495684_0001491 Ga0495684_0001491_15705_16556 272
316 3300047471 Ga0495684_0028800 Ga0495684_0028800_507_1358 272
317 3300048088 Ga0495602_0054226 Ga0495602_0054226_1375_2226 272
318 3300048088 Ga0495602_0111686 Ga0495602_0111686_1210_2061 272
319 3300050508 nmdc:mga09592_96738_c1 nmdc:mga09592_96738_c1_594_1517 272
320 3300050512 nmdc:mga0n895_73729_c1 nmdc:mga0n895_73729_c1_206_1129 272
321 3300050513 nmdc:mga0rr50_193550_c1 nmdc:mga0rr50_193550_c1_44_970 272
322 3300050515 nmdc:mga0a205_15081_c1 nmdc:mga0a205_15081_c1_4164_5087 272
323 3300050515 nmdc:mga0a205_157314_c1 nmdc:mga0a205_157314_c1_425_1351 272
324 3300050515 nmdc:mga0a205_294970_c1 nmdc:mga0a205_294970_c1_513_1436 272
325 3300005471 Ga0070698_100036025 Ga0070698_1000360252 273
326 3300006871 Ga0075434_100090554 Ga0075434_1000905544 273
327 3300050512 nmdc:mga0n895_29727_c1 nmdc:mga0n895_29727_c1_1494_2378 273
328 3300005518 Ga0070699_100023613 Ga0070699_1000236132 275
329 3300005536 Ga0070697_100293465 Ga0070697_1002934651 275
330 3300005546 Ga0070696_100001683 Ga0070696_1000016836 275
331 3300005354 Ga0070675_100192798 Ga0070675_1001927981 276
332 3300005435 Ga0070714_100074252 Ga0070714_1000742523 276
333 3300005549 Ga0070704_100002439 Ga0070704_1000024397 276
334 3300006844 Ga0075428_100680424 Ga0075428_1006804242 276
335 3300006880 Ga0075429_100591115 Ga0075429_1005911151 276
336 3300014326 Ga0157380_10009037 Ga0157380_100090376 276
337 3300025914 Ga0207671_10011589 Ga0207671_100115892 276
338 3300026089 Ga0207648_10192469 Ga0207648_101924692 276
339 3300028380 Ga0268265_10320302 Ga0268265_103203022 276
340 3300037418 Ga0395900_0400119 Ga0395900_0400119_431_1318 276
341 3300037471 Ga0395905_0364155 Ga0395905_0364155_24_911 276
342 3300049572 Ga0501036_0352395 Ga0501036_0352395_207_1112 276
343 3300049588 Ga0501072_0068038 Ga0501072_0068038_815_1720 276
344 3300050515 nmdc:mga0a205_259528_c1 nmdc:mga0a205_259528_c1_543_1442 276
345 3300005329 Ga0070683_100081068 Ga0070683_1000810683 277
346 3300006028 Ga0070717_10045774 Ga0070717_100457741 277
347 3300006237 Ga0097621_100359486 Ga0097621_1003594862 277
348 3300014969 Ga0157376_10023590 Ga0157376_100235902 277
349 3300046472 Ga0495580_0005932 Ga0495580_0005932_6015_6848 277
350 3300046473 Ga0495582_0074493 Ga0495582_0074493_430_1263 277
351 3300047471 Ga0495684_0023926 Ga0495684_0023926_2703_3536 277
352 3300048088 Ga0495602_0026545 Ga0495602_0026545_2195_3028 277
353 3300048917 Ga0496114_0001915 Ga0496114_0001915_6156_7064 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

64

312

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8686 30 268
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.8567 30 268
3kws-assembly1.cif.gz_B crystal structure of putative sugar isomerase (yp_001305149.1) from parabacteroides distasonis atcc 8503 at 1.68 a resolution 0.8412 30 274
4pgl-assembly2.cif.gz_D crystal structure of engineered d-tagatose 3-epimerase pcdte-ils6 0.8314 30 258
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.8167 28 277
ID Description Score Start End Superfamily
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8699 30 268 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8617 30 268 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8557 32 268 3.20.20.150
af_Q11185_2_259_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8471 28 272 3.20.20.150
af_P36951_1_261_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8417 30 274 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A1G0J6R8-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9814 28 277 GO:0016853
AF-A0A2V9FSA9-F1-model_v4 Hydroxypyruvate isomerase 0.9811 28 277 GO:0016853
AF-A0A3M1YUC3-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9791 51 218 GO:0016853
AF-A0A258WQI7-F1-model_v4 Hydroxypyruvate isomerase 0.977 29 277 GO:0016853
AF-A0A2V8N8X7-F1-model_v4 Hydroxypyruvate isomerase 0.9735 42 277 GO:0016853

Feature Viewer

pLDDT pTM Quality
89.44 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map