F418458

General Info

Members Datasets Scaffolds Average Seq Length
350 314 158 273

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2977864932|2977868631
Length 298
Sequence SRFPSARDCPVFIDQSSGVPALPVSAGRHEQAAPLRLRRLAALLGGGLMVGTVLFFLVLPTLLIVPMSLSQTDYLQFPPRGLTMDWYRTFFGDPDWMAATWFSFKIAIATTLSATVVGTMTSLALVRGKLPFKNTLLAMSLGPMIVPHIVLGVALYLVFSPLQLTGSFTGFLVAHTVLAVPYVVITVSASLQRFDPTLELAALSCGANRVQAFFRIVLPNIAPGIFAASVFAFLASFDEATVAFFISDINGKSIGRKMFEDIDFNLTPVIAAASTTFVGLSLLLMALAHIFGQPNDRR

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
5 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
6 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
7 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
8 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
9 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
10 2519899620 Rhizobium sp. Pop5 Isolate Nodule
11 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
12 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
13 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
14 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
15 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
16 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
17 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
18 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
19 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
20 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
21 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
22 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
23 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
24 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
25 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
26 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
27 2643221610 Ensifer sp. Root74 Isolate Unclassified
28 2643221626 Ensifer sp. Root31 Isolate Unclassified
29 2643221655 Ensifer sp. Root1252 Isolate Unclassified
30 2643221659 Ensifer sp. Root127 Isolate Unclassified
31 2643221668 Ensifer sp. Root423 Isolate Unclassified
32 2643221675 Ensifer sp. Root1298 Isolate Unclassified
33 2643221680 Ensifer sp. Root1312 Isolate Unclassified
34 2643221688 Rhizobium sp. Root482 Isolate Unclassified
35 2643221698 Ensifer sp. Root142 Isolate Unclassified
36 2643221712 Ensifer sp. Root258 Isolate Unclassified
37 2643221726 Ensifer sp. Root954 Isolate Unclassified
38 2643221734 Bosea sp. Root670 Isolate Unclassified
39 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
40 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
41 2718217882 Rhizobium sp. N741 Isolate Nodule
42 2718218009 Rhizobium sp. N561 Isolate Nodule
43 2718218363 Rhizobium sp. N113 Isolate Nodule
44 2718218366 Rhizobium sp. N621 Isolate Nodule
45 2721755514 Rhizobium sp. N6212 Isolate Nodule
46 2721755810 Rhizobium sp. N871 Isolate Nodule
47 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
48 2728369365 Rhizobium sp. N1341 Isolate Nodule
49 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
50 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
51 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
52 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
53 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
54 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
55 2791355262 Rhizobium sp. M1 Isolate Nodule
56 2791355264 Rhizobium sp. S9 Isolate Nodule
57 2791355265 Rhizobium sp. H4 Isolate Nodule
58 2802429634 Rhizobium anhuiense S10 Isolate Nodule
59 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
60 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
61 2802429637 Rhizobium anhuiense C15 Isolate Nodule
62 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
63 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
64 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
65 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
66 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
67 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
68 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
69 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
70 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
71 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
72 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
73 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
74 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
75 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
76 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
77 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
78 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
79 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
80 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
81 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
82 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
83 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
84 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
85 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
86 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
87 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
88 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
