F419108

General Info

Members Datasets Scaffolds Average Seq Length
352 233 704 119

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_1070605|Ga0436361_1070605_191_556
Length 121
Sequence MAVTIGLWFAGVVGVAIVLIGVRFFAQPAAASAAFGVPAAADDAYLTTKGVRDIASGLFIGLLVWRGQPGLVGWFMLVATLIPIVDGLIVLRHHGPRLAAFGVHWATALFMLASAGLLLLG

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
163 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
164 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
165 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
166 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
228 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
229 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
230 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
231 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
232 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
233 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 0
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.2
Nodule 0.28
Rhizoplane 10.8
Rhizosphere 70.74
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_1070605 3300039447 Bacteria 666
2 JGI24750J21931_1058302 3300002070 Bacteria 614
3 JGI24738J21930_10055007 3300002075 Bacteria 813
4 JGI24749J21850_1009243 3300002076 Bacteria 1378
5 JGI24744J21845_10002344 3300002077 Bacteria 3864
6 JGI24034J26672_10001151 3300002239 Bacteria 3459
7 JGI24751J29686_10003294 3300002459 Bacteria 3252
8 rootH2_10257890 3300003320 Bacteria 1530
9 Ga0055540_1008066 3300003792 Bacteria 3847
10 Ga0065704_10178884 3300005289 Bacteria 1248
11 Ga0070683_100460925 3300005329 Bacteria 1213
12 Ga0070690_100023150 3300005330 Bacteria 3808
13 Ga0070670_100048768 3300005331 Bacteria 3644
14 Ga0070677_10058208 3300005333 Bacteria 1586
15 Ga0068869_100026780 3300005334 Bacteria 4015
16 Ga0070666_10116817 3300005335 Bacteria 1848
17 Ga0070680_100044103 3300005336 Bacteria 3623
18 Ga0068868_100041911 3300005338 Bacteria 3569
19 Ga0068868_100128608 3300005338 Bacteria 2071
20 Ga0070660_100212760 3300005339 Bacteria 1570
21 Ga0070689_100059295 3300005340 Bacteria 2974
22 Ga0070691_10039754 3300005341 Bacteria 2222
23 Ga0070661_101439120 3300005344 Bacteria 580
24 Ga0070692_10066317 3300005345 Bacteria 1913
25 Ga0070668_100001409 3300005347 Bacteria 17298
26 Ga0070668_100128684 3300005347 Bacteria 2030
27 Ga0070671_100005370 3300005355 Bacteria 10216
28 Ga0070671_100416796 3300005355 Bacteria 1150
29 Ga0070671_100862961 3300005355 Bacteria 790
30 Ga0070674_100015558 3300005356 Bacteria 4752
31 Ga0070674_100823941 3300005356 Bacteria 803
32 Ga0070673_100241133 3300005364 Bacteria 1572
33 Ga0070688_100017705 3300005365 Bacteria 4093
34 Ga0070667_100014088 3300005367 Bacteria 6607
35 Ga0070667_100104535 3300005367 Bacteria 2449
36 Ga0070667_100350089 3300005367 Bacteria 1337
37 Ga0070709_10564966 3300005434 Bacteria 872
38 Ga0070709_10566790 3300005434 Bacteria 871
39 Ga0070714_100684400 3300005435 Bacteria 989
40 Ga0070714_100859662 3300005435 Bacteria 880
41 Ga0070710_10045614 3300005437 Bacteria 2437
42 Ga0070701_11205733 3300005438 Bacteria 537
43 Ga0070711_100011440 3300005439 Bacteria 5511
44 Ga0070711_101215190 3300005439 Unclassified 652
45 Ga0070705_100090629 3300005440 Bacteria 1904
46 Ga0070700_100159132 3300005441 Bacteria 1553
47 Ga0070694_100018782 3300005444 Bacteria 4392
48 Ga0070663_100012544 3300005455 Bacteria 5366
49 Ga0070663_100382406 3300005455 Bacteria 1147
