F417893

General Info

Members Datasets Scaffolds Average Seq Length
349 186 349 110

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_11108381|Ga0157369_111083811
Length 131
Sequence VVGAFVHIRLPVADVPCEARGMPPNTVQPPYDQFLATAEAVALERPEVDLELAREVFLEVATLLYNGLALDGLDEHDANAVVAGLCVDLVTDDPGAAVRARSQATLEVPGDLHDPEGVSRVYLISAAILKL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
118 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
119 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
122 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 19.77
Rhizosphere 75.93
Stem 0
Stem Tuber 0
Unclassified 3.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10293964 3300005327 Bacteria 1384
2 Ga0070658_10997872 3300005327 Unclassified 728
3 Ga0070683_100010577 3300005329 Bacteria 7931
4 Ga0070683_100206075 3300005329 Bacteria 1868
5 Ga0070683_100206457 3300005329 Bacteria 1866
6 Ga0070683_100371264 3300005329 Bacteria 1363
7 Ga0070670_100311840 3300005331 Bacteria 1377
8 Ga0070666_11521151 3300005335 Unclassified 501
9 Ga0070680_100107870 3300005336 Bacteria 2316
10 Ga0070682_100023048 3300005337 Bacteria 3695
11 Ga0070682_100394465 3300005337 Bacteria 1045
12 Ga0070682_100998601 3300005337 Bacteria 694
13 Ga0068868_101132028 3300005338 Unclassified 721
14 Ga0070660_100010467 3300005339 Bacteria 6556
15 Ga0070661_100361725 3300005344 Bacteria 1141
16 Ga0070668_101159045 3300005347 Unclassified 699
17 Ga0070675_100543337 3300005354 Bacteria 1050
18 Ga0070674_100305245 3300005356 Bacteria 1270
19 Ga0070673_101450932 3300005364 Bacteria 646
20 Ga0070659_100028278 3300005366 Bacteria 4328
21 Ga0070659_100263581 3300005366 Bacteria 1430
22 Ga0070659_100511754 3300005366 Bacteria 1024
23 Ga0070667_102040263 3300005367 Unclassified 540
24 Ga0070709_11689684 3300005434 Unclassified 517
25 Ga0070714_101275268 3300005435 Bacteria 717
26 Ga0070713_101031607 3300005436 Bacteria 794
27 Ga0070678_100746592 3300005456 Bacteria 885
28 Ga0070662_100946315 3300005457 Bacteria 736
29 Ga0070685_10585143 3300005466 Bacteria 801
30 Ga0070679_100524942 3300005530 Unclassified 1128
31 Ga0070679_101315810 3300005530 Bacteria 668
32 Ga0070684_100183857 3300005535 Bacteria 1901
33 Ga0070684_100432739 3300005535 Unclassified 1215
34 Ga0070684_100466925 3300005535 Bacteria 1167
35 Ga0070684_101680702 3300005535 Bacteria 599
36 Ga0068853_100314345 3300005539 Bacteria 1451
37 Ga0070686_100106776 3300005544 Bacteria 1901
38 Ga0070686_100778737 3300005544 Unclassified 769
39 Ga0070693_100143970 3300005547 Bacteria 1503
40 Ga0070693_100292182 3300005547 Bacteria 1095
41 Ga0070665_100511933 3300005548 Bacteria 1212
42 Ga0070665_101203776 3300005548 Bacteria 768
43 Ga0068855_100443250 3300005563 Unclassified 1418
44 Ga0068855_101589793 3300005563 Unclassified 669
45 Ga0068855_101792677 3300005563 Unclassified 624
46 Ga0070664_101408592 3300005564 Bacteria 659
47 Ga0068857_100095323 3300005577 Bacteria 2666
48 Ga0068857_101607871 3300005577 Bacteria 634
49 Ga0068857_102063972 3300005577 Unclassified 559
50 Ga0068856_100030864 3300005614 Bacteria 5241
51 Ga0068856_101539348 3300005614 Bacteria 679
52 Ga0070702_100691741 3300005615 Bacteria 776
53 Ga0068852_100162580 3300005616 Bacteria 2086
54 Ga0068864_100213961 3300005618 Bacteria 1776
55 Ga0068864_100525579 3300005618 Bacteria 1141
56 Ga0068866_10225932 3300005718 Unclassified 1132
57 Ga0068866_10731323 3300005718 Unclassified 682
58 Ga0068861_100426919 3300005719 Bacteria 1182
59 Ga0068851_10154436 3300005834 Bacteria 1257
60 Ga0068851_10950212 3300005834 Unclassified 540
61 Ga0068870_11088427 3300005840 Bacteria 574
62 Ga0068863_100556814 3300005841 Bacteria 1132
63 Ga0068858_100813796 3300005842 Bacteria 912
64 Ga0068858_101145331 3300005842 Bacteria 764
65 Ga0068862_100543124 3300005844 Bacteria 1109
66 Ga0075365_10025856 3300006038 Bacteria 3720
67 Ga0075365_11029808 3300006038 Bacteria 580
68 Ga0075432_10325429 3300006058 Bacteria 645
69 Ga0070712_100163103 3300006175 Bacteria 1723