89 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
90 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
91 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
92 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
93 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
94 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
95 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
96 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
97 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
98 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
99 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
100 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
101 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
102 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
103 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
104 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
105 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
106 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
107 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
108 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
109 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
110 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
111 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
112 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
113 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
114 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
115 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
116 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
117 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
118 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
119 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
120 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
121 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
122 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
123 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
124 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
125 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
126 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
127 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
128 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
129 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
130 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
131 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
132 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
133 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
134 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
135 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
136 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
137 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
138 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
139 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
140 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
141 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
142 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
143 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
144 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
145 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
146 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
147 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
148 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
149 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
150 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
151 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
152 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
153 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
154 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
155 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
156 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
157 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
158 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
159 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
160 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
161 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
162 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
163 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
164 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
165 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
166 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
167 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
168 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
169 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
170 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
171 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
172 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
173 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
174 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
175 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
176 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
177 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
178 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
179 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
180 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
181 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
182 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
183 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
184 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
185 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
186 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
187 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
188 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
189 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
190 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
191 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
192 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
193 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
194 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
195 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
196 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
197 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
198 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
199 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
200 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
201 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
202 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
203 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
204 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
205 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
206 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
207 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
208 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
209 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
210 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
212 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
213 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
215 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
216 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
217 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
219 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
220 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
221 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
223 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
231 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
237 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
238 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
239 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
240 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
241 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
242 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
243 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
244 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
245 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
248 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
249 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
250 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
288 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
289 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
290 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
291 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
292 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
293 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
294 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
295 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
296 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
297 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
298 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
301 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
302 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
303 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
304 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
305 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
306 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
307 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
308 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
309 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
310 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
311 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
312 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
313 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
314 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.86
Metatranscriptomes 0.29
Isolates 54.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.43
Nodule 43.43
Rhizoplane 2.86
Rhizosphere 20.29
Stem 0
Stem Tuber 0
Unclassified 16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1007295 3300002773 Bacteria 2881
2 JGI25151J46595_10000610 3300003187 Bacteria 31293
3 JGI25165J46597_1000274 3300003214 Bacteria 66514
4 JGI25153J46596_10001161 3300003215 Bacteria 15923
5 rootH2_10186764 3300003320 Bacteria 1338
6 rootH1_10248531 3300003323 Bacteria 3568
