F418560

General Info

Members Datasets Scaffolds Average Seq Length
351 230 702 129

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100097542|Ga0068855_1000975422
Length 140
Sequence LKKAEMMIQPKLSKLELQIMETLWSRGACSIREMQEAFPEAKRPAYTTVQTIVYRLLERKKAVKIVRRISNANIFDAAISRDDAGRRLMDDALALFGGRTKPVMAHLVETGRLTLEDLKEAEEAIRRLGKPKGSRNEGRK

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
214 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
215 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
218 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
219 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 2.85
Rhizosphere 95.16
Stem 0
Stem Tuber 0
Unclassified 28.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100097542 3300005563 Unclassified 3386
2 MBSR1b_contig_8740816 2162886012 Bacteria 2074
3 rootH2_10225329 3300003320 Bacteria 2342
4 rootL2_10217067 3300003322 Unclassified 1165
5 Ga0070658_10184203 3300005327 Bacteria 1758
6 Ga0070658_10542849 3300005327 Unclassified 1006
7 Ga0070676_10021788 3300005328 Bacteria 3589
8 Ga0070676_10509261 3300005328 Bacteria 856
9 Ga0070683_100328828 3300005329 Bacteria 1455
10 Ga0070683_100877736 3300005329 Unclassified 860
11 Ga0070690_100004643 3300005330 Bacteria 7647
12 Ga0070690_100761046 3300005330 Unclassified 748
13 Ga0070670_100859438 3300005331 Bacteria 821
14 Ga0070677_10429597 3300005333 Bacteria 702
15 Ga0070677_10441458 3300005333 Bacteria 694
16 Ga0068869_100266608 3300005334 Bacteria 1373
17 Ga0068869_100303345 3300005334 Unclassified 1290
18 Ga0070666_10019069 3300005335 Bacteria 4423
19 Ga0070680_101549997 3300005336 Bacteria 574
20 Ga0068868_100715399 3300005338 Unclassified 897
21 Ga0070691_10173867 3300005341 Bacteria 1117
22 Ga0070691_10473378 3300005341 Bacteria 719
23 Ga0070661_100088175 3300005344 Bacteria 2296
24 Ga0070668_100305224 3300005347 Bacteria 1336
25 Ga0070668_101192301 3300005347 Bacteria 690
26 Ga0070669_100035205 3300005353 Bacteria 3627
27 Ga0070669_100036017 3300005353 Bacteria 3585
28 Ga0070675_100005863 3300005354 Bacteria 9410
29 Ga0070675_100042295 3300005354 Bacteria 3722
30 Ga0070675_100968833 3300005354 Bacteria 781
31 Ga0070673_100003777 3300005364 Bacteria 9495
32 Ga0070659_101130473 3300005366 Bacteria 691
33 Ga0070703_10063364 3300005406 Unclassified 1215
34 Ga0070713_100470506 3300005436 Bacteria 1183
35 Ga0070713_101151202 3300005436 Bacteria 750
36 Ga0070701_10036293 3300005438 Bacteria 2483
37 Ga0070711_100468410 3300005439 Unclassified 1034
38 Ga0070705_100332073 3300005440 Bacteria 1102
39 Ga0070700_100005153 3300005441 Bacteria 6905
40 Ga0070700_100120342 3300005441 Bacteria 1758
41 Ga0070694_100348043 3300005444 Bacteria 1147
42 Ga0070662_100009244 3300005457 Bacteria 6439
43 Ga0070681_10020319 3300005458 Bacteria 6656
44 Ga0068867_100804396 3300005459 Bacteria 839
45 Ga0070707_100704947 3300005468 Bacteria 972
46 Ga0070699_101183159 3300005518 Bacteria 701
47 Ga0070679_100193484 3300005530 Bacteria 2002
48 Ga0070679_100948789 3300005530 Unclassified 804
49 Ga0070684_100010424 3300005535 Bacteria 7364
50 Ga0070684_100070890 3300005535 Unclassified 3068
51 Ga0068853_100000295 3300005539 Bacteria 34981
52 Ga0070686_100408868 3300005544 Bacteria 1034
53 Ga0070695_100073954 3300005545 Bacteria 2238
54 Ga0070695_100410170 3300005545 Bacteria 1029
55 Ga0070693_100310561 3300005547 Unclassified 1066
56 Ga0070704_100891347 3300005549 Bacteria 800