70 Ga0075428_100796149 3300006844 Bacteria 1005
71 Ga0068865_100334473 3300006881 Unclassified 1222
72 Ga0105240_10733775 3300009093 Bacteria 1075
73 Ga0111539_10056168 3300009094 Bacteria 4680
74 Ga0105245_10001722 3300009098 Bacteria 19953
75 Ga0105245_10115674 3300009098 Bacteria 2499
76 Ga0105245_10385392 3300009098 Bacteria 1397
77 Ga0105245_10401946 3300009098 Bacteria 1369
78 Ga0105245_11387289 3300009098 Unclassified 752
79 Ga0105245_11999705 3300009098 Bacteria 633
80 Ga0105247_11556264 3300009101 Unclassified 541
81 Ga0105243_10150801 3300009148 Bacteria 1994
82 Ga0105243_10234823 3300009148 Bacteria 1629
83 Ga0105243_10329720 3300009148 Bacteria 1394
84 Ga0105243_12183634 3300009148 Unclassified 590
85 Ga0105243_12823481 3300009148 Bacteria 526
86 Ga0105237_10095320 3300009545 Bacteria 2965
87 Ga0105237_12110175 3300009545 Bacteria 573
88 Ga0105238_10357954 3300009551 Bacteria 1449
89 Ga0105238_10474680 3300009551 Bacteria 1250
90 Ga0105238_11349789 3300009551 Unclassified 740
91 Ga0105249_10194220 3300009553 Bacteria 1983
92 Ga0105249_10197790 3300009553 Bacteria 1965
93 Ga0105249_12017415 3300009553 Unclassified 650
94 Ga0105239_10001349 3300010375 Bacteria 33078
95 Ga0105246_10004154 3300011119 Bacteria 8796
96 Ga0105246_10249743 3300011119 Bacteria 1407
97 Ga0105246_10747677 3300011119 Bacteria 862
98 Ga0105246_11061883 3300011119 Bacteria 737
99 Ga0157370_12129810 3300013104 Unclassified 502
100 Ga0157369_10024241 3300013105 Bacteria 6754
101 Ga0157369_10130481 3300013105 Bacteria 2664
102 Ga0157369_10330623 3300013105 Bacteria 1584
103 Ga0157369_11108381 3300013105 Bacteria 809
104 Ga0157369_12106379 3300013105 Bacteria 572
105 Ga0157378_11689358 3300013297 Bacteria 680
106 Ga0163162_10024710 3300013306 Bacteria 5934
107 Ga0163162_10505465 3300013306 Bacteria 1339
108 Ga0163162_10938472 3300013306 Bacteria 977
109 Ga0157372_10333735 3300013307 Bacteria 1766
110 Ga0157372_10337220 3300013307 Bacteria 1756
111 Ga0157372_10744544 3300013307 Bacteria 1140
112 Ga0157372_12586004 3300013307 Bacteria 583
113 Ga0157375_10008571 3300013308 Bacteria 8952
114 Ga0157375_10046518 3300013308 Bacteria 4232
115 Ga0157375_10573084 3300013308 Bacteria 1289
116 Ga0157375_12065663 3300013308 Bacteria 678
117 Ga0157375_12608034 3300013308 Bacteria 604
118 Ga0163163_10527076 3300014325 Bacteria 1244
119 Ga0163163_11046678 3300014325 Unclassified 879
120 Ga0163163_11406279 3300014325 Bacteria 759
121 Ga0157380_10286372 3300014326 Bacteria 1510
122 Ga0157377_10187554 3300014745 Bacteria 1305
123 Ga0157377_10335815 3300014745 Bacteria 1009
124 Ga0157379_10065021 3300014968 Bacteria 3260
125 Ga0157379_10378989 3300014968 Bacteria 1298
126 Ga0157376_10979238 3300014969 Bacteria 867
127 Ga0163161_10206524 3300017792 Bacteria 1515
128 Ga0163161_10268585 3300017792 Bacteria 1334
129 Ga0163161_10747523 3300017792 Unclassified 818
130 Ga0163161_10994715 3300017792 Bacteria 716
131 Ga0197907_11264205 3300020069 Unclassified 536
132 Ga0206353_10952417 3300020082 Unclassified 1298
133 Ga0213876_10066040 3300021384 Bacteria 1910
134 Ga0207642_10634893 3300025899 Unclassified 668
135 Ga0207688_10030686 3300025901 Bacteria 2964
136 Ga0207647_10333077 3300025904 Bacteria 861
137 Ga0207705_10416872 3300025909 Bacteria 1039
138 Ga0207705_10689251 3300025909 Unclassified 794
139 Ga0207660_10087920 3300025917 Bacteria 2297
140 Ga0207657_10005803 3300025919 Bacteria 12864
141 Ga0207649_10348317 3300025920 Bacteria 1096
142 Ga0207652_10033306 3300025921 Bacteria 4338
143 Ga0207652_10776601 3300025921 Unclassified 852
144 Ga0207652_10998663 3300025921 Bacteria 736
145 Ga0207694_10720563 3300025924 Bacteria 841
146 Ga0207687_10108872 3300025927 Bacteria 2052
147 Ga0207687_10286874 3300025927 Bacteria 1321
148 Ga0207687_11362157 3300025927 Unclassified 610
149 Ga0207687_11763762 3300025927 Unclassified 530
150 Ga0207664_11079771 3300025929 Bacteria 718
151 Ga0207690_10154487 3300025932 Bacteria 1704
152 Ga0207709_10268733 3300025935 Bacteria 1254