7 JGI25160J50197_1001099 3300003354 Bacteria 13817
8 Ga0006562J51391_1031288 3300003578 Bacteria 3810
9 Ga0055526_1001246 3300003771 Bacteria 18251
10 Ga0055526_1010636 3300003771 Bacteria 4255
11 Ga0055524_1000407 3300003775 Bacteria 36421
12 Ga0055524_1001340 3300003775 Bacteria 14365
13 Ga0055524_1018781 3300003775 Bacteria 2389
14 Ga0055528_1000913 3300003790 Bacteria 19898
15 Ga0055528_1003230 3300003790 Bacteria 8315
16 Ga0055528_1006179 3300003790 Bacteria 5461
17 Ga0055543_1000389 3300004625 Bacteria 28395
18 Ga0065165_1001405 3300005262 Bacteria 26282
19 Ga0065165_1006787 3300005262 Bacteria 5851
20 Ga0065165_1010118 3300005262 Bacteria 4129
21 Ga0068853_100003983 3300005539 Bacteria 11353
22 Ga0068854_100043950 3300005578 Bacteria 3169
23 Ga0068856_100043125 3300005614 Bacteria 4439
24 Ga0068852_100303390 3300005616 Bacteria 1546
25 Ga0081540_1093155 3300005983 Bacteria 1320
26 Ga0075368_10071455 3300006042 Bacteria 1402
27 Ga0079104_1008962 3300006946 Bacteria 3434
28 Ga0105240_10000376 3300009093 Bacteria 83903
29 Ga0105237_10001377 3300009545 Bacteria 32081
30 Ga0105237_10028882 3300009545 Bacteria 5644
31 Ga0105237_10039933 3300009545 Bacteria 4734
32 Ga0105238_10514616 3300009551 Bacteria 1199
33 Ga0105239_10224449 3300010375 Bacteria 2107
34 Ga0157370_10002238 3300013104 Bacteria 23529
35 Ga0157369_10056421 3300013105 Bacteria 4239
36 Ga0182007_10001179 3300015262 Bacteria 14187
37 Ga0182005_1018439 3300015265 Bacteria 1928
38 Ga0214543_1000023 3300021327 Bacteria 240412
39 Ga0209563_101954 3300025230 Bacteria 4971
40 Ga0209437_100203 3300025233 Bacteria 117490
41 Ga0207425_1000729 3300025245 Bacteria 17447
42 Ga0209677_100218 3300025253 Bacteria 41903
43 Ga0209129_1001049 3300025258 Bacteria 16312
44 Ga0209233_1000097 3300025261 Bacteria 295452
45 Ga0209233_1000205 3300025261 Bacteria 118120
46 Ga0209673_1000212 3300025273 Bacteria 116031
47 Ga0209673_1001733 3300025273 Bacteria 18329
48 Ga0209673_1001887 3300025273 Bacteria 16855
49 Ga0209675_1019650 3300025291 Bacteria 1851
50 Ga0209025_1000300 3300025294 Bacteria 110956
51 Ga0209564_1000402 3300025295 Bacteria 76964
52 Ga0209564_1002117 3300025295 Bacteria 16855
53 Ga0209758_1002186 3300025297 Bacteria 20487
54 Ga0209758_1008357 3300025297 Bacteria 6735
55 Ga0209256_1000228 3300025299 Bacteria 102990
56 Ga0209256_1000678 3300025299 Bacteria 46016
57 Ga0209256_1002174 3300025299 Bacteria 16843
58 Ga0207426_1000035 3300025302 Bacteria 448327
59 Ga0207426_1000552 3300025302 Bacteria 51852
60 Ga0209051_1012512 3300025303 Bacteria 4099
61 Ga0207695_10000495 3300025913 Bacteria 83911
62 Ga0207671_10000568 3300025914 Bacteria 49545
63 Ga0207671_10158332 3300025914 Bacteria 1752
64 Ga0207671_10287440 3300025914 Bacteria 1298
65 Ga0207640_10041159 3300025981 Bacteria 2937
66 Ga0207639_10063794 3300026041 Bacteria 2854
67 Ga0207702_10016728 3300026078 Bacteria 6071
68 Ga0207698_10219354 3300026142 Bacteria 1717
69 Ga0209281_1002230 3300027111 Bacteria 8291
70 Ga0209371_1007438 3300027312 Bacteria 3818
71 Ga0209813_10028877 3300027866 Bacteria 1620
72 Ga0268266_10161265 3300028379 Bacteria 2029
73 Ga0268256_1021538 3300030500 Bacteria 1712
74 Ga0307408_100355134 3300031548 Bacteria 1245
75 Ga0439438_040660 3300041405 Bacteria 1208
76 Ga0451787_654008 3300041441 Bacteria 2390
77 Ga0451789_0527437 3300041443 Bacteria 1373
78 Ga0451833_0753147 3300041491 Bacteria 2108
79 Ga0451837_0450117 3300041494 Bacteria 3397
80 Ga0451839_1372946 3300041496 Bacteria 4071
81 Ga0451841_0847481 3300041498 Bacteria 5151
82 Ga0451847_0065384 3300041503 Bacteria 2053
83 Ga0451849_0930887 3300041505 Bacteria 2838
84 Ga0451855_0741662 3300041511 Bacteria 3384
85 Ga0451853_0087006 3300041512 Bacteria 7071
86 Ga0439449_0013106 3300042007 Bacteria 3118
87 Ga0439462_0005866 3300042015 Bacteria 3042
88 Ga0450906_014078 3300042145 Bacteria 1468
89 Ga0450907_020048 3300042146 Bacteria 1122
90 Ga0439434_0044924 3300042435 Bacteria 1362
91 Ga0495638_0002214 3300046460 Bacteria 16188
92 Ga0495638_0004843 3300046460 Bacteria 10139
93 Ga0495605_0030071 3300046474 Bacteria 2788
94 Ga0495585_0003273 3300046492 Bacteria 11024
95 Ga0495585_0084487 3300046492 Bacteria 1717
96 Ga0495607_0013979 3300046501 Bacteria 5242
97 Ga0495606_0002718 3300046507 Bacteria 19948
98 Ga0495610_0001800 3300046512 Bacteria 18666
99 Ga0495610_0027093 3300046512 Bacteria 3052
100 Ga0495620_0000910 3300046515 Bacteria 18178
101 Ga0495631_0122747 3300046518 Bacteria 1117
102 Ga0495632_0019325 3300046519 Bacteria 3715
103 Ga0495643_0001649 3300046522 Bacteria 19641
104 Ga0495648_0037937 3300046524 Bacteria 3091
105 Ga0495597_0042436 3300046542 Bacteria 2028
106 Ga0495633_0072184 3300046558 Bacteria 1610
107 Ga0495625_0024190 3300046660 Bacteria 4627
108 Ga0495661_0090951 3300046665 Bacteria 1736
109 Ga0495649_0012404 3300046694 Bacteria 4957
110 Ga0495660_0003460 3300046810 Bacteria 9752
111 Ga0495681_0077993 3300047470 Bacteria 1485
112 Ga0495686_0002269 3300047472 Bacteria 18532
113 Ga0496100_0019401 3300048903 Bacteria 4056
114 Ga0496101_0056529 3300048904 Bacteria 2837
115 Ga0496101_0553933 3300048904 Unclassified 909
116 Ga0496102_0002742 3300048905 Bacteria 15011