50 Ga0070662_101236106 3300005457 Bacteria 642
51 Ga0068867_100114416 3300005459 Bacteria 2077
52 Ga0070685_10051717 3300005466 Bacteria 2376
53 Ga0070685_11451571 3300005466 Bacteria 528
54 Ga0070697_100433301 3300005536 Bacteria 1143
55 Ga0068853_100422801 3300005539 Bacteria 1250
56 Ga0068853_101655207 3300005539 Bacteria 620
57 Ga0070672_100094515 3300005543 Bacteria 2417
58 Ga0070686_100030519 3300005544 Bacteria 3289
59 Ga0070686_100125866 3300005544 Bacteria 1766
60 Ga0070696_100031205 3300005546 Bacteria 3651
61 Ga0070693_100077702 3300005547 Bacteria 1971
62 Ga0070693_100253131 3300005547 Bacteria 1168
63 Ga0070665_100040526 3300005548 Bacteria 4681
64 Ga0070665_100226228 3300005548 Bacteria 1871
65 Ga0070665_100234417 3300005548 Bacteria 1836
66 Ga0070704_100015775 3300005549 Bacteria 4756
67 Ga0068855_100110339 3300005563 Bacteria 3158
68 Ga0068854_100047247 3300005578 Bacteria 3067
69 Ga0068854_100244184 3300005578 Bacteria 1431
70 Ga0068856_100187131 3300005614 Bacteria 2084
71 Ga0070702_100025393 3300005615 Bacteria 3174
72 Ga0070702_101577758 3300005615 Bacteria 542
73 Ga0068852_100078640 3300005616 Bacteria 2918
74 Ga0068859_100047800 3300005617 Bacteria 4299
75 Ga0068859_100599599 3300005617 Bacteria 1195
76 Ga0068864_101775850 3300005618 Bacteria 622
77 Ga0068866_10007775 3300005718 Bacteria 4498
78 Ga0068861_100022341 3300005719 Bacteria 4556
79 Ga0068863_100013390 3300005841 Bacteria 7909
80 Ga0068858_100079037 3300005842 Bacteria 3056
81 Ga0068858_100352824 3300005842 Bacteria 1409
82 Ga0068860_100045210 3300005843 Bacteria 4198
83 Ga0068862_100563341 3300005844 Bacteria 1089
84 Ga0070717_10455872 3300006028 Bacteria 1153
85 Ga0075365_10188503 3300006038 Bacteria 1443
86 Ga0075365_10837789 3300006038 Bacteria 649
87 Ga0075363_100027624 3300006048 Bacteria 2911
88 Ga0075363_100033846 3300006048 Bacteria 2665
89 Ga0075363_100064426 3300006048 Bacteria 1980
90 Ga0075363_100208501 3300006048 Bacteria 1118
91 Ga0075363_100282658 3300006048 Bacteria 960
92 Ga0075364_10008928 3300006051 Bacteria 6003
93 Ga0075364_10026825 3300006051 Bacteria 3677
94 Ga0075364_10225902 3300006051 Bacteria 1271
95 Ga0075364_10475975 3300006051 Bacteria 854
96 Ga0075364_10600654 3300006051 Bacteria 752
97 Ga0075432_10590409 3300006058 Bacteria 507
98 Ga0070716_100455021 3300006173 Bacteria 934
99 Ga0070712_100028305 3300006175 Bacteria 3747
100 Ga0070712_100257461 3300006175 Bacteria 1397
101 Ga0075362_10060955 3300006177 Bacteria 1706
102 Ga0075362_10582298 3300006177 Bacteria 577
103 Ga0075367_10609732 3300006178 Bacteria 694
104 Ga0075369_10006954 3300006186 Bacteria 4296
105 Ga0075369_10012279 3300006186 Bacteria 3383
106 Ga0075369_10052049 3300006186 Bacteria 1774
107 Ga0075369_10110973 3300006186 Bacteria 1236
108 Ga0075369_10216704 3300006186 Bacteria 885
109 Ga0097621_100078912 3300006237 Bacteria 2736
110 Ga0075370_10004860 3300006353 Bacteria 6591
111 Ga0075370_10086581 3300006353 Bacteria 1804
112 Ga0075370_10183838 3300006353 Bacteria 1231
113 Ga0075370_10236509 3300006353 Bacteria 1081
114 Ga0075430_100056939 3300006846 Bacteria 3288
115 Ga0075431_100030710 3300006847 Bacteria 5535
116 Ga0075434_100186952 3300006871 Bacteria 2092
117 Ga0068865_100035624 3300006881 Bacteria 3349
118 Ga0097620_100047802 3300006931 Bacteria 4299
119 Ga0097620_100599639 3300006931 Bacteria 1195
120 Ga0075435_100137271 3300007076 Bacteria 2049
121 Ga0105250_10013866 3300009092 Bacteria 3319
122 Ga0105250_10056690 3300009092 Bacteria 1572