153 Ga0207709_11728688 3300025935 Unclassified 520
154 Ga0207669_10292110 3300025937 Bacteria 1235
155 Ga0207704_10287240 3300025938 Unclassified 1253
156 Ga0207691_10289588 3300025940 Bacteria 1408
157 Ga0207711_10091413 3300025941 Bacteria 2677
158 Ga0207661_10014311 3300025944 Bacteria 5812
159 Ga0207661_10101107 3300025944 Bacteria 2421
160 Ga0207661_10479235 3300025944 Bacteria 1136
161 Ga0207661_10568888 3300025944 Bacteria 1039
162 Ga0207661_11920398 3300025944 Unclassified 538
163 Ga0207679_10231131 3300025945 Bacteria 1561
164 Ga0207668_11303374 3300025972 Unclassified 654
165 Ga0207703_11633493 3300026035 Bacteria 620
166 Ga0207702_10170493 3300026078 Bacteria 1995
167 Ga0207702_11213807 3300026078 Bacteria 748
168 Ga0207641_10383710 3300026088 Bacteria 1346
169 Ga0207676_10443826 3300026095 Bacteria 1222
170 Ga0207674_11915449 3300026116 Unclassified 559
171 Ga0207675_100883546 3300026118 Unclassified 909
172 Ga0207683_10355054 3300026121 Bacteria 1346
173 Ga0207698_11472384 3300026142 Bacteria 696
174 Ga0207698_12423621 3300026142 Bacteria 536
175 Ga0207428_10359229 3300027907 Bacteria 1071
176 Ga0268265_10455482 3300028380 Bacteria 1196
177 Ga0316575_10241152 3300031665 Unclassified 757
178 Ga0316578_10862565 3300031728 Bacteria 523
179 Ga0316577_10014350 3300031733 Bacteria 4348
180 Ga0307413_11237438 3300031824 Bacteria 651
181 Ga0307410_10042082 3300031852 Bacteria 3017
182 Ga0307406_10061568 3300031901 Unclassified 2424
183 Ga0307406_10582901 3300031901 Bacteria 920
184 Ga0307407_10303580 3300031903 Bacteria 1114
185 Ga0307407_10889218 3300031903 Bacteria 683
186 Ga0307409_100005330 3300031995 Bacteria 7384
187 Ga0307409_100301092 3300031995 Bacteria 1492
188 Ga0307409_100304850 3300031995 Unclassified 1483
189 Ga0307416_100640911 3300032002 Unclassified 1146
190 Ga0307416_101120459 3300032002 Bacteria 892
191 Ga0307416_101237092 3300032002 Bacteria 852
192 Ga0307416_102276050 3300032002 Bacteria 643
193 Ga0307416_102297424 3300032002 Unclassified 640
194 Ga0307415_100228651 3300032126 Unclassified 1496
195 Ga0316580_10017959 3300032139 Bacteria 2176
196 Ga0316574_0069181 3300035398 Bacteria 2227
197 Ga0373931_0329385 3300035691 Bacteria 951
198 Ga0316584_0255852 3300036712 Bacteria 1278
199 Ga0436365_1297167 3300039437 Bacteria 2434
200 Ga0436365_1374999 3300039437 Bacteria 1918
201 Ga0436365_1465922 3300039437 Bacteria 1045
202 Ga0439436_0038467 3300041404 Bacteria 1376
203 Ga0439436_0225624 3300041404 Bacteria 540
204 Ga0451802_2059427 3300041460 Unclassified 540
205 Ga0451841_0613821 3300041498 Unclassified 965
206 Ga0451853_0823676 3300041512 Bacteria 803
207 Ga0451853_0884934 3300041512 Unclassified 601
208 Ga0451853_3014048 3300041512 Bacteria 560
209 Ga0439457_025652 3300042014 Bacteria 1304
210 Ga0439462_0093986 3300042015 Bacteria 823
211 Ga0466972_0479137 3300044658 Bacteria 585
212 Ga0466965_0200588 3300044683 Bacteria 1058
213 Ga0466966_0144652 3300044684 Bacteria 1452
214 Ga0466961_0881414 3300044693 Bacteria 533
215 Ga0466964_0036721 3300044706 Bacteria 1966
216 Ga0466970_0571749 3300044765 Bacteria 654
217 Ga0466960_0055198 3300044901 Bacteria 1931
218 Ga0466960_0178884 3300044901 Bacteria 1149
219 Ga0466960_0408927 3300044901 Bacteria 783
220 Ga0466960_0849192 3300044901 Bacteria 555
221 Ga0451576_0783060 3300045051 Bacteria 1002
222 Ga0466958_0378966 3300045836 Bacteria 912
223 Ga0466967_0057288 3300045976 Bacteria 3439
224 Ga0466967_0876541 3300045976 Bacteria 892
225 Ga0466967_1006178 3300045976 Bacteria 830
226 Ga0466967_1238593 3300045976 Bacteria 743
227 Ga0466967_1389188 3300045976 Bacteria 699
228 Ga0466967_2111468 3300045976 Unclassified 560
229 Ga0466967_2605411 3300045976 Bacteria 500
230 Ga0495656_0293128 3300046615 Bacteria 832
231 Ga0495604_0661149 3300047317 Bacteria 666
232 Ga0495604_1046275 3300047317 Bacteria 503
233 Ga0495676_1049700 3300047321 Unclassified 519
234 Ga0495676_1116173 3300047321 Bacteria 501
235 Ga0495677_0369439 3300047445 Unclassified 567