57 Ga0068855_101406270 3300005563 Unclassified 719
58 Ga0070664_100024986 3300005564 Bacteria 4950
59 Ga0070664_100212205 3300005564 Bacteria 1730
60 Ga0068857_100081367 3300005577 Bacteria 2892
61 Ga0068857_101027249 3300005577 Bacteria 794
62 Ga0068854_100051052 3300005578 Unclassified 2962
63 Ga0068856_100027373 3300005614 Bacteria 5561
64 Ga0068856_100027634 3300005614 Bacteria 5535
65 Ga0070702_100002504 3300005615 Bacteria 7959
66 Ga0068852_100000126 3300005616 Bacteria 51078
67 Ga0068859_100034972 3300005617 Bacteria 5040
68 Ga0068859_100332621 3300005617 Unclassified 1613
69 Ga0068859_100859323 3300005617 Bacteria 993
70 Ga0068864_100016506 3300005618 Bacteria 6146
71 Ga0068861_100000062 3300005719 Bacteria 51049
72 Ga0068861_100005027 3300005719 Bacteria 8915
73 Ga0068861_100559205 3300005719 Bacteria 1044
74 Ga0068851_10155063 3300005834 Bacteria 1254
75 Ga0068870_10033826 3300005840 Bacteria 2612
76 Ga0068858_100145854 3300005842 Bacteria 2223
77 Ga0068858_101075150 3300005842 Bacteria 789
78 Ga0068860_100225676 3300005843 Bacteria 1819
79 Ga0068862_100000727 3300005844 Bacteria 33406
80 Ga0068862_100008025 3300005844 Bacteria 8736
81 Ga0068862_100423385 3300005844 Bacteria 1250
82 Ga0070717_10014178 3300006028 Bacteria 6128
83 Ga0070715_10628263 3300006163 Unclassified 633
84 Ga0070712_101298728 3300006175 Bacteria 634
85 Ga0068871_100045247 3300006358 Bacteria 3542
86 Ga0068871_100073303 3300006358 Unclassified 2822
87 Ga0075428_100123856 3300006844 Unclassified 2814
88 Ga0075431_100005098 3300006847 Bacteria 12915
89 Ga0075434_100843803 3300006871 Bacteria 932
90 Ga0075429_100787738 3300006880 Bacteria 833
91 Ga0068865_100026571 3300006881 Bacteria 3818
92 Ga0068865_100081013 3300006881 Bacteria 2330
93 Ga0068865_100729537 3300006881 Unclassified 849
94 Ga0075436_100236180 3300006914 Bacteria 1299
95 Ga0075436_100477954 3300006914 Bacteria 910
96 Ga0075436_100590362 3300006914 Unclassified 818
97 Ga0097620_100034974 3300006931 Bacteria 5040
98 Ga0097620_100332592 3300006931 Unclassified 1613
99 Ga0097620_100859369 3300006931 Bacteria 993
100 Ga0075435_100076914 3300007076 Unclassified 2736
101 Ga0105240_10003981 3300009093 Bacteria 22791
102 Ga0105240_10017692 3300009093 Bacteria 9599
103 Ga0105240_10561570 3300009093 Bacteria 1261
104 Ga0111539_10116577 3300009094 Bacteria 3132
105 Ga0111539_10459862 3300009094 Bacteria 1482
106 Ga0111539_11007607 3300009094 Unclassified 968
107 Ga0105245_10782327 3300009098 Unclassified 991
108 Ga0105245_10899499 3300009098 Unclassified 927
109 Ga0105247_10132710 3300009101 Bacteria 1624
110 Ga0105247_11656700 3300009101 Unclassified 527
111 Ga0114129_10099270 3300009147 Unclassified 4030
112 Ga0105243_10043686 3300009148 Bacteria 3513
113 Ga0105243_10227507 3300009148 Bacteria 1652
114 Ga0105243_10937085 3300009148 Bacteria 864
115 Ga0105243_11758700 3300009148 Unclassified 650
116 Ga0105241_10000195 3300009174 Bacteria 45500
117 Ga0105241_11175929 3300009174 Bacteria 725
118 Ga0105242_10080022 3300009176 Bacteria 2730
119 Ga0105242_10245144 3300009176 Bacteria 1612
120 Ga0105242_10339283 3300009176 Bacteria 1384
121 Ga0105242_10703728 3300009176 Unclassified 989
122 Ga0105248_10006380 3300009177 Bacteria 12943
123 Ga0105248_10154832 3300009177 Unclassified 2586
124 Ga0105248_10405989 3300009177 Bacteria 1534
125 Ga0105237_10045240 3300009545 Unclassified 4431