123 Ga0111539_10258181 3300009094 Bacteria 2029
124 Ga0105245_10136739 3300009098 Bacteria 2304
125 Ga0114129_10020617 3300009147 Bacteria 9372
126 Ga0105243_10108632 3300009148 Bacteria 2316
127 Ga0105243_10183120 3300009148 Bacteria 1823
128 Ga0105243_10558450 3300009148 Bacteria 1095
129 Ga0105243_12935846 3300009148 Unclassified 517
130 Ga0105241_10065393 3300009174 Bacteria 2810
131 Ga0105242_10014318 3300009176 Bacteria 6142
132 Ga0105242_12907009 3300009176 Bacteria 529
133 Ga0105248_10022301 3300009177 Bacteria 7020
134 Ga0105248_10287496 3300009177 Bacteria 1851
135 Ga0105248_10538569 3300009177 Bacteria 1317
136 Ga0105237_10071129 3300009545 Bacteria 3474
137 Ga0105238_10183260 3300009551 Bacteria 2070
138 Ga0105238_11010795 3300009551 Bacteria 852
139 Ga0105249_10111240 3300009553 Bacteria 2590
140 Ga0105239_10170544 3300010375 Bacteria 2433
141 Ga0105239_10983595 3300010375 Bacteria 970
142 Ga0105246_10471590 3300011119 Bacteria 1060
143 Ga0157371_10083637 3300013102 Bacteria 2260
144 Ga0157369_11052414 3300013105 Bacteria 832
145 Ga0157369_11253431 3300013105 Bacteria 756
146 Ga0157374_10377667 3300013296 Bacteria 1411
147 Ga0157378_10023801 3300013297 Bacteria 5388
148 Ga0163162_10283911 3300013306 Bacteria 1787
149 Ga0157372_10418890 3300013307 Bacteria 1561
150 Ga0157375_10238886 3300013308 Bacteria 1976
151 Ga0163163_10022551 3300014325 Bacteria 5965
152 Ga0157380_10032557 3300014326 Bacteria 4012
153 Ga0157377_10132278 3300014745 Bacteria 1525
154 Ga0157379_10062989 3300014968 Bacteria 3316
155 Ga0157379_10386808 3300014968 Bacteria 1284
156 Ga0157376_10470091 3300014969 Bacteria 1230
157 Ga0163161_10108033 3300017792 Bacteria 2077
158 Ga0209673_1098707 3300025273 Bacteria 632
159 Ga0209051_1048874 3300025303 Bacteria 1430
160 Ga0209051_1078840 3300025303 Bacteria 958
161 Ga0207692_10004298 3300025898 Bacteria 5633
162 Ga0207642_10003351 3300025899 Bacteria 5046
163 Ga0207710_10073993 3300025900 Bacteria 1568
164 Ga0207688_10020191 3300025901 Bacteria 3636
165 Ga0207699_10949242 3300025906 Unclassified 635
166 Ga0207645_10026148 3300025907 Bacteria 3774
167 Ga0207643_10715569 3300025908 Bacteria 647
168 Ga0207654_10048348 3300025911 Bacteria 2434
169 Ga0207693_10109507 3300025915 Bacteria 2166
170 Ga0207693_10161709 3300025915 Bacteria 1762
171 Ga0207660_10150646 3300025917 Bacteria 1787
172 Ga0207662_10037962 3300025918 Bacteria 2821
173 Ga0207657_10367940 3300025919 Bacteria 1133
174 Ga0207681_10487871 3300025923 Bacteria 1007
175 Ga0207694_11796046 3300025924 Bacteria 515
176 Ga0207650_10128546 3300025925 Bacteria 1980
177 Ga0207659_10238225 3300025926 Bacteria 1471
178 Ga0207687_10017141 3300025927 Bacteria 4762
179 Ga0207700_10044824 3300025928 Bacteria 3259
180 Ga0207644_10166225 3300025931 Bacteria 1719
181 Ga0207644_10377621 3300025931 Bacteria 1155
182 Ga0207644_10641745 3300025931 Bacteria 883
183 Ga0207706_10018040 3300025933 Bacteria 6349
184 Ga0207686_10014397 3300025934 Bacteria 4402
185 Ga0207670_10021976 3300025936 Bacteria 3945
186 Ga0207669_10004457 3300025937 Bacteria 6165
187 Ga0207704_10003009 3300025938 Bacteria 7627
188 Ga0207665_10033757 3300025939 Bacteria 3394
189 Ga0207665_10076244 3300025939 Bacteria 2299
190 Ga0207665_10180815 3300025939 Bacteria 1527
191 Ga0207665_10263684 3300025939 Bacteria 1277
192 Ga0207665_10851034 3300025939 Bacteria 722
193 Ga0207691_10395804 3300025940 Bacteria 1178
194 Ga0207711_10479161 3300025941 Bacteria 1159