236 Ga0496100_0129256 3300048903 Bacteria 1777
237 Ga0496100_0144924 3300048903 Unclassified 1688
238 Ga0496100_0396490 3300048903 Bacteria 1050
239 Ga0496100_1549370 3300048903 Unclassified 524
240 Ga0496101_0065131 3300048904 Bacteria 2656
241 Ga0496101_0102035 3300048904 Bacteria 2149
242 Ga0496101_0191570 3300048904 Bacteria 1578
243 Ga0496101_0556514 3300048904 Bacteria 907
244 Ga0496102_0001614 3300048905 Bacteria 19876
245 Ga0496102_0040032 3300048905 Bacteria 4238
246 Ga0496102_0193257 3300048905 Bacteria 1918
247 Ga0496102_0470231 3300048905 Bacteria 1178
248 Ga0496102_1207001 3300048905 Bacteria 676
249 Ga0496103_0007504 3300048906 Bacteria 6498
250 Ga0496103_0122947 3300048906 Bacteria 1654
251 Ga0496104_0218822 3300048907 Bacteria 1816
252 Ga0496104_0641427 3300048907 Bacteria 971
253 Ga0496104_0641482 3300048907 Bacteria 971
254 Ga0496104_1011878 3300048907 Bacteria 735
255 Ga0496105_0001223 3300048908 Bacteria 17907
256 Ga0496105_0059220 3300048908 Bacteria 3161
257 Ga0496105_0212913 3300048908 Unclassified 1574
258 Ga0496105_0766275 3300048908 Bacteria 736
259 Ga0496105_1216767 3300048908 Unclassified 554
260 Ga0496106_0092285 3300048909 Bacteria 2339
261 Ga0496106_0156179 3300048909 Unclassified 1802
262 Ga0496107_0037831 3300048910 Bacteria 3463
263 Ga0496107_0078200 3300048910 Bacteria 2410
264 Ga0496107_0144343 3300048910 Bacteria 1760
265 Ga0496107_0229229 3300048910 Bacteria 1382
266 Ga0496108_0032472 3300048911 Bacteria 4336
267 Ga0496108_0198417 3300048911 Bacteria 1741
268 Ga0496108_0547530 3300048911 Bacteria 1010
269 Ga0496108_0623466 3300048911 Bacteria 939
270 Ga0496109_0009202 3300048912 Bacteria 8414
271 Ga0496109_0057438 3300048912 Bacteria 3552
272 Ga0496109_0069340 3300048912 Bacteria 3233
273 Ga0496109_0205448 3300048912 Unclassified 1852
274 Ga0496109_0521998 3300048912 Unclassified 1121
275 Ga0496109_0707567 3300048912 Bacteria 945
276 Ga0496110_0315188 3300048913 Bacteria 1424
277 Ga0496110_0575528 3300048913 Bacteria 1023
278 Ga0496110_0673059 3300048913 Bacteria 935
279 Ga0496110_0817709 3300048913 Bacteria 836
280 Ga0496110_0873035 3300048913 Unclassified 805
281 Ga0496111_0035789 3300048914 Bacteria 3549
282 Ga0496111_0379125 3300048914 Bacteria 1046
283 Ga0496111_0646010 3300048914 Unclassified 772
284 Ga0496112_0998233 3300048915 Unclassified 757
285 Ga0496113_0068352 3300048916 Bacteria 2696
286 Ga0496113_0223574 3300048916 Bacteria 1501
287 Ga0496113_1193802 3300048916 Bacteria 594
288 Ga0496114_0016166 3300048917 Bacteria 6006
289 Ga0496114_0028798 3300048917 Bacteria 4561
290 Ga0496114_0049658 3300048917 Bacteria 3491
291 Ga0496114_0088717 3300048917 Bacteria 2623
292 Ga0496114_0162377 3300048917 Bacteria 1943
293 Ga0496114_0273946 3300048917 Bacteria 1487
294 Ga0496114_0285840 3300048917 Bacteria 1455
295 Ga0496114_0369861 3300048917 Bacteria 1269
296 Ga0496114_0518163 3300048917 Bacteria 1054
297 Ga0496114_0620271 3300048917 Unclassified 953
298 Ga0496114_0944130 3300048917 Bacteria 745
299 Ga0496114_1190810 3300048917 Bacteria 648
300 Ga0496115_0049753 3300048918 Bacteria 3356
301 Ga0496115_0057866 3300048918 Bacteria 3118
302 Ga0496115_0088233 3300048918 Bacteria 2532
303 Ga0496115_0987702 3300048918 Bacteria 644
304 Ga0496124_0791233 3300048927 Bacteria 589
305 Ga0496126_0097283 3300048929 Bacteria 2580
306 Ga0496126_0852079 3300048929 Unclassified 695
307 Ga0501031_0003404 3300049568 Bacteria 10207
308 Ga0501031_0355672 3300049568 Unclassified 948
309 Ga0501032_0054108 3300049569 Bacteria 2702
310 Ga0501033_0232838 3300049570 Bacteria 1308
311 Ga0501036_0154205 3300049572 Bacteria 1937
312 Ga0501038_0016519 3300049574 Bacteria 6690
313 Ga0501039_0012631 3300049575 Bacteria 6454
314 Ga0501040_0041351 3300049576 Bacteria 3139
315 Ga0501040_1362577 3300049576 Unclassified 515
316 Ga0501041_0024846 3300049577 Bacteria 3598
317 Ga0501042_1204551 3300049578 Unclassified 552
318 Ga0501043_0107671 3300049579 Bacteria 2189
319 Ga0501046_0008641 3300049580 Bacteria 8855