117 Ga0496103_0002573 3300048906 Bacteria 11366
118 Ga0496104_0120373 3300048907 Bacteria 2520
119 Ga0496116_0007414 3300048919 Bacteria 9735
120 Ga0496116_0024159 3300048919 Bacteria 4502
121 Ga0496117_0002594 3300048920 Bacteria 22480
122 Ga0496118_0002871 3300048921 Bacteria 22494
123 Ga0496119_0018460 3300048922 Bacteria 5189
124 Ga0496119_0020666 3300048922 Bacteria 4791
125 Ga0496120_0002148 3300048923 Bacteria 21016
126 Ga0496120_0067534 3300048923 Bacteria 1975
127 Ga0496121_0003414 3300048924 Bacteria 22710
128 Ga0496121_0039640 3300048924 Bacteria 4146
129 Ga0496122_0002187 3300048925 Bacteria 28613
130 Ga0496122_0014917 3300048925 Bacteria 7478
131 Ga0496123_0002071 3300048926 Bacteria 25846
132 Ga0496123_0004496 3300048926 Bacteria 14608
133 Ga0496124_0015732 3300048927 Bacteria 7233
134 Ga0496125_0001448 3300048928 Bacteria 34530
135 Ga0496125_0003070 3300048928 Bacteria 20855
136 Ga0496126_0006426 3300048929 Bacteria 13098
137 Ga0496126_0259149 3300048929 Bacteria 1447
138 Ga0495678_028104 3300049459 Bacteria 2378
139 Ga0500578_0014339 3300053086 Bacteria 5097
140 Ga0500557_001473 3300053105 Bacteria 3856
141 Ga0500569_006823 3300053109 Bacteria 2528
142 Ga0500572_000162 3300053111 Bacteria 23210
143 Ga0500618_000873 3300053125 Bacteria 16100
144 Ga0500618_004467 3300053125 Bacteria 4460
145 Ga0500642_0009401 3300053130 Bacteria 3391
146 Ga0500658_0039971 3300053134 Bacteria 1877
147 Ga0500559_0000201 3300053136 Bacteria 47715
148 Ga0500564_037285 3300053138 Bacteria 2242
149 Ga0500568_0000092 3300053139 Bacteria 84471
150 Ga0500574_000062 3300053141 Bacteria 12353
151 Ga0500616_0005089 3300053153 Bacteria 9073
152 Ga0500616_0021433 3300053153 Bacteria 3623
153 Ga0500622_0000459 3300053156 Bacteria 38656
154 Ga0500622_0001050 3300053156 Bacteria 23016
155 Ga0500639_071502 3300053163 Bacteria 1767
156 Ga0500636_0019625 3300053177 Bacteria 3999
157 Ga0500596_003114 3300053735 Bacteria 3190
158 Ga0500599_000078 3300053736 Bacteria 9372

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046512 Ga0495610_0027093 Ga0495610_0027093_1198_1950 229
2 iso_pu_bacteria 2824679649 2824680723 231
3 3300027312 Ga0209371_1007438 Ga0209371_10074384 233
4 3300030500 Ga0268256_1021538 Ga0268256_10215382 233
5 3300047470 Ga0495681_0077993 Ga0495681_0077993_617_1369 233
6 iso_pu_bacteria 2857349434 2857357226 233
7 3300021327 Ga0214543_1000023 Ga0214543_1000023111 235
8 3300048923 Ga0496120_0067534 Ga0496120_0067534_161_940 235
9 3300048925 Ga0496122_0002187 Ga0496122_0002187_16747_17526 235
10 3300048926 Ga0496123_0002071 Ga0496123_0002071_11088_11867 235
11 3300048928 Ga0496125_0001448 Ga0496125_0001448_22561_23340 235
12 iso_pu_bacteria 2513237159 2514002319 235
13 iso_pu_bacteria 2791355262 2793334788 235
14 iso_pu_bacteria 2842521101 2842527506 235
15 iso_pu_bacteria 2582581307 2585271972 236
16 iso_pu_bacteria 2667528174 2671116829 236
17 iso_pu_bacteria 2818991448 2819611758 236
18 iso_pu_bacteria 2919408235 2919411322 236
19 3300046460 Ga0495638_0002214 Ga0495638_0002214_8135_8911 237
20 3300046492 Ga0495585_0003273 Ga0495585_0003273_7440_8216 237
21 3300046810 Ga0495660_0003460 Ga0495660_0003460_7885_8661 237
22 3300048904 Ga0496101_0553933 Ga0496101_0553933_112_897 237
23 3300048907 Ga0496104_0120373 Ga0496104_0120373_1586_2371 237
24 3300053125 Ga0500618_000873 Ga0500618_000873_7277_8053 237
25 3300053138 Ga0500564_037285 Ga0500564_037285_385_1161 237
26 3300053141 Ga0500574_000062 Ga0500574_000062_8063_8839 237
27 3300009545 Ga0105237_10028882 Ga0105237_100288822 239
28 3300048919 Ga0496116_0024159 Ga0496116_0024159_734_1483 239
29 3300003214 JGI25165J46597_1000274 JGI25165J46597_100027442 240
30 3300005614 Ga0068856_100043125 Ga0068856_1000431254 240
31 3300025233 Ga0209437_100203 Ga0209437_10020330 240
32 3300025261 Ga0209233_1000205 Ga0209233_100020530 240
33 3300026078 Ga0207702_10016728 Ga0207702_100167283 240
34 3300048922 Ga0496119_0020666 Ga0496119_0020666_1590_2342 240
35 iso_pu_bacteria 2857349434 2857353848 240
36 iso_pu_bacteria 2987636660 2987642741 240
37 3300046460 Ga0495638_0004843 Ga0495638_0004843_4264_5139 243
38 iso_pu_bacteria 2519899620 2520376757 243
39 iso_pu_bacteria 2838022645 2838025801 243
40 iso_pu_bacteria 2842198810 2842205311 243
41 iso_pu_bacteria 2842298080 2842303402 243
42 iso_pu_bacteria 2916000859 2916007143 243
43 iso_pu_bacteria 2916041962 2916048328 243
44 iso_pu_bacteria 2524023209 2524462473 244
45 iso_pu_bacteria 2842357229 2842362003 244
46 iso_pu_bacteria 8005314921 8005319919 244
47 iso_pu_bacteria 8005645114 8005647201 244
48 3300041405 Ga0439438_040660 Ga0439438_040660_136_927 245
49 3300042145 Ga0450906_014078 Ga0450906_014078_49_840 245
50 3300042435 Ga0439434_0044924 Ga0439434_0044924_413_1204 245
51 3300053125 Ga0500618_004467 Ga0500618_004467_2064_2930 246
52 3300048924 Ga0496121_0039640 Ga0496121_0039640_3123_3896 248
53 3300048929 Ga0496126_0259149 Ga0496126_0259149_542_1315 248
54 iso_pu_bacteria 2758568016 2758639822 248
55 iso_pu_bacteria 2921296804 2921301823 248
56 3300009545 Ga0105237_10039933 Ga0105237_100399334 250
57 3300010375 Ga0105239_10224449 Ga0105239_102244492 250