126 Ga0105237_10153761 3300009545 Bacteria 2297
127 Ga0105237_10889471 3300009545 Unclassified 897
128 Ga0105237_11150707 3300009545 Unclassified 782
129 Ga0105238_10005226 3300009551 Bacteria 12825
130 Ga0105238_10385244 3300009551 Bacteria 1394
131 Ga0105238_10932352 3300009551 Unclassified 887
132 Ga0105238_11396858 3300009551 Bacteria 727
133 Ga0105249_10010081 3300009553 Bacteria 8293
134 Ga0105249_11046533 3300009553 Unclassified 886
135 Ga0105239_10017289 3300010375 Bacteria 7975
136 Ga0105239_10754198 3300010375 Bacteria 1114
137 Ga0105239_11051256 3300010375 Unclassified 937
138 Ga0105246_10093024 3300011119 Unclassified 2177
139 Ga0157373_10190165 3300013100 Unclassified 1446
140 Ga0157369_10001836 3300013105 Bacteria 25661
141 Ga0157374_10002118 3300013296 Bacteria 16704
142 Ga0157374_10906213 3300013296 Bacteria 899
143 Ga0157374_11076531 3300013296 Unclassified 824
144 Ga0157378_10242041 3300013297 Bacteria 1724
145 Ga0163162_11431837 3300013306 Bacteria 786
146 Ga0157372_10006904 3300013307 Bacteria 12084
147 Ga0157375_10124714 3300013308 Unclassified 2689
148 Ga0163163_10006028 3300014325 Bacteria 10542
149 Ga0163163_10537657 3300014325 Bacteria 1231
150 Ga0163163_11235821 3300014325 Bacteria 809
151 Ga0157380_10558191 3300014326 Unclassified 1125
152 Ga0157377_10007725 3300014745 Bacteria 5209
153 Ga0157379_10110942 3300014968 Bacteria 2463
154 Ga0157379_10993104 3300014968 Unclassified 800
155 Ga0157379_12503370 3300014968 Unclassified 516
156 Ga0157376_11754032 3300014969 Unclassified 656
157 Ga0213876_10433482 3300021384 Unclassified 699
158 Ga0207426_1023032 3300025302 Bacteria 2130
159 Ga0207656_10153724 3300025321 Unclassified 1091
160 Ga0207710_10082770 3300025900 Bacteria 1491
161 Ga0207685_10232324 3300025905 Bacteria 883
162 Ga0207645_10062406 3300025907 Bacteria 2381
163 Ga0207645_10551978 3300025907 Bacteria 781
164 Ga0207643_10101539 3300025908 Bacteria 1687
165 Ga0207654_10000087 3300025911 Bacteria 61321
166 Ga0207707_10664575 3300025912 Unclassified 877
167 Ga0207695_10000724 3300025913 Bacteria 64098
168 Ga0207695_10014101 3300025913 Bacteria 9490
169 Ga0207695_10444006 3300025913 Bacteria 1180
170 Ga0207671_10000399 3300025914 Bacteria 60606
171 Ga0207671_11466716 3300025914 Unclassified 527
172 Ga0207660_10590622 3300025917 Bacteria 904
173 Ga0207657_10573856 3300025919 Bacteria 881
174 Ga0207649_10035137 3300025920 Bacteria 3009
175 Ga0207649_10173087 3300025920 Bacteria 1505
176 Ga0207646_10494052 3300025922 Bacteria 1103
177 Ga0207681_10027597 3300025923 Bacteria 3672
178 Ga0207694_10000040 3300025924 Bacteria 184281
179 Ga0207659_10017189 3300025926 Bacteria 4721
180 Ga0207687_11595869 3300025927 Bacteria 560
181 Ga0207700_10197753 3300025928 Bacteria 1692
182 Ga0207690_10639918 3300025932 Bacteria 871
183 Ga0207706_10014694 3300025933 Bacteria 7091
184 Ga0207706_10687467 3300025933 Bacteria 875
185 Ga0207686_10079915 3300025934 Unclassified 2130
186 Ga0207686_10273612 3300025934 Bacteria 1243
187 Ga0207686_10294139 3300025934 Bacteria 1204
188 Ga0207709_10026018 3300025935 Bacteria 3357
189 Ga0207709_10124179 3300025935 Bacteria 1748
190 Ga0207709_10867599 3300025935 Unclassified 732
191 Ga0207670_10068047 3300025936 Bacteria 2452
192 Ga0207669_10125913 3300025937 Bacteria 1750
193 Ga0207704_10012312 3300025938 Bacteria 4245
194 Ga0207704_10053309 3300025938 Bacteria 2458
195 Ga0207704_10966808 3300025938 Bacteria 719