320 Ga0501048_0007832 3300049582 Bacteria 8094
321 Ga0501048_0696846 3300049582 Unclassified 729
322 Ga0501067_0013709 3300049583 Bacteria 4490
323 Ga0501067_0066254 3300049583 Bacteria 1999
324 Ga0501068_0116235 3300049584 Bacteria 1666
325 Ga0501068_0612562 3300049584 Unclassified 710
326 Ga0501069_0025305 3300049585 Bacteria 3243
327 Ga0501069_0044281 3300049585 Bacteria 2464
328 Ga0501070_0029868 3300049586 Bacteria 4567
329 Ga0501070_0568604 3300049586 Bacteria 906
330 Ga0501071_0338144 3300049587 Bacteria 1144
331 Ga0501072_0041184 3300049588 Bacteria 3627
332 Ga0501076_0016415 3300049592 Bacteria 5614
333 Ga0501077_0034666 3300049593 Bacteria 3212
334 Ga0501079_0044977 3300049741 Bacteria 3407
335 Ga0501079_0281760 3300049741 Bacteria 1300
336 Ga0501081_0055570 3300049743 Bacteria 2735
337 Ga0501035_0135658 3300049822 Bacteria 2143
338 Ga0501045_0009840 3300049824 Bacteria 6690
339 Ga0501045_0295306 3300049824 Bacteria 1206
340 nmdc:mga0yw44_510773_c1 3300050492 Bacteria 815
341 nmdc:mga0yw44_74778_c1 3300050492 Bacteria 2111
342 nmdc:mga08y16_96490_c1 3300050511 Bacteria 3079
343 Ga0495601_0486657 3300053077 Bacteria 797
344 Ga0495595_0562245 3300053084 Bacteria 583
345 Ga0495619_0023977 3300053085 Bacteria 3913
346 Ga0501084_0007169 3300054114 Bacteria 9182
347 Ga0501082_0533162 3300060353 Bacteria 1026
348 Ga0530510_0011878 3300061734 Bacteria 6111
349 Ga0530510_1377287 3300061734 Unclassified 541

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0088233 Ga0496115_0088233_440_760 106
2 3300005366 Ga0070659_100263581 Ga0070659_1002635811 108
3 3300032002 Ga0307416_102276050 Ga0307416_1022760502 108
4 3300045976 Ga0466967_1238593 Ga0466967_1238593_71_397 108
5 3300005329 Ga0070683_100206075 Ga0070683_1002060752 109
6 3300005335 Ga0070666_11521151 Ga0070666_115211511 109
7 3300005337 Ga0070682_100998601 Ga0070682_1009986012 109
8 3300005356 Ga0070674_100305245 Ga0070674_1003052452 109
9 3300005366 Ga0070659_100511754 Ga0070659_1005117542 109
10 3300005530 Ga0070679_101315810 Ga0070679_1013158101 109
11 3300005544 Ga0070686_100778737 Ga0070686_1007787372 109
12 3300005548 Ga0070665_101203776 Ga0070665_1012037762 109
13 3300005564 Ga0070664_101408592 Ga0070664_1014085922 109
14 3300005577 Ga0068857_102063972 Ga0068857_1020639722 109
15 3300005718 Ga0068866_10731323 Ga0068866_107313231 109
16 3300005834 Ga0068851_10950212 Ga0068851_109502121 109
17 3300006175 Ga0070712_100163103 Ga0070712_1001631032 109
18 3300009148 Ga0105243_10234823 Ga0105243_102348231 109
19 3300009148 Ga0105243_12823481 Ga0105243_128234811 109
20 3300009553 Ga0105249_12017415 Ga0105249_120174152 109
21 3300011119 Ga0105246_10249743 Ga0105246_102497432 109
22 3300011119 Ga0105246_11061883 Ga0105246_110618832 109
23 3300014325 Ga0163163_11046678 Ga0163163_110466782 109
24 3300014325 Ga0163163_11406279 Ga0163163_114062791 109
25 3300014326 Ga0157380_10286372 Ga0157380_102863722 109
26 3300017792 Ga0163161_10747523 Ga0163161_107475232 109
27 3300025899 Ga0207642_10634893 Ga0207642_106348931 109
28 3300025909 Ga0207705_10689251 Ga0207705_106892512 109
29 3300025921 Ga0207652_10998663 Ga0207652_109986632 109
30 3300025935 Ga0207709_11728688 Ga0207709_117286881 109
31 3300025941 Ga0207711_10091413 Ga0207711_100914133 109
32 3300025944 Ga0207661_10479235 Ga0207661_104792352 109
33 3300025944 Ga0207661_10568888 Ga0207661_105688882 109
34 3300026116 Ga0207674_11915449 Ga0207674_119154492 109
35 3300031903 Ga0307407_10889218 Ga0307407_108892181 109
36 3300048905 Ga0496102_1207001 Ga0496102_1207001_313_642 109
37 3300048907 Ga0496104_1011878 Ga0496104_1011878_113_442 109
38 3300048908 Ga0496105_0766275 Ga0496105_0766275_342_671 109
39 3300048913 Ga0496110_0673059 Ga0496110_0673059_430_759 109
40 3300048916 Ga0496113_1193802 Ga0496113_1193802_179_508 109
41 3300005327 Ga0070658_10293964 Ga0070658_102939642 110
42 3300005327 Ga0070658_10997872 Ga0070658_109978721 110
43 3300005329 Ga0070683_100010577 Ga0070683_1000105777 110