195 Ga0207689_10009946 3300025942 Bacteria 8204
196 Ga0207667_10398964 3300025949 Bacteria 1400
197 Ga0207651_10435414 3300025960 Bacteria 1122
198 Ga0207712_10254274 3300025961 Bacteria 1422
199 Ga0207668_10000534 3300025972 Bacteria 23819
200 Ga0207668_10034248 3300025972 Bacteria 3371
201 Ga0207640_10130970 3300025981 Bacteria 1813
202 Ga0207640_10195607 3300025981 Bacteria 1528
203 Ga0207658_10030663 3300025986 Bacteria 3810
204 Ga0207658_10055840 3300025986 Bacteria 2928
205 Ga0207677_10142428 3300026023 Bacteria 1838
206 Ga0207703_10136595 3300026035 Bacteria 2123
207 Ga0207639_10017613 3300026041 Bacteria 5066
208 Ga0207708_10476353 3300026075 Bacteria 1043
209 Ga0207702_10080021 3300026078 Bacteria 2834
210 Ga0207641_10002119 3300026088 Bacteria 18758
211 Ga0207676_10543546 3300026095 Bacteria 1109
212 Ga0207675_100394537 3300026118 Bacteria 1363
213 Ga0207683_10027945 3300026121 Bacteria 4875
214 Ga0207698_10296440 3300026142 Bacteria 1503
215 Ga0209813_10109962 3300027866 Bacteria 948
216 Ga0268266_10023906 3300028379 Bacteria 5200
217 Ga0268266_10193421 3300028379 Bacteria 1858
218 Ga0268265_10437328 3300028380 Bacteria 1218
219 Ga0268264_10038613 3300028381 Bacteria 3941
220 Ga0268264_11599067 3300028381 Bacteria 662
221 Ga0307405_10073069 3300031731 Bacteria 2213
222 Ga0307406_10090060 3300031901 Bacteria 2063
223 Ga0307416_103746469 3300032002 Bacteria 509
224 Ga0436360_0554182 3300039438 Bacteria 1024
225 Ga0436361_1171481 3300039447 Bacteria 625
226 Ga0436363_0241537 3300039450 Bacteria 2918
227 Ga0439461_0053585 3300041410 Bacteria 900
228 Ga0439466_0011702 3300041411 Bacteria 3240
229 Ga0439466_0017723 3300041411 Bacteria 2562
230 Ga0439465_0011600 3300041413 Bacteria 2765
231 Ga0439465_0013595 3300041413 Bacteria 2535
232 Ga0439465_0040284 3300041413 Bacteria 1509
233 Ga0439465_0084297 3300041413 Bacteria 1081
234 Ga0451841_0382881 3300041498 Bacteria 571
235 Ga0439431_0005097 3300041997 Bacteria 2896
236 Ga0439445_0008078 3300042004 Bacteria 2456
237 Ga0439448_0057072 3300042005 Bacteria 1286
238 Ga0439434_0007237 3300042435 Bacteria 3252
239 Ga0439434_0099217 3300042435 Bacteria 937
240 Ga0466972_0014404 3300044658 Bacteria 3960
241 Ga0466965_0374066 3300044683 Bacteria 783
242 Ga0466966_0002623 3300044684 Bacteria 11780
243 Ga0466961_0014627 3300044693 Bacteria 5041
244 Ga0466963_0020810 3300044694 Bacteria 4130
245 Ga0466963_1283734 3300044694 Bacteria 514
246 Ga0466964_0123067 3300044706 Bacteria 1172
247 Ga0466964_0196777 3300044706 Bacteria 965
248 Ga0466964_0257546 3300044706 Bacteria 863
249 Ga0466968_0272592 3300044735 Bacteria 808
250 Ga0466968_0280547 3300044735 Bacteria 797
251 Ga0466970_0236991 3300044765 Bacteria 1020
252 Ga0466957_0008307 3300044842 Bacteria 5901
253 Ga0466957_0103932 3300044842 Bacteria 1794
254 Ga0466960_0001319 3300044901 Bacteria 9001
255 Ga0466960_0199941 3300044901 Bacteria 1091
256 Ga0466959_0005097 3300045049 Bacteria 8939
257 Ga0466959_0031349 3300045049 Bacteria 3934
258 Ga0466959_0445024 3300045049 Bacteria 879
259 Ga0466959_0771887 3300045049 Bacteria 643
260 Ga0466958_0573330 3300045836 Bacteria 734
261 Ga0466967_0014281 3300045976 Bacteria 6179
262 Ga0466967_0033862 3300045976 Bacteria 4329
263 Ga0466967_0467943 3300045976 Bacteria 1234
264 Ga0495629_0090668 3300046459 Bacteria 2133
265 Ga0495639_0595861 3300046475 Bacteria 568
266 Ga0495606_0057456 3300046507 Bacteria 2506
267 Ga0495665_0395006 3300046531 Bacteria 702