58 3300025914 Ga0207671_10287440 Ga0207671_102874402 250
59 3300003578 Ga0006562J51391_1031288 Ga0006562J51391_10312882 252
60 iso_pu_bacteria 2643221610 2644066825 252
61 iso_pu_bacteria 2643221668 2644381270 252
62 iso_pu_bacteria 2643221675 2644417771 252
63 iso_pu_bacteria 2643221680 2644451047 252
64 iso_pu_bacteria 2643221726 2644691734 252
65 iso_pu_bacteria 2917699015 2917701126 252
66 iso_pu_bacteria 2508501127 2509146277 254
67 iso_pu_bacteria 2852387548 2852393853 254
68 iso_pu_bacteria 2961127735 2961134479 254
69 3300003775 Ga0055524_1000407 Ga0055524_100040722 255
70 3300025299 Ga0209256_1000228 Ga0209256_100022869 255
71 iso_pu_bacteria 2510065057 2510308288 255
72 iso_pu_bacteria 2513237143 2513907022 255
73 iso_pu_bacteria 2551306089 2551714027 255
74 iso_pu_bacteria 2916048683 2916054497 255
75 iso_pu_bacteria 2916076590 2916081888 255
76 iso_pu_bacteria 2921201388 2921208011 255
77 iso_pu_bacteria 2921244191 2921250270 255
78 iso_pu_bacteria 2937009748 2937015349 255
79 iso_pu_bacteria 2937106411 2937106673 255
80 iso_pu_bacteria 2957464669 2957470297 255
81 iso_pu_bacteria 2960610863 2960616430 255
82 iso_pu_bacteria 2964621998 2964622336 255
83 iso_pu_bacteria 2964649959 2964655415 255
84 iso_pu_bacteria 2967664464 2967664732 255
85 iso_pu_bacteria 2967693043 2967699169 255
86 iso_pu_bacteria 2967714385 2967720199 255
87 iso_pu_bacteria 2967721400 2967728070 255
88 iso_pu_bacteria 2970095765 2970102307 255
89 3300003354 JGI25160J50197_1001099 JGI25160J50197_100109911 256
90 3300003790 Ga0055528_1006179 Ga0055528_10061793 256
91 3300004625 Ga0055543_1000389 Ga0055543_100038919 256
92 3300005262 Ga0065165_1006787 Ga0065165_10067874 256
93 3300025302 Ga0207426_1000035 Ga0207426_1000035411 256
94 3300041505 Ga0451849_0930887 Ga0451849_0930887_1005_1856 256
95 iso_pu_bacteria 2515154107 2515610842 256
96 iso_pu_bacteria 2791355082 2792584867 256
97 iso_pu_bacteria 2936996657 2937002191 256
98 3300003771 Ga0055526_1010636 Ga0055526_10106362 257
99 3300003775 Ga0055524_1018781 Ga0055524_10187812 257
100 3300003790 Ga0055528_1000913 Ga0055528_10009136 257
101 3300005539 Ga0068853_100003983 Ga0068853_1000039835 257
102 3300005983 Ga0081540_1093155 Ga0081540_10931552 257
103 3300025273 Ga0209673_1001733 Ga0209673_100173311 257
104 3300025273 Ga0209673_1001887 Ga0209673_100188715 257
105 3300025295 Ga0209564_1002117 Ga0209564_100211715 257
106 3300025297 Ga0209758_1008357 Ga0209758_10083575 257
107 3300025299 Ga0209256_1002174 Ga0209256_100217415 257
108 3300026041 Ga0207639_10063794 Ga0207639_100637943 257
109 3300041441 Ga0451787_654008 Ga0451787_654008_1484_2335 257
110 3300041443 Ga0451789_0527437 Ga0451789_0527437_443_1294 257
111 3300041491 Ga0451833_0753147 Ga0451833_0753147_393_1244 257
112 3300041494 Ga0451837_0450117 Ga0451837_0450117_2337_3188 257
113 3300041503 Ga0451847_0065384 Ga0451847_0065384_904_1755 257
114 3300041511 Ga0451855_0741662 Ga0451855_0741662_1531_2382 257
115 3300041512 Ga0451853_0087006 Ga0451853_0087006_3024_3875 257
116 3300046474 Ga0495605_0030071 Ga0495605_0030071_1330_2181 257
117 3300046492 Ga0495585_0084487 Ga0495585_0084487_360_1211 257
118 3300046501 Ga0495607_0013979 Ga0495607_0013979_4247_5098 257
119 3300046507 Ga0495606_0002718 Ga0495606_0002718_4263_5114 257
120 3300046512 Ga0495610_0001800 Ga0495610_0001800_4416_5267 257
121 3300046515 Ga0495620_0000910 Ga0495620_0000910_2227_3078 257
122 3300046519 Ga0495632_0019325 Ga0495632_0019325_1121_1972 257
123 3300046522 Ga0495643_0001649 Ga0495643_0001649_15094_15945 257
124 3300046542 Ga0495597_0042436 Ga0495597_0042436_944_1795 257
125 3300046558 Ga0495633_0072184 Ga0495633_0072184_135_986 257
126 3300046660 Ga0495625_0024190 Ga0495625_0024190_1499_2350 257
127 3300046665 Ga0495661_0090951 Ga0495661_0090951_53_904 257
128 3300046694 Ga0495649_0012404 Ga0495649_0012404_2760_3611 257
129 3300047472 Ga0495686_0002269 Ga0495686_0002269_13617_14468 257
130 3300049459 Ga0495678_028104 Ga0495678_028104_1262_2113 257
131 3300053086 Ga0500578_0014339 Ga0500578_0014339_2868_3719 257
132 3300053109 Ga0500569_006823 Ga0500569_006823_1345_2196 257
133 3300053134 Ga0500658_0039971 Ga0500658_0039971_939_1790 257
134 3300053153 Ga0500616_0005089 Ga0500616_0005089_239_1090 257
135 iso_pu_bacteria 2558860100 2558860859 258
136 3300003323 rootH1_10248531 rootH1_102485313 259
137 3300006946 Ga0079104_1008962 Ga0079104_10089624 259
138 3300027111 Ga0209281_1002230 Ga0209281_10022308 259
139 3300042146 Ga0450907_020048 Ga0450907_020048_81_923 259
140 iso_pu_bacteria 2643221734 2644737865 259
141 iso_pu_bacteria 2935827899 2935835890 260
142 3300003320 rootH2_10186764 rootH2_101867642 261
143 3300046518 Ga0495631_0122747 Ga0495631_0122747_115_966 261
144 3300053105 Ga0500557_001473 Ga0500557_001473_2410_3261 261
145 3300053111 Ga0500572_000162 Ga0500572_000162_16106_16924 261
146 3300053136 Ga0500559_0000201 Ga0500559_0000201_23072_23890 261
147 3300053139 Ga0500568_0000092 Ga0500568_0000092_21114_21965 261
148 3300053153 Ga0500616_0021433 Ga0500616_0021433_616_1467 261
149 3300053163 Ga0500639_071502 Ga0500639_071502_24_842 261
150 3300053735 Ga0500596_003114 Ga0500596_003114_1789_2607 261