44 3300005329 Ga0070683_100206457 Ga0070683_1002064572 110
45 3300005329 Ga0070683_100371264 Ga0070683_1003712642 110
46 3300005331 Ga0070670_100311840 Ga0070670_1003118401 110
47 3300005336 Ga0070680_100107870 Ga0070680_1001078702 110
48 3300005337 Ga0070682_100023048 Ga0070682_1000230482 110
49 3300005337 Ga0070682_100394465 Ga0070682_1003944651 110
50 3300005338 Ga0068868_101132028 Ga0068868_1011320282 110
51 3300005339 Ga0070660_100010467 Ga0070660_1000104677 110
52 3300005344 Ga0070661_100361725 Ga0070661_1003617252 110
53 3300005347 Ga0070668_101159045 Ga0070668_1011590451 110
54 3300005354 Ga0070675_100543337 Ga0070675_1005433372 110
55 3300005364 Ga0070673_101450932 Ga0070673_1014509321 110
56 3300005366 Ga0070659_100028278 Ga0070659_1000282782 110
57 3300005367 Ga0070667_102040263 Ga0070667_1020402631 110
58 3300005434 Ga0070709_11689684 Ga0070709_116896841 110
59 3300005435 Ga0070714_101275268 Ga0070714_1012752681 110
60 3300005436 Ga0070713_101031607 Ga0070713_1010316072 110
61 3300005456 Ga0070678_100746592 Ga0070678_1007465922 110
62 3300005457 Ga0070662_100946315 Ga0070662_1009463151 110
63 3300005466 Ga0070685_10585143 Ga0070685_105851431 110
64 3300005530 Ga0070679_100524942 Ga0070679_1005249421 110
65 3300005535 Ga0070684_100183857 Ga0070684_1001838572 110
66 3300005535 Ga0070684_100432739 Ga0070684_1004327391 110
67 3300005535 Ga0070684_100466925 Ga0070684_1004669252 110
68 3300005535 Ga0070684_101680702 Ga0070684_1016807022 110
69 3300005539 Ga0068853_100314345 Ga0068853_1003143452 110
70 3300005544 Ga0070686_100106776 Ga0070686_1001067762 110
71 3300005547 Ga0070693_100143970 Ga0070693_1001439701 110
72 3300005547 Ga0070693_100292182 Ga0070693_1002921822 110
73 3300005548 Ga0070665_100511933 Ga0070665_1005119331 110
74 3300005563 Ga0068855_100443250 Ga0068855_1004432502 110
75 3300005563 Ga0068855_101589793 Ga0068855_1015897932 110
76 3300005563 Ga0068855_101792677 Ga0068855_1017926771 110
77 3300005577 Ga0068857_100095323 Ga0068857_1000953232 110
78 3300005577 Ga0068857_101607871 Ga0068857_1016078711 110
79 3300005614 Ga0068856_100030864 Ga0068856_1000308643 110
80 3300005614 Ga0068856_101539348 Ga0068856_1015393481 110
81 3300005615 Ga0070702_100691741 Ga0070702_1006917411 110
82 3300005616 Ga0068852_100162580 Ga0068852_1001625802 110
83 3300005618 Ga0068864_100213961 Ga0068864_1002139612 110
84 3300005618 Ga0068864_100525579 Ga0068864_1005255792 110
85 3300005718 Ga0068866_10225932 Ga0068866_102259322 110
86 3300005719 Ga0068861_100426919 Ga0068861_1004269192 110
87 3300005834 Ga0068851_10154436 Ga0068851_101544362 110
88 3300005840 Ga0068870_11088427 Ga0068870_110884272 110
89 3300005841 Ga0068863_100556814 Ga0068863_1005568142 110
90 3300005842 Ga0068858_100813796 Ga0068858_1008137962 110
91 3300005842 Ga0068858_101145331 Ga0068858_1011453312 110
92 3300005844 Ga0068862_100543124 Ga0068862_1005431242 110
93 3300006038 Ga0075365_10025856 Ga0075365_100258565 110
94 3300006038 Ga0075365_11029808 Ga0075365_110298081 110
95 3300006058 Ga0075432_10325429 Ga0075432_103254292 110
96 3300006844 Ga0075428_100796149 Ga0075428_1007961493 110
97 3300006881 Ga0068865_100334473 Ga0068865_1003344731 110
98 3300009093 Ga0105240_10733775 Ga0105240_107337753 110
99 3300009094 Ga0111539_10056168 Ga0111539_100561683 110
100 3300009098 Ga0105245_10001722 Ga0105245_100017222 110
101 3300009098 Ga0105245_10115674 Ga0105245_101156743 110
102 3300009098 Ga0105245_10385392 Ga0105245_103853922 110
103 3300009098 Ga0105245_10401946 Ga0105245_104019462 110
104 3300009098 Ga0105245_11387289 Ga0105245_113872891 110
105 3300009098 Ga0105245_11999705 Ga0105245_119997051 110
106 3300009101 Ga0105247_11556264 Ga0105247_115562641 110
107 3300009148 Ga0105243_10150801 Ga0105243_101508012 110
108 3300009148 Ga0105243_10329720 Ga0105243_103297202 110
109 3300009148 Ga0105243_12183634 Ga0105243_121836342 110
110 3300009545 Ga0105237_10095320 Ga0105237_100953203 110
111 3300009545 Ga0105237_12110175 Ga0105237_121101752 110