268 Ga0495640_0066700 3300046533 Bacteria 2427
269 Ga0495635_0111980 3300046663 Bacteria 1864
270 Ga0495581_0152857 3300047315 Bacteria 1348
271 Ga0495686_0001484 3300047472 Bacteria 25494
272 Ga0495686_0033400 3300047472 Bacteria 3322
273 Ga0495593_0058901 3300047673 Bacteria 2013
274 Ga0496100_0043510 3300048903 Bacteria 2872
275 Ga0496100_0335997 3300048903 Bacteria 1138
276 Ga0496100_1084309 3300048903 Bacteria 631
277 Ga0496101_0012239 3300048904 Bacteria 5720
278 Ga0496101_0024544 3300048904 Bacteria 4173
279 Ga0496101_0034399 3300048904 Bacteria 3578
280 Ga0496102_0013344 3300048905 Bacteria 7117
281 Ga0496102_0207284 3300048905 Bacteria 1848
282 Ga0496102_1147753 3300048905 Bacteria 696
283 Ga0496103_0007259 3300048906 Bacteria 6605
284 Ga0496103_0023206 3300048906 Bacteria 3740
285 Ga0496103_0489289 3300048906 Bacteria 788
286 Ga0496104_0008326 3300048907 Bacteria 9210
287 Ga0496105_0072453 3300048908 Bacteria 2847
288 Ga0496106_0011425 3300048909 Bacteria 6570
289 Ga0496107_0522927 3300048910 Bacteria 880
290 Ga0496107_0574036 3300048910 Bacteria 834
291 Ga0496108_0121415 3300048911 Bacteria 2241
292 Ga0496108_1090817 3300048911 Bacteria 679
293 Ga0496109_0053072 3300048912 Bacteria 3696
294 Ga0496109_0494117 3300048912 Bacteria 1155
295 Ga0496109_1407281 3300048912 Bacteria 633
296 Ga0496110_0383558 3300048913 Bacteria 1281
297 Ga0496111_1047122 3300048914 Bacteria 583
298 Ga0496112_0003401 3300048915 Bacteria 13142
299 Ga0496112_0032348 3300048915 Bacteria 5079
300 Ga0496112_0307329 3300048915 Bacteria 1531
301 Ga0496112_0444046 3300048915 Bacteria 1235
302 Ga0496112_0591320 3300048915 Bacteria 1042
303 Ga0496112_0913164 3300048915 Bacteria 800
304 Ga0496113_0044796 3300048916 Bacteria 3279
305 Ga0496113_0117416 3300048916 Bacteria 2077
306 Ga0496113_0118828 3300048916 Bacteria 2065
307 Ga0496113_0245347 3300048916 Bacteria 1429
308 Ga0496114_0003127 3300048917 Bacteria 12700
309 Ga0496114_0814627 3300048917 Bacteria 813
310 Ga0496115_0030731 3300048918 Bacteria 4227
311 Ga0496115_0692088 3300048918 Bacteria 802
312 Ga0496118_0000444 3300048921 Bacteria 68615
313 Ga0496122_0031020 3300048925 Bacteria 4460
314 Ga0496122_0038291 3300048925 Bacteria 3845
315 Ga0496123_0035717 3300048926 Bacteria 3537
316 Ga0496123_0050677 3300048926 Bacteria 2771
317 Ga0496126_0048771 3300048929 Bacteria 3868
318 nmdc:mga03683_353683_c1 3300050489 Bacteria 696
319 nmdc:mga03n38_234713_c1 3300050490 Bacteria 963
320 nmdc:mga03n38_4155_c1 3300050490 Bacteria 4756
321 nmdc:mga03n38_421559_c1 3300050490 Unclassified 738
322 nmdc:mga03n38_88909_c1 3300050490 Bacteria 1466
323 nmdc:mga00v17_221028_c1 3300050491 Bacteria 1226
324 nmdc:mga00v17_39143_c1 3300050491 Bacteria 2838
325 nmdc:mga00v17_45151_c1 3300050491 Bacteria 2661
326 nmdc:mga00v17_552886_c1 3300050491 Bacteria 744
327 nmdc:mga0yw44_22419_c1 3300050492 Bacteria 3541
328 nmdc:mga0yw44_462915_c1 3300050492 Bacteria 859
329 nmdc:mga07m45_18273_c1 3300050496 Bacteria 3781
330 nmdc:mga07m45_41189_c1 3300050496 Bacteria 2586
331 nmdc:mga07m45_8204_c1 3300050496 Bacteria 5359
332 nmdc:mga0qj67_111131_c1 3300050509 Bacteria 2213
333 nmdc:mga06r32_48689_c1 3300050510 Bacteria 4052
334 nmdc:mga08y16_252754_c1 3300050511 Bacteria 1821
335 nmdc:mga0n895_335015_c1 3300050512 Bacteria 1533
336 nmdc:mga0rr50_28637_c1 3300050513 Bacteria 3918
337 nmdc:mga08x19_228806_c1 3300050514 Bacteria 1279
338 nmdc:mga0sz30_159251_c1 3300050516 Bacteria 1000