196 Ga0207665_10381957 3300025939 Unclassified 1069
197 Ga0207711_10023266 3300025941 Bacteria 5185
198 Ga0207711_10057672 3300025941 Unclassified 3339
199 Ga0207711_11034392 3300025941 Bacteria 761
200 Ga0207689_10167858 3300025942 Bacteria 1808
201 Ga0207689_10402002 3300025942 Bacteria 1142
202 Ga0207661_10309703 3300025944 Bacteria 1417
203 Ga0207661_11408357 3300025944 Unclassified 640
204 Ga0207661_11640321 3300025944 Unclassified 588
205 Ga0207679_10015566 3300025945 Bacteria 5030
206 Ga0207679_10204954 3300025945 Bacteria 1650
207 Ga0207679_10621640 3300025945 Bacteria 975
208 Ga0207667_10010077 3300025949 Bacteria 11080
209 Ga0207651_10013083 3300025960 Bacteria 4731
210 Ga0207712_10003769 3300025961 Bacteria 9574
211 Ga0207712_10063614 3300025961 Bacteria 2627
212 Ga0207712_10596280 3300025961 Bacteria 955
213 Ga0207712_10678883 3300025961 Bacteria 897
214 Ga0207712_10903065 3300025961 Unclassified 781
215 Ga0207668_10061441 3300025972 Bacteria 2642
216 Ga0207640_10067038 3300025981 Bacteria 2400
217 Ga0207640_10570486 3300025981 Bacteria 954
218 Ga0207658_10624811 3300025986 Bacteria 969
219 Ga0207677_10261238 3300026023 Bacteria 1411
220 Ga0207703_10101073 3300026035 Unclassified 2444
221 Ga0207703_10329538 3300026035 Bacteria 1400
222 Ga0207639_10000156 3300026041 Bacteria 51907
223 Ga0207708_10061187 3300026075 Bacteria 2874
224 Ga0207708_10255552 3300026075 Unclassified 1413
225 Ga0207702_10022784 3300026078 Bacteria 5195
226 Ga0207702_10067079 3300026078 Unclassified 3078
227 Ga0207648_10075078 3300026089 Bacteria 2947
228 Ga0207648_10216731 3300026089 Bacteria 1700
229 Ga0207648_10452565 3300026089 Unclassified 1169
230 Ga0207674_10088844 3300026116 Bacteria 3083
231 Ga0207674_10994743 3300026116 Bacteria 808
232 Ga0207675_100000614 3300026118 Bacteria 34802
233 Ga0207683_10680240 3300026121 Bacteria 954
234 Ga0207698_10000088 3300026142 Bacteria 60215
235 Ga0207698_11126311 3300026142 Bacteria 798
236 Ga0207428_10057582 3300027907 Bacteria 3085
237 Ga0207428_10720584 3300027907 Unclassified 712
238 Ga0268266_10244722 3300028379 Unclassified 1657
239 Ga0268265_10003359 3300028380 Bacteria 11556
240 Ga0268265_10006101 3300028380 Bacteria 8180
241 Ga0268264_10097513 3300028381 Bacteria 2548
242 Ga0268264_10424931 3300028381 Bacteria 1282
243 Ga0265318_10289825 3300028577 Unclassified 597
244 Ga0265760_10306838 3300031090 Unclassified 563
245 Ga0265331_10009175 3300031250 Bacteria 5577
246 Ga0307408_100206880 3300031548 Unclassified 1592
247 Ga0307408_100630477 3300031548 Unclassified 956
248 Ga0307408_101135087 3300031548 Bacteria 726
249 Ga0307412_10267912 3300031911 Unclassified 1335
250 Ga0307416_100106036 3300032002 Bacteria 2462
251 Ga0307411_10067144 3300032005 Bacteria 2412
252 Ga0373958_0008290 3300034819 Unclassified 1680
253 Ga0373934_0031237 3300035086 Bacteria 2085
254 Ga0373932_0376556 3300035112 Bacteria 545
255 Ga0373941_0075705 3300035115 Bacteria 1127
256 Ga0373953_0112176 3300035117 Unclassified 1154
257 Ga0373953_0315232 3300035117 Bacteria 683
258 Ga0373954_0001012 3300035118 Bacteria 11114
259 Ga0373957_0063756 3300035120 Bacteria 1432
260 Ga0373955_0061690 3300035172 Bacteria 2071
261 Ga0373962_0058754 3300035242 Unclassified 1125
262 Ga0373931_1266873 3300035691 Unclassified 506
263 Ga0373927_0001204 3300035695 Bacteria 19622
264 Ga0373927_0641408 3300035695 Unclassified 702