151 iso_pu_bacteria 3005409236 3005410065 261
152 iso_pu_bacteria 2791355264 2793345217 262
153 iso_pu_bacteria 2791355265 2793356991 262
154 iso_pu_bacteria 2842192696 2842193599 262
155 iso_pu_bacteria 2937071275 2937072272 262
156 3300041496 Ga0451839_1372946 Ga0451839_1372946_182_1033 263
157 3300041498 Ga0451841_0847481 Ga0451841_0847481_3813_4664 263
158 iso_pu_bacteria 2599185170 2599416159 263
159 iso_pu_bacteria 2775506902 2776267419 263
160 iso_pu_bacteria 2775506904 2776280151 263
161 iso_pu_bacteria 2838035591 2838036281 263
162 iso_pu_bacteria 2838661181 2838666560 263
163 iso_pu_bacteria 2933016740 2933019636 263
164 3300005262 Ga0065165_1001405 Ga0065165_100140515 264
165 3300013105 Ga0157369_10056421 Ga0157369_100564212 264
166 3300025230 Ga0209563_101954 Ga0209563_1019543 264
167 3300025302 Ga0207426_1000552 Ga0207426_10005528 264
168 3300046524 Ga0495648_0037937 Ga0495648_0037937_1933_2820 264
169 3300053130 Ga0500642_0009401 Ga0500642_0009401_509_1354 264
170 3300053156 Ga0500622_0001050 Ga0500622_0001050_6567_7454 264
171 3300053736 Ga0500599_000078 Ga0500599_000078_1943_2830 264
172 iso_pu_bacteria 2847670302 2847670423 264
173 iso_pu_bacteria 2856364286 2856371756 264
174 iso_pu_bacteria 2869285874 2869289319 264
175 iso_pu_bacteria 2871429161 2871431387 264
176 iso_pu_bacteria 2874146452 2874154523 264
177 iso_pu_bacteria 2874155637 2874161910 264
178 iso_pu_bacteria 2876413966 2876420093 264
179 iso_pu_bacteria 2878745973 2878747991 264
180 iso_pu_bacteria 2889914905 2889918355 264
181 iso_pu_bacteria 2903492973 2903505639 264
182 iso_pu_bacteria 2906308376 2906311609 264
183 iso_pu_bacteria 2906321335 2906323349 264
184 iso_pu_bacteria 2937813078 2937818572 264
185 iso_pu_bacteria 2958064165 2958064634 264
186 iso_pu_bacteria 2958130278 2958133695 264
187 iso_pu_bacteria 2958179912 2958183339 264
188 iso_pu_bacteria 2961077736 2961081306 264
189 iso_pu_bacteria 2977843712 2977850679 264
190 iso_pu_bacteria 2977942078 2977949427 264
191 iso_pu_bacteria 2987636660 2987644617 264
192 iso_pu_bacteria 3004203850 3004210921 264
193 iso_pu_bacteria 8004387939 8004391198 264
194 iso_pu_bacteria 8004714634 8004716569 264
195 iso_pu_bacteria 8005682033 8005687119 267
196 3300053156 Ga0500622_0000459 Ga0500622_0000459_16581_17456 269
197 iso_pu_bacteria 2509276033 2509441457 269
198 iso_pu_bacteria 8005563573 8005566113 269
199 iso_pu_bacteria 8024479707 8024485153 269
200 3300053177 Ga0500636_0019625 Ga0500636_0019625_2672_3520 270
201 iso_pu_bacteria 2509276021 2509386095 270
202 iso_pu_bacteria 2513237085 2513581287 270
203 iso_pu_bacteria 2516653085 2517080604 270
204 iso_pu_bacteria 2585427528 2585543485 270
205 iso_pu_bacteria 2585427593 2585840942 270
206 iso_pu_bacteria 2615840624 2616298344 270
207 iso_pu_bacteria 2718217882 2719185043 270
208 iso_pu_bacteria 2718218009 2719729062 270
209 iso_pu_bacteria 2718218363 2721144754 270
210 iso_pu_bacteria 2718218366 2721162119 270
211 iso_pu_bacteria 2721755514 2722843264 270
212 iso_pu_bacteria 2721755810 2724042087 270
213 iso_pu_bacteria 2724679232 2725948762 270
214 iso_pu_bacteria 2728369365 2730161158 270
215 iso_pu_bacteria 2738541333 2739033491 270
216 iso_pu_bacteria 2802429634 2806053829 270
217 iso_pu_bacteria 2802429635 2806060079 270
218 iso_pu_bacteria 2802429636 2806065866 270
219 iso_pu_bacteria 2802429637 2806075395 270
220 iso_pu_bacteria 2838686498 2838693892 270
221 iso_pu_bacteria 2838729681 2838733259 270
222 iso_pu_bacteria 2838742623 2838749368 270
223 iso_pu_bacteria 2841851746 2841858612 270
224 iso_pu_bacteria 2842156927 2842163394 270
225 iso_pu_bacteria 2842180545 2842187095 270
226 iso_pu_bacteria 2842229732 2842236685 270
227 iso_pu_bacteria 2842243621 2842250369 270
228 iso_pu_bacteria 2842257432 2842264243 270
229 iso_pu_bacteria 2842271015 2842278409 270
230 iso_pu_bacteria 2842304105 2842307262 270
231 iso_pu_bacteria 2842317721 2842319708 270
232 iso_pu_bacteria 2842495871 2842501597 270
233 iso_pu_bacteria 2844454524 2844460041 270
234 iso_pu_bacteria 2915986958 2915993356 270
235 iso_pu_bacteria 2916035215 2916041189 270
236 iso_pu_bacteria 2921282425 2921282811 270
237 iso_pu_bacteria 2924144063 2924148613 270
238 iso_pu_bacteria 2924158325 2924165261 270
239 iso_pu_bacteria 2924179722 2924185925 270
240 iso_pu_bacteria 2924200457 2924206477 270
241 iso_pu_bacteria 2933570622 2933574082 270
242 iso_pu_bacteria 2937098957 2937100029 270
243 iso_pu_bacteria 2960584000 2960584968 270
244 iso_pu_bacteria 2960667422 2960672970 270
245 iso_pu_bacteria 2964643177 2964648647 270
246 iso_pu_bacteria 2964670856 2964676999 270
247 iso_pu_bacteria 2964685014 2964691805 270
248 iso_pu_bacteria 2964698721 2964704212 270
249 iso_pu_bacteria 2967678726 2967679774 270
250 iso_pu_bacteria 2967742019 2967748272 270
251 iso_pu_bacteria 2967748971 2967755189 270
252 iso_pu_bacteria 2967769361 2967775167 270
253 iso_pu_bacteria 2970019648 2970021011 270
254 iso_pu_bacteria 2970129317 2970135184 270
255 iso_pu_bacteria 2970156795 2970157224 270
256 iso_pu_bacteria 2977516862 2977523774 270
257 iso_pu_bacteria 2977537788 2977544297 270
258 iso_pu_bacteria 2977551784 2977558201 270