339 nmdc:mga0sz30_171816_c1 3300050516 Bacteria 961
340 nmdc:mga0sz30_40589_c1 3300050516 Bacteria 1956
341 nmdc:mga0sz30_45973_c1 3300050516 Bacteria 1842
342 nmdc:mga0sz30_73416_c1 3300050516 Bacteria 1474
343 Ga0495655_0214912 3300053083 Bacteria 634
344 Ga0495619_0193720 3300053085 Bacteria 1407
345 Ga0500616_0045802 3300053153 Bacteria 2328
346 Ga0500633_0307888 3300053160 Bacteria 582
347 2644487750 2643221687 Bacteria 6500351
348 2644636403 2643221715 Bacteria 6671032
349 2842139747 2842134933 Bacteria 5847019
350 2902798439 2902792274 Bacteria 7270173
351 2902802786 2902799365 Bacteria 5419524
352 2902813178 2902810491 Bacteria 6794147
353 Ga0436361_1070605
354 JGI24750J21931_1058302
355 JGI24738J21930_10055007
356 JGI24749J21850_1009243
357 JGI24744J21845_10002344
358 JGI24034J26672_10001151
359 JGI24751J29686_10003294
360 rootH2_10257890
361 Ga0055540_1008066
362 Ga0065704_10178884
363 Ga0070683_100460925
364 Ga0070690_100023150
365 Ga0070670_100048768
366 Ga0070677_10058208
367 Ga0068869_100026780
368 Ga0070666_10116817
369 Ga0070680_100044103
370 Ga0068868_100041911
371 Ga0068868_100128608
372 Ga0070660_100212760
373 Ga0070689_100059295
374 Ga0070691_10039754
375 Ga0070661_101439120
376 Ga0070692_10066317
377 Ga0070668_100001409
378 Ga0070668_100128684
379 Ga0070671_100005370
380 Ga0070671_100416796
381 Ga0070671_100862961
382 Ga0070674_100015558
383 Ga0070674_100823941
384 Ga0070673_100241133
385 Ga0070688_100017705
386 Ga0070667_100014088
387 Ga0070667_100104535
388 Ga0070667_100350089
389 Ga0070709_10564966
390 Ga0070709_10566790
391 Ga0070714_100684400
392 Ga0070714_100859662
393 Ga0070710_10045614
394 Ga0070701_11205733
395 Ga0070711_100011440
396 Ga0070711_101215190
397 Ga0070705_100090629
398 Ga0070700_100159132
399 Ga0070694_100018782
400 Ga0070663_100012544
401 Ga0070663_100382406
402 Ga0070662_101236106
403 Ga0068867_100114416
404 Ga0070685_10051717
405 Ga0070685_11451571
406 Ga0070697_100433301
407 Ga0068853_100422801
408 Ga0068853_101655207
409 Ga0070672_100094515
410 Ga0070686_100030519
411 Ga0070686_100125866
412 Ga0070696_100031205
413 Ga0070693_100077702
414 Ga0070693_100253131
415 Ga0070665_100040526
416 Ga0070665_100226228
417 Ga0070665_100234417
418 Ga0070704_100015775
419 Ga0068855_100110339
420 Ga0068854_100047247
421 Ga0068854_100244184
422 Ga0068856_100187131
423 Ga0070702_100025393
424 Ga0070702_101577758
425 Ga0068852_100078640
426 Ga0068859_100047800
427 Ga0068859_100599599
428 Ga0068864_101775850
429 Ga0068866_10007775
430 Ga0068861_100022341
431 Ga0068863_100013390
432 Ga0068858_100079037
433 Ga0068858_100352824
434 Ga0068860_100045210
435 Ga0068862_100563341
436 Ga0070717_10455872
437 Ga0075365_10188503
438 Ga0075365_10837789
439 Ga0075363_100027624
440 Ga0075363_100033846
441 Ga0075363_100064426
442 Ga0075363_100208501
443 Ga0075363_100282658
444 Ga0075364_10008928
445 Ga0075364_10026825
446 Ga0075364_10225902
447 Ga0075364_10475975
448 Ga0075364_10600654
449 Ga0075432_10590409
450 Ga0070716_100455021
451 Ga0070712_100028305
452 Ga0070712_100257461
453 Ga0075362_10060955
454 Ga0075362_10582298
455 Ga0075367_10609732
456 Ga0075369_10006954
457 Ga0075369_10012279
458 Ga0075369_10052049
459 Ga0075369_10110973
460 Ga0075369_10216704
461 Ga0097621_100078912
462 Ga0075370_10004860
463 Ga0075370_10086581
464 Ga0075370_10183838
465 Ga0075370_10236509
466 Ga0075430_100056939
467 Ga0075431_100030710
468 Ga0075434_100186952
469 Ga0068865_100035624
470 Ga0097620_100047802