265 Ga0373933_0057418 3300035724 Bacteria 2339
266 Ga0373933_0559297 3300035724 Unclassified 751
267 Ga0373947_0021906 3300035725 Bacteria 3703
268 Ga0373937_0431715 3300036401 Bacteria 1250
269 Ga0373937_0876870 3300036401 Unclassified 846
270 Ga0373937_2134277 3300036401 Bacteria 506
271 Ga0373925_0521274 3300037068 Bacteria 976
272 Ga0373925_0660070 3300037068 Unclassified 862
273 Ga0436365_0451629 3300039437 Unclassified 2078
274 Ga0436363_1720029 3300039450 Bacteria 2818
275 Ga0436362_1232383 3300039453 Unclassified 1657
276 Ga0466959_0957180 3300045049 Bacteria 571
277 Ga0451576_0124342 3300045051 Bacteria 2687
278 Ga0495592_0019586 3300046454 Bacteria 5147
279 Ga0495629_0506632 3300046459 Unclassified 814
280 Ga0495651_0048667 3300046462 Unclassified 3273
281 Ga0495653_0321459 3300046463 Bacteria 1003
282 Ga0495653_0527956 3300046463 Unclassified 733
283 Ga0495580_0000667 3300046472 Bacteria 29197
284 Ga0495582_0214411 3300046473 Unclassified 1101
285 Ga0495639_0093962 3300046475 Bacteria 1410
286 Ga0495662_0139644 3300046476 Bacteria 1192
287 Ga0495664_0253156 3300046477 Unclassified 1065
288 Ga0495594_0113134 3300046499 Unclassified 1531
289 Ga0495608_0909134 3300046511 Bacteria 515
290 Ga0495618_0258163 3300046514 Bacteria 1092
291 Ga0495628_0085768 3300046516 Bacteria 2442
292 Ga0495630_0140620 3300046517 Bacteria 1835
293 Ga0495652_0223371 3300046529 Bacteria 1414
294 Ga0495652_0799690 3300046529 Unclassified 628
295 Ga0495665_0145396 3300046531 Bacteria 1238
296 Ga0495665_0656255 3300046531 Unclassified 522
297 Ga0495586_0378379 3300046535 Bacteria 814
298 Ga0495645_0284611 3300046543 Bacteria 1086
299 Ga0495645_0302493 3300046543 Bacteria 1044
300 Ga0495645_0700861 3300046543 Unclassified 615
301 Ga0495667_0129146 3300046559 Bacteria 1630
302 Ga0495635_0054953 3300046663 Bacteria 2743
303 Ga0495635_0343824 3300046663 Bacteria 996
304 Ga0495657_0570988 3300046675 Bacteria 656
305 Ga0495599_0019722 3300046678 Unclassified 4203
306 Ga0495623_0129657 3300046679 Bacteria 1511
307 Ga0495646_0312108 3300046680 Bacteria 830
308 Ga0495646_0521455 3300046680 Unclassified 609
309 Ga0495658_0599270 3300046683 Unclassified 706
310 Ga0495613_0141242 3300046689 Bacteria 1721
311 Ga0495636_0372597 3300047318 Bacteria 677
312 Ga0495674_0078146 3300047319 Bacteria 2844
313 Ga0495674_0511484 3300047319 Bacteria 959
314 Ga0495680_0352483 3300047322 Unclassified 1024
315 Ga0495675_0144880 3300047444 Bacteria 1470
316 Ga0495684_0029024 3300047471 Unclassified 4245
317 Ga0495684_0163470 3300047471 Bacteria 1659
318 Ga0495602_0691978 3300048088 Unclassified 693
319 Ga0496104_0147673 3300048907 Unclassified 2258
320 Ga0496104_0159018 3300048907 Unclassified 2167
321 Ga0496106_0140222 3300048909 Bacteria 1901
322 Ga0496107_0067305 3300048910 Bacteria 2599
323 Ga0496108_0322002 3300048911 Bacteria 1348
324 Ga0496110_0824740 3300048913 Bacteria 832
325 Ga0496112_1337403 3300048915 Unclassified 632
326 Ga0496114_0198399 3300048917 Unclassified 1757
327 Ga0496115_0115612 3300048918 Bacteria 2206
328 Ga0496115_0148363 3300048918 Bacteria 1936
329 Ga0496126_0293140 3300048929 Bacteria 1345
330 Ga0501299_013020 3300049522 Bacteria 1429
331 Ga0501208_033615 3300049655 Bacteria 918
332 Ga0501249_097577 3300049679 Bacteria 701
333 Ga0501080_0548121 3300049742 Bacteria 1030
334 Ga0501272_014964 3300049769 Bacteria 900
335 Ga0501279_067368 3300049775 Bacteria 597