259 iso_pu_bacteria 2977558990 2977559403 270
260 iso_pu_bacteria 2977565890 2977569421 270
261 iso_pu_bacteria 8005301065 8005307258 270
262 iso_pu_bacteria 2524023207 2524449525 271
263 iso_pu_bacteria 2582581283 2585166898 271
264 iso_pu_bacteria 2582581308 2585277702 271
265 iso_pu_bacteria 2582581315 2585326736 271
266 iso_pu_bacteria 2585427527 2585533430 271
267 iso_pu_bacteria 2585427530 2585557263 271
268 iso_pu_bacteria 2599185352 2600195116 271
269 iso_pu_bacteria 2615840626 2616310619 271
270 iso_pu_bacteria 2643221626 2644146216 271
271 iso_pu_bacteria 2643221655 2644307954 271
272 iso_pu_bacteria 2643221659 2644333681 271
273 iso_pu_bacteria 2643221688 2644493942 271
274 iso_pu_bacteria 2643221698 2644541951 271
275 iso_pu_bacteria 2643221712 2644614108 271
276 iso_pu_bacteria 2690316117 2692318258 271
277 iso_pu_bacteria 2791355094 2792640886 271
278 iso_pu_bacteria 2818991453 2819643075 271
279 iso_pu_bacteria 2847417321 2847423236 271
280 iso_pu_bacteria 2848992105 2848997369 271
281 iso_pu_bacteria 2855872281 2855874225 271
282 iso_pu_bacteria 2871495908 2871500976 271
283 iso_pu_bacteria 2878760144 2878765013 271
284 iso_pu_bacteria 2878767105 2878772165 271
285 iso_pu_bacteria 2903540706 2903545793 271
286 iso_pu_bacteria 2937994558 2937999643 271
287 iso_pu_bacteria 2941499720 2941506143 271
288 iso_pu_bacteria 2958092219 2958099843 271
289 iso_pu_bacteria 2958165035 2958170114 271
290 iso_pu_bacteria 2961163497 2961168568 271
291 iso_pu_bacteria 2965018300 2965023389 271
292 iso_pu_bacteria 2968171901 2968176979 271
293 iso_pu_bacteria 2970554993 2970559861 271
294 iso_pu_bacteria 2987659509 2987664595 271
295 iso_pu_bacteria 3004188549 3004193647 271
296 iso_pu_bacteria 643692032 643822915 271
297 iso_pu_bacteria 8049293176 8049297812 271
298 3300031548 Ga0307408_100355134 Ga0307408_1003551342 272
299 3300002773 JGI25152J39213_1007295 JGI25152J39213_10072952 274
300 3300003187 JGI25151J46595_10000610 JGI25151J46595_1000061019 274
301 3300003215 JGI25153J46596_10001161 JGI25153J46596_100011619 274
302 3300003771 Ga0055526_1001246 Ga0055526_100124614 274
303 3300003775 Ga0055524_1001340 Ga0055524_10013408 274
304 3300003790 Ga0055528_1003230 Ga0055528_10032309 274
305 3300005262 Ga0065165_1010118 Ga0065165_10101181 274
306 3300005578 Ga0068854_100043950 Ga0068854_1000439502 274
307 3300005616 Ga0068852_100303390 Ga0068852_1003033901 274
308 3300006042 Ga0075368_10071455 Ga0075368_100714552 274
309 3300009093 Ga0105240_10000376 Ga0105240_1000037648 274
310 3300009545 Ga0105237_10001377 Ga0105237_1000137724 274
311 3300009551 Ga0105238_10514616 Ga0105238_105146162 274
312 3300013104 Ga0157370_10002238 Ga0157370_1000223810 274
313 3300015262 Ga0182007_10001179 Ga0182007_100011794 274
314 3300015265 Ga0182005_1018439 Ga0182005_10184392 274
315 3300025245 Ga0207425_1000729 Ga0207425_10007299 274
316 3300025253 Ga0209677_100218 Ga0209677_10021833 274
317 3300025258 Ga0209129_1001049 Ga0209129_100104910 274
318 3300025261 Ga0209233_1000097 Ga0209233_1000097219 274
319 3300025273 Ga0209673_1000212 Ga0209673_10002128 274
320 3300025291 Ga0209675_1019650 Ga0209675_10196502 274
321 3300025294 Ga0209025_1000300 Ga0209025_10003008 274
322 3300025295 Ga0209564_1000402 Ga0209564_10004028 274
323 3300025297 Ga0209758_1002186 Ga0209758_100218615 274
324 3300025299 Ga0209256_1000678 Ga0209256_100067831 274
325 3300025303 Ga0209051_1012512 Ga0209051_10125122 274
326 3300025913 Ga0207695_10000495 Ga0207695_1000049532 274
327 3300025914 Ga0207671_10000568 Ga0207671_100005689 274
328 3300025914 Ga0207671_10158332 Ga0207671_101583322 274
329 3300025981 Ga0207640_10041159 Ga0207640_100411593 274
330 3300026142 Ga0207698_10219354 Ga0207698_102193542 274
331 3300027866 Ga0209813_10028877 Ga0209813_100288772 274
332 3300028379 Ga0268266_10161265 Ga0268266_101612652 274
333 3300042007 Ga0439449_0013106 Ga0439449_0013106_1365_2231 274
334 3300042015 Ga0439462_0005866 Ga0439462_0005866_361_1227 274
335 3300048903 Ga0496100_0019401 Ga0496100_0019401_2804_3670 274
336 3300048904 Ga0496101_0056529 Ga0496101_0056529_258_1124 274
337 3300048905 Ga0496102_0002742 Ga0496102_0002742_2538_3404 274
338 3300048906 Ga0496103_0002573 Ga0496103_0002573_7283_8149 274
339 3300048919 Ga0496116_0007414 Ga0496116_0007414_8423_9289 274
340 3300048920 Ga0496117_0002594 Ga0496117_0002594_9130_9996 274
341 3300048921 Ga0496118_0002871 Ga0496118_0002871_9144_10010 274
342 3300048922 Ga0496119_0018460 Ga0496119_0018460_3147_4013 274
343 3300048923 Ga0496120_0002148 Ga0496120_0002148_11744_12610 274
344 3300048924 Ga0496121_0003414 Ga0496121_0003414_13337_14203 274
345 3300048925 Ga0496122_0014917 Ga0496122_0014917_853_1719 274
346 3300048926 Ga0496123_0004496 Ga0496123_0004496_8097_8963 274
347 3300048927 Ga0496124_0015732 Ga0496124_0015732_4148_5014 274
348 3300048928 Ga0496125_0003070 Ga0496125_0003070_11641_12507 274
349 3300048929 Ga0496126_0006426 Ga0496126_0006426_8085_8951 274
350 iso_pu_bacteria 2977864932 2977868631 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

114

298

0.84

Feature Viewer

pLDDT pTM Quality
61.06 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map