471 Ga0097620_100599639
472 Ga0075435_100137271
473 Ga0105250_10013866
474 Ga0105250_10056690
475 Ga0111539_10258181
476 Ga0105245_10136739
477 Ga0114129_10020617
478 Ga0105243_10108632
479 Ga0105243_10183120
480 Ga0105243_10558450
481 Ga0105243_12935846
482 Ga0105241_10065393
483 Ga0105242_10014318
484 Ga0105242_12907009
485 Ga0105248_10022301
486 Ga0105248_10287496
487 Ga0105248_10538569
488 Ga0105237_10071129
489 Ga0105238_10183260
490 Ga0105238_11010795
491 Ga0105249_10111240
492 Ga0105239_10170544
493 Ga0105239_10983595
494 Ga0105246_10471590
495 Ga0157371_10083637
496 Ga0157369_11052414
497 Ga0157369_11253431
498 Ga0157374_10377667
499 Ga0157378_10023801
500 Ga0163162_10283911
501 Ga0157372_10418890
502 Ga0157375_10238886
503 Ga0163163_10022551
504 Ga0157380_10032557
505 Ga0157377_10132278
506 Ga0157379_10062989
507 Ga0157379_10386808
508 Ga0157376_10470091
509 Ga0163161_10108033
510 Ga0209673_1098707
511 Ga0209051_1048874
512 Ga0209051_1078840
513 Ga0207692_10004298
514 Ga0207642_10003351
515 Ga0207710_10073993
516 Ga0207688_10020191
517 Ga0207699_10949242
518 Ga0207645_10026148
519 Ga0207643_10715569
520 Ga0207654_10048348
521 Ga0207693_10109507
522 Ga0207693_10161709
523 Ga0207660_10150646
524 Ga0207662_10037962
525 Ga0207657_10367940
526 Ga0207681_10487871
527 Ga0207694_11796046
528 Ga0207650_10128546
529 Ga0207659_10238225
530 Ga0207687_10017141
531 Ga0207700_10044824
532 Ga0207644_10166225
533 Ga0207644_10377621
534 Ga0207644_10641745
535 Ga0207706_10018040
536 Ga0207686_10014397
537 Ga0207670_10021976
538 Ga0207669_10004457
539 Ga0207704_10003009
540 Ga0207665_10033757
541 Ga0207665_10076244
542 Ga0207665_10180815
543 Ga0207665_10263684
544 Ga0207665_10851034
545 Ga0207691_10395804
546 Ga0207711_10479161
547 Ga0207689_10009946
548 Ga0207667_10398964
549 Ga0207651_10435414
550 Ga0207712_10254274
551 Ga0207668_10000534
552 Ga0207668_10034248
553 Ga0207640_10130970
554 Ga0207640_10195607
555 Ga0207658_10030663
556 Ga0207658_10055840
557 Ga0207677_10142428
558 Ga0207703_10136595
559 Ga0207639_10017613
560 Ga0207708_10476353
561 Ga0207702_10080021
562 Ga0207641_10002119
563 Ga0207676_10543546
564 Ga0207675_100394537
565 Ga0207683_10027945
566 Ga0207698_10296440
567 Ga0209813_10109962
568 Ga0268266_10023906
569 Ga0268266_10193421
570 Ga0268265_10437328
571 Ga0268264_10038613
572 Ga0268264_11599067
573 Ga0307405_10073069
574 Ga0307406_10090060
575 Ga0307416_103746469
576 Ga0436360_0554182
577 Ga0436361_1171481
578 Ga0436363_0241537
579 Ga0439461_0053585
580 Ga0439466_0011702
581 Ga0439466_0017723
582 Ga0439465_0011600
583 Ga0439465_0013595
584 Ga0439465_0040284
585 Ga0439465_0084297
586 Ga0451841_0382881
587 Ga0439431_0005097
588 Ga0439445_0008078
589 Ga0439448_0057072
590 Ga0439434_0007237
591 Ga0439434_0099217
592 Ga0466972_0014404
593 Ga0466965_0374066
594 Ga0466966_0002623
595 Ga0466961_0014627
596 Ga0466963_0020810
597 Ga0466963_1283734
598 Ga0466964_0123067
599 Ga0466964_0196777
600 Ga0466964_0257546
601 Ga0466968_0272592
602 Ga0466968_0280547
603 Ga0466970_0236991
604 Ga0466957_0008307
605 Ga0466957_0103932
606 Ga0466960_0001319
607 Ga0466960_0199941
608 Ga0466959_0005097
609 Ga0466959_0031349
610 Ga0466959_0445024
611 Ga0466959_0771887
612 Ga0466958_0573330
613 Ga0466967_0014281
614 Ga0466967_0033862
615 Ga0466967_0467943
616 Ga0495629_0090668
617 Ga0495639_0595861
618 Ga0495606_0057456
619 Ga0495665_0395006
620 Ga0495640_0066700
621 Ga0495635_0111980
622 Ga0495581_0152857