336 Ga0501212_071068 3300049851 Bacteria 616
337 nmdc:mga05p37_90012_c1 3300050507 Unclassified 3782
338 nmdc:mga09592_119778_c1 3300050508 Bacteria 2260
339 nmdc:mga09592_567741_c1 3300050508 Bacteria 974
340 nmdc:mga0qj67_37503_c1 3300050509 Bacteria 3797
341 nmdc:mga06r32_104245_c1 3300050510 Bacteria 2785
342 nmdc:mga06r32_2667_c1 3300050510 Bacteria 15957
343 nmdc:mga06r32_858690_c1 3300050510 Bacteria 866
344 nmdc:mga08y16_202574_c1 3300050511 Unclassified 1300
345 nmdc:mga08y16_936982_c1 3300050511 Bacteria 850
346 nmdc:mga0n895_523412_c1 3300050512 Bacteria 1193
347 nmdc:mga0rr50_80154_c1 3300050513 Unclassified 2516
348 nmdc:mga08x19_812646_c1 3300050514 Bacteria 664
349 Ga0495601_0687348 3300053077 Unclassified 653
350 Ga0495595_0408185 3300053084 Bacteria 689
351 Ga0501082_0000167 3300060353 Bacteria 56214
352 Ga0068855_100097542
353 MBSR1b_contig_8740816
354 rootH2_10225329
355 rootL2_10217067
356 Ga0070658_10184203
357 Ga0070658_10542849
358 Ga0070676_10021788
359 Ga0070676_10509261
360 Ga0070683_100328828
361 Ga0070683_100877736
362 Ga0070690_100004643
363 Ga0070690_100761046
364 Ga0070670_100859438
365 Ga0070677_10429597
366 Ga0070677_10441458
367 Ga0068869_100266608
368 Ga0068869_100303345
369 Ga0070666_10019069
370 Ga0070680_101549997
371 Ga0068868_100715399
372 Ga0070691_10173867
373 Ga0070691_10473378
374 Ga0070661_100088175
375 Ga0070668_100305224
376 Ga0070668_101192301
377 Ga0070669_100035205
378 Ga0070669_100036017
379 Ga0070675_100005863
380 Ga0070675_100042295
381 Ga0070675_100968833
382 Ga0070673_100003777
383 Ga0070659_101130473
384 Ga0070703_10063364
385 Ga0070713_100470506
386 Ga0070713_101151202
387 Ga0070701_10036293
388 Ga0070711_100468410
389 Ga0070705_100332073
390 Ga0070700_100005153
391 Ga0070700_100120342
392 Ga0070694_100348043
393 Ga0070662_100009244
394 Ga0070681_10020319
395 Ga0068867_100804396
396 Ga0070707_100704947
397 Ga0070699_101183159
398 Ga0070679_100193484
399 Ga0070679_100948789
400 Ga0070684_100010424
401 Ga0070684_100070890
402 Ga0068853_100000295
403 Ga0070686_100408868
404 Ga0070695_100073954
405 Ga0070695_100410170
406 Ga0070693_100310561
407 Ga0070704_100891347
408 Ga0068855_101406270
409 Ga0070664_100024986
410 Ga0070664_100212205
411 Ga0068857_100081367
412 Ga0068857_101027249
413 Ga0068854_100051052
414 Ga0068856_100027373
415 Ga0068856_100027634
416 Ga0070702_100002504
417 Ga0068852_100000126
418 Ga0068859_100034972
419 Ga0068859_100332621
420 Ga0068859_100859323
421 Ga0068864_100016506
422 Ga0068861_100000062
423 Ga0068861_100005027
424 Ga0068861_100559205
425 Ga0068851_10155063
426 Ga0068870_10033826
427 Ga0068858_100145854
428 Ga0068858_101075150
429 Ga0068860_100225676
430 Ga0068862_100000727
431 Ga0068862_100008025
432 Ga0068862_100423385
433 Ga0070717_10014178
434 Ga0070715_10628263
435 Ga0070712_101298728
436 Ga0068871_100045247
437 Ga0068871_100073303
438 Ga0075428_100123856
439 Ga0075431_100005098
440 Ga0075434_100843803
441 Ga0075429_100787738
442 Ga0068865_100026571
443 Ga0068865_100081013
444 Ga0068865_100729537
445 Ga0075436_100236180
446 Ga0075436_100477954
447 Ga0075436_100590362
448 Ga0097620_100034974
449 Ga0097620_100332592
450 Ga0097620_100859369
451 Ga0075435_100076914
452 Ga0105240_10003981
453 Ga0105240_10017692
454 Ga0105240_10561570
455 Ga0111539_10116577
456 Ga0111539_10459862
457 Ga0111539_11007607
458 Ga0105245_10782327
459 Ga0105245_10899499
460 Ga0105247_10132710