112 3300009551 Ga0105238_10357954 Ga0105238_103579542 110
113 3300009551 Ga0105238_10474680 Ga0105238_104746802 110
114 3300009551 Ga0105238_11349789 Ga0105238_113497892 110
115 3300009553 Ga0105249_10194220 Ga0105249_101942203 110
116 3300009553 Ga0105249_10197790 Ga0105249_101977902 110
117 3300010375 Ga0105239_10001349 Ga0105239_1000134931 110
118 3300011119 Ga0105246_10004154 Ga0105246_100041547 110
119 3300011119 Ga0105246_10747677 Ga0105246_107476772 110
120 3300013104 Ga0157370_12129810 Ga0157370_121298101 110
121 3300013105 Ga0157369_10024241 Ga0157369_100242417 110
122 3300013105 Ga0157369_10130481 Ga0157369_101304812 110
123 3300013105 Ga0157369_10330623 Ga0157369_103306232 110
124 3300013105 Ga0157369_11108381 Ga0157369_111083811 110
125 3300013105 Ga0157369_12106379 Ga0157369_121063791 110
126 3300013297 Ga0157378_11689358 Ga0157378_116893581 110
127 3300013306 Ga0163162_10024710 Ga0163162_100247101 110
128 3300013306 Ga0163162_10505465 Ga0163162_105054652 110
129 3300013306 Ga0163162_10938472 Ga0163162_109384722 110
130 3300013307 Ga0157372_10333735 Ga0157372_103337352 110
131 3300013307 Ga0157372_10337220 Ga0157372_103372202 110
132 3300013307 Ga0157372_10744544 Ga0157372_107445442 110
133 3300013307 Ga0157372_12586004 Ga0157372_125860042 110
134 3300013308 Ga0157375_10008571 Ga0157375_100085715 110
135 3300013308 Ga0157375_10046518 Ga0157375_100465183 110
136 3300013308 Ga0157375_10573084 Ga0157375_105730841 110
137 3300013308 Ga0157375_12065663 Ga0157375_120656632 110
138 3300013308 Ga0157375_12608034 Ga0157375_126080342 110
139 3300014325 Ga0163163_10527076 Ga0163163_105270762 110
140 3300014745 Ga0157377_10187554 Ga0157377_101875542 110
141 3300014745 Ga0157377_10335815 Ga0157377_103358152 110
142 3300014968 Ga0157379_10065021 Ga0157379_100650213 110
143 3300014968 Ga0157379_10378989 Ga0157379_103789893 110
144 3300014969 Ga0157376_10979238 Ga0157376_109792382 110
145 3300017792 Ga0163161_10206524 Ga0163161_102065242 110
146 3300017792 Ga0163161_10268585 Ga0163161_102685851 110
147 3300017792 Ga0163161_10994715 Ga0163161_109947151 110
148 3300020069 Ga0197907_11264205 Ga0197907_112642051 110
149 3300020082 Ga0206353_10952417 Ga0206353_109524172 110
150 3300021384 Ga0213876_10066040 Ga0213876_100660401 110
151 3300025901 Ga0207688_10030686 Ga0207688_100306862 110
152 3300025904 Ga0207647_10333077 Ga0207647_103330771 110
153 3300025909 Ga0207705_10416872 Ga0207705_104168722 110
154 3300025917 Ga0207660_10087920 Ga0207660_100879202 110
155 3300025919 Ga0207657_10005803 Ga0207657_100058036 110
156 3300025920 Ga0207649_10348317 Ga0207649_103483172 110
157 3300025921 Ga0207652_10033306 Ga0207652_100333063 110
158 3300025921 Ga0207652_10776601 Ga0207652_107766011 110
159 3300025924 Ga0207694_10720563 Ga0207694_107205632 110
160 3300025927 Ga0207687_10108872 Ga0207687_101088723 110
161 3300025927 Ga0207687_10286874 Ga0207687_102868742 110
162 3300025927 Ga0207687_11362157 Ga0207687_113621571 110
163 3300025927 Ga0207687_11763762 Ga0207687_117637621 110
164 3300025929 Ga0207664_11079771 Ga0207664_110797712 110
165 3300025932 Ga0207690_10154487 Ga0207690_101544872 110
166 3300025935 Ga0207709_10268733 Ga0207709_102687332 110
167 3300025937 Ga0207669_10292110 Ga0207669_102921102 110
168 3300025938 Ga0207704_10287240 Ga0207704_102872401 110
169 3300025940 Ga0207691_10289588 Ga0207691_102895882 110
170 3300025944 Ga0207661_10014311 Ga0207661_100143114 110
171 3300025944 Ga0207661_10101107 Ga0207661_101011072 110
172 3300025944 Ga0207661_11920398 Ga0207661_119203981 110
173 3300025945 Ga0207679_10231131 Ga0207679_102311312 110
174 3300025972 Ga0207668_11303374 Ga0207668_113033741 110
175 3300026035 Ga0207703_11633493 Ga0207703_116334931 110
176 3300026078 Ga0207702_10170493 Ga0207702_101704933 110
177 3300026078 Ga0207702_11213807 Ga0207702_112138072 110
178 3300026088 Ga0207641_10383710 Ga0207641_103837102 110
179 3300026095 Ga0207676_10443826 Ga0207676_104438262 110