623 Ga0495686_0001484
624 Ga0495686_0033400
625 Ga0495593_0058901
626 Ga0496100_0043510
627 Ga0496100_0335997
628 Ga0496100_1084309
629 Ga0496101_0012239
630 Ga0496101_0024544
631 Ga0496101_0034399
632 Ga0496102_0013344
633 Ga0496102_0207284
634 Ga0496102_1147753
635 Ga0496103_0007259
636 Ga0496103_0023206
637 Ga0496103_0489289
638 Ga0496104_0008326
639 Ga0496105_0072453
640 Ga0496106_0011425
641 Ga0496107_0522927
642 Ga0496107_0574036
643 Ga0496108_0121415
644 Ga0496108_1090817
645 Ga0496109_0053072
646 Ga0496109_0494117
647 Ga0496109_1407281
648 Ga0496110_0383558
649 Ga0496111_1047122
650 Ga0496112_0003401
651 Ga0496112_0032348
652 Ga0496112_0307329
653 Ga0496112_0444046
654 Ga0496112_0591320
655 Ga0496112_0913164
656 Ga0496113_0044796
657 Ga0496113_0117416
658 Ga0496113_0118828
659 Ga0496113_0245347
660 Ga0496114_0003127
661 Ga0496114_0814627
662 Ga0496115_0030731
663 Ga0496115_0692088
664 Ga0496118_0000444
665 Ga0496122_0031020
666 Ga0496122_0038291
667 Ga0496123_0035717
668 Ga0496123_0050677
669 Ga0496126_0048771
670 nmdc:mga03683_353683_c1
671 nmdc:mga03n38_234713_c1
672 nmdc:mga03n38_4155_c1
673 nmdc:mga03n38_421559_c1
674 nmdc:mga03n38_88909_c1
675 nmdc:mga00v17_221028_c1
676 nmdc:mga00v17_39143_c1
677 nmdc:mga00v17_45151_c1
678 nmdc:mga00v17_552886_c1
679 nmdc:mga0yw44_22419_c1
680 nmdc:mga0yw44_462915_c1
681 nmdc:mga07m45_18273_c1
682 nmdc:mga07m45_41189_c1
683 nmdc:mga07m45_8204_c1
684 nmdc:mga0qj67_111131_c1
685 nmdc:mga06r32_48689_c1
686 nmdc:mga08y16_252754_c1
687 nmdc:mga0n895_335015_c1
688 nmdc:mga0rr50_28637_c1
689 nmdc:mga08x19_228806_c1
690 nmdc:mga0sz30_159251_c1
691 nmdc:mga0sz30_171816_c1
692 nmdc:mga0sz30_40589_c1
693 nmdc:mga0sz30_45973_c1
694 nmdc:mga0sz30_73416_c1
695 Ga0495655_0214912
696 Ga0495619_0193720
697 Ga0500616_0045802
698 Ga0500633_0307888
699 2644487750
700 2644636403
701 2842139747
702 2902798439
703 2902802786
704 2902813178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14087

DUF4267

Domain of unknown function (DUF4267)

14

118

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gou-assembly1.cif.gz_J structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.5977 1 61
5gou-assembly1.cif.gz_A structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.5003 2 56
6m20-assembly3.cif.gz_C crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose 0.4243 2 111
1s3q-assembly1.cif.gz_D crystal structures of a novel open pore ferritin from the hyperthermophilic archaeon archaeoglobus fulgidus 0.4221 2 112
6j4j-assembly1.cif.gz_H soybean seed h-2 ferritin 0.4151 2 113
ID Description Score Start End Superfamily
af_Q552F9_2_110_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6998 5 101 1.20.120.550
af_A1Z9K9_1_160_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6961 1 112 1.20.140.150
af_A1Z9K9_1_160_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.682 1 112 1.20.140.150
af_A0A0R0GET6_7_150_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6528 1 111 1.20.140.40
af_K7M4G9_28_173_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6477 1 111 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A7Y9EBV6-F1-model_v4 DUF4267 domain-containing protein 0.9891 50 112 GO:0016020
AF-A0A840PQL7-F1-model_v4 DUF4267 domain-containing protein 0.9647 54 114 GO:0016020
AF-A0A840PQL7-F1-model_v4 DUF4267 domain-containing protein 0.9208 54 114 GO:0016020
AF-A0A3N6DZC1-F1-model_v4 deleted 0.8989 2 114
AF-A0A850CX58-F1-model_v4 deleted 0.8951 4 114

Map