461 Ga0105247_11656700
462 Ga0114129_10099270
463 Ga0105243_10043686
464 Ga0105243_10227507
465 Ga0105243_10937085
466 Ga0105243_11758700
467 Ga0105241_10000195
468 Ga0105241_11175929
469 Ga0105242_10080022
470 Ga0105242_10245144
471 Ga0105242_10339283
472 Ga0105242_10703728
473 Ga0105248_10006380
474 Ga0105248_10154832
475 Ga0105248_10405989
476 Ga0105237_10045240
477 Ga0105237_10153761
478 Ga0105237_10889471
479 Ga0105237_11150707
480 Ga0105238_10005226
481 Ga0105238_10385244
482 Ga0105238_10932352
483 Ga0105238_11396858
484 Ga0105249_10010081
485 Ga0105249_11046533
486 Ga0105239_10017289
487 Ga0105239_10754198
488 Ga0105239_11051256
489 Ga0105246_10093024
490 Ga0157373_10190165
491 Ga0157369_10001836
492 Ga0157374_10002118
493 Ga0157374_10906213
494 Ga0157374_11076531
495 Ga0157378_10242041
496 Ga0163162_11431837
497 Ga0157372_10006904
498 Ga0157375_10124714
499 Ga0163163_10006028
500 Ga0163163_10537657
501 Ga0163163_11235821
502 Ga0157380_10558191
503 Ga0157377_10007725
504 Ga0157379_10110942
505 Ga0157379_10993104
506 Ga0157379_12503370
507 Ga0157376_11754032
508 Ga0213876_10433482
509 Ga0207426_1023032
510 Ga0207656_10153724
511 Ga0207710_10082770
512 Ga0207685_10232324
513 Ga0207645_10062406
514 Ga0207645_10551978
515 Ga0207643_10101539
516 Ga0207654_10000087
517 Ga0207707_10664575
518 Ga0207695_10000724
519 Ga0207695_10014101
520 Ga0207695_10444006
521 Ga0207671_10000399
522 Ga0207671_11466716
523 Ga0207660_10590622
524 Ga0207657_10573856
525 Ga0207649_10035137
526 Ga0207649_10173087
527 Ga0207646_10494052
528 Ga0207681_10027597
529 Ga0207694_10000040
530 Ga0207659_10017189
531 Ga0207687_11595869
532 Ga0207700_10197753
533 Ga0207690_10639918
534 Ga0207706_10014694
535 Ga0207706_10687467
536 Ga0207686_10079915
537 Ga0207686_10273612
538 Ga0207686_10294139
539 Ga0207709_10026018
540 Ga0207709_10124179
541 Ga0207709_10867599
542 Ga0207670_10068047
543 Ga0207669_10125913
544 Ga0207704_10012312
545 Ga0207704_10053309
546 Ga0207704_10966808
547 Ga0207665_10381957
548 Ga0207711_10023266
549 Ga0207711_10057672
550 Ga0207711_11034392
551 Ga0207689_10167858
552 Ga0207689_10402002
553 Ga0207661_10309703
554 Ga0207661_11408357
555 Ga0207661_11640321
556 Ga0207679_10015566
557 Ga0207679_10204954
558 Ga0207679_10621640
559 Ga0207667_10010077
560 Ga0207651_10013083
561 Ga0207712_10003769
562 Ga0207712_10063614
563 Ga0207712_10596280
564 Ga0207712_10678883
565 Ga0207712_10903065
566 Ga0207668_10061441
567 Ga0207640_10067038
568 Ga0207640_10570486
569 Ga0207658_10624811
570 Ga0207677_10261238
571 Ga0207703_10101073
572 Ga0207703_10329538
573 Ga0207639_10000156
574 Ga0207708_10061187
575 Ga0207708_10255552
576 Ga0207702_10022784
577 Ga0207702_10067079
578 Ga0207648_10075078
579 Ga0207648_10216731
580 Ga0207648_10452565
581 Ga0207674_10088844
582 Ga0207674_10994743
583 Ga0207675_100000614
584 Ga0207683_10680240
585 Ga0207698_10000088
586 Ga0207698_11126311
587 Ga0207428_10057582
588 Ga0207428_10720584
589 Ga0268266_10244722
590 Ga0268265_10003359
591 Ga0268265_10006101
592 Ga0268264_10097513
593 Ga0268264_10424931
594 Ga0265318_10289825
595 Ga0265760_10306838
596 Ga0265331_10009175
597 Ga0307408_100206880
598 Ga0307408_100630477
599 Ga0307408_101135087
600 Ga0307412_10267912
601 Ga0307416_100106036
602 Ga0307411_10067144
603 Ga0373958_0008290
604 Ga0373934_0031237
605 Ga0373932_0376556
606 Ga0373941_0075705
607 Ga0373953_0112176
608 Ga0373953_0315232
609 Ga0373954_0001012
610 Ga0373957_0063756
611 Ga0373955_0061690
612 Ga0373962_0058754
613 Ga0373931_1266873
614 Ga0373927_0001204
615 Ga0373927_0641408
616 Ga0373933_0057418
617 Ga0373933_0559297
618 Ga0373947_0021906
619 Ga0373937_0431715
620 Ga0373937_0876870
621 Ga0373937_2134277
622 Ga0373925_0521274
623 Ga0373925_0660070
624 Ga0436365_0451629
625 Ga0436363_1720029
626 Ga0436362_1232383
627 Ga0466959_0957180
628 Ga0451576_0124342
629 Ga0495592_0019586
630 Ga0495629_0506632
631 Ga0495651_0048667
632 Ga0495653_0321459
633 Ga0495653_0527956
634 Ga0495580_0000667
635 Ga0495582_0214411
636 Ga0495639_0093962
637 Ga0495662_0139644
638 Ga0495664_0253156
639 Ga0495594_0113134
640 Ga0495608_0909134
641 Ga0495618_0258163
642 Ga0495628_0085768
643 Ga0495630_0140620
644 Ga0495652_0223371
645 Ga0495652_0799690
646 Ga0495665_0145396
647 Ga0495665_0656255
648 Ga0495586_0378379
649 Ga0495645_0284611
650 Ga0495645_0302493
651 Ga0495645_0700861
652 Ga0495667_0129146
653 Ga0495635_0054953
654 Ga0495635_0343824
655 Ga0495657_0570988
656 Ga0495599_0019722
657 Ga0495623_0129657
658 Ga0495646_0312108
659 Ga0495646_0521455
660 Ga0495658_0599270
661 Ga0495613_0141242
662 Ga0495636_0372597
663 Ga0495674_0078146
664 Ga0495674_0511484
665 Ga0495680_0352483
666 Ga0495675_0144880
667 Ga0495684_0029024
668 Ga0495684_0163470
669 Ga0495602_0691978
670 Ga0496104_0147673
671 Ga0496104_0159018
672 Ga0496106_0140222
673 Ga0496107_0067305
674 Ga0496108_0322002
675 Ga0496110_0824740
676 Ga0496112_1337403
677 Ga0496114_0198399
678 Ga0496115_0115612
679 Ga0496115_0148363
680 Ga0496126_0293140
681 Ga0501299_013020
682 Ga0501208_033615
683 Ga0501249_097577
684 Ga0501080_0548121
685 Ga0501272_014964
686 Ga0501279_067368
687 Ga0501212_071068
688 nmdc:mga05p37_90012_c1
689 nmdc:mga09592_119778_c1
690 nmdc:mga09592_567741_c1
691 nmdc:mga0qj67_37503_c1
692 nmdc:mga06r32_104245_c1
693 nmdc:mga06r32_2667_c1
694 nmdc:mga06r32_858690_c1
695 nmdc:mga08y16_202574_c1
696 nmdc:mga08y16_936982_c1
697 nmdc:mga0n895_523412_c1
698 nmdc:mga0rr50_80154_c1
699 nmdc:mga08x19_812646_c1
700 Ga0495601_0687348
701 Ga0495595_0408185
702 Ga0501082_0000167

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

12

127

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8986 5 71
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8966 5 71
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.8948 7 71
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.8901 7 71
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8783 8 72
ID Description Score Start End Superfamily
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9136 7 71 1.10.10.10
1sd4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9109 10 70 1.10.10.10
2g9wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9028 5 71 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9005 7 71 1.10.10.10
1sd6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8989 7 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3D5P045-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9382 4 79 GO:0003677
GO:0045892
AF-A0A1G3WQU3-F1-model_v4 Transcriptional regulator 0.9122 1 89 GO:0003677
GO:0045892
AF-A0A4V5TQF5-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9021 5 91 GO:0003677
GO:0045892
AF-A0A3F3LEU3-F1-model_v4 deleted 0.8943 5 85
AF-A0A7X2TWX2-F1-model_v4 MarR family transcriptional regulator 0.8777 5 102 GO:0003677
GO:0045892

Map