180 3300026118 Ga0207675_100883546 Ga0207675_1008835462 110
181 3300026121 Ga0207683_10355054 Ga0207683_103550542 110
182 3300026142 Ga0207698_11472384 Ga0207698_114723842 110
183 3300026142 Ga0207698_12423621 Ga0207698_124236211 110
184 3300027907 Ga0207428_10359229 Ga0207428_103592291 110
185 3300028380 Ga0268265_10455482 Ga0268265_104554822 110
186 3300031665 Ga0316575_10241152 Ga0316575_102411521 110
187 3300031728 Ga0316578_10862565 Ga0316578_108625651 110
188 3300031733 Ga0316577_10014350 Ga0316577_100143502 110
189 3300031824 Ga0307413_11237438 Ga0307413_112374382 110
190 3300031852 Ga0307410_10042082 Ga0307410_100420821 110
191 3300031901 Ga0307406_10061568 Ga0307406_100615682 110
192 3300031901 Ga0307406_10582901 Ga0307406_105829012 110
193 3300031903 Ga0307407_10303580 Ga0307407_103035802 110
194 3300031995 Ga0307409_100005330 Ga0307409_1000053304 110
195 3300031995 Ga0307409_100301092 Ga0307409_1003010922 110
196 3300031995 Ga0307409_100304850 Ga0307409_1003048502 110
197 3300032002 Ga0307416_100640911 Ga0307416_1006409112 110
198 3300032002 Ga0307416_101120459 Ga0307416_1011204592 110
199 3300032002 Ga0307416_101237092 Ga0307416_1012370922 110
200 3300032002 Ga0307416_102297424 Ga0307416_1022974241 110
201 3300032126 Ga0307415_100228651 Ga0307415_1002286512 110
202 3300032139 Ga0316580_10017959 Ga0316580_100179592 110
203 3300035398 Ga0316574_0069181 Ga0316574_0069181_143_475 110
204 3300035691 Ga0373931_0329385 Ga0373931_0329385_27_359 110
205 3300036712 Ga0316584_0255852 Ga0316584_0255852_199_531 110
206 3300039437 Ga0436365_1297167 Ga0436365_1297167_372_704 110
207 3300039437 Ga0436365_1374999 Ga0436365_1374999_667_999 110
208 3300039437 Ga0436365_1465922 Ga0436365_1465922_274_606 110
209 3300041404 Ga0439436_0038467 Ga0439436_0038467_559_891 110
210 3300041404 Ga0439436_0225624 Ga0439436_0225624_48_380 110
211 3300041460 Ga0451802_2059427 Ga0451802_2059427_78_410 110
212 3300041498 Ga0451841_0613821 Ga0451841_0613821_397_729 110
213 3300041512 Ga0451853_0823676 Ga0451853_0823676_101_433 110
214 3300041512 Ga0451853_0884934 Ga0451853_0884934_76_408 110
215 3300041512 Ga0451853_3014048 Ga0451853_3014048_108_440 110
216 3300042014 Ga0439457_025652 Ga0439457_025652_915_1247 110
217 3300042015 Ga0439462_0093986 Ga0439462_0093986_432_764 110
218 3300044658 Ga0466972_0479137 Ga0466972_0479137_72_404 110
219 3300044683 Ga0466965_0200588 Ga0466965_0200588_376_708 110
220 3300044684 Ga0466966_0144652 Ga0466966_0144652_644_976 110
221 3300044693 Ga0466961_0881414 Ga0466961_0881414_14_346 110
222 3300044706 Ga0466964_0036721 Ga0466964_0036721_1444_1776 110
223 3300044765 Ga0466970_0571749 Ga0466970_0571749_94_426 110
224 3300044901 Ga0466960_0055198 Ga0466960_0055198_1456_1788 110
225 3300044901 Ga0466960_0178884 Ga0466960_0178884_731_1063 110
226 3300044901 Ga0466960_0408927 Ga0466960_0408927_431_763 110
227 3300044901 Ga0466960_0849192 Ga0466960_0849192_207_539 110
228 3300045051 Ga0451576_0783060 Ga0451576_0783060_595_927 110
229 3300045836 Ga0466958_0378966 Ga0466958_0378966_497_829 110
230 3300045976 Ga0466967_0057288 Ga0466967_0057288_838_1170 110
231 3300045976 Ga0466967_0876541 Ga0466967_0876541_239_571 110
232 3300045976 Ga0466967_1006178 Ga0466967_1006178_35_367 110
233 3300045976 Ga0466967_1389188 Ga0466967_1389188_169_501 110
234 3300045976 Ga0466967_2111468 Ga0466967_2111468_65_397 110
235 3300045976 Ga0466967_2605411 Ga0466967_2605411_105_437 110
236 3300046615 Ga0495656_0293128 Ga0495656_0293128_233_565 110
237 3300047317 Ga0495604_0661149 Ga0495604_0661149_308_643 110
238 3300047317 Ga0495604_1046275 Ga0495604_1046275_122_454 110
239 3300047321 Ga0495676_1049700 Ga0495676_1049700_39_374 110
240 3300047321 Ga0495676_1116173 Ga0495676_1116173_139_471 110
241 3300047445 Ga0495677_0369439 Ga0495677_0369439_74_409 110
242 3300048903 Ga0496100_0129256 Ga0496100_0129256_182_514 110
243 3300048903 Ga0496100_0144924 Ga0496100_0144924_926_1321 110
244 3300048903 Ga0496100_0396490 Ga0496100_0396490_362_694 110
245 3300048903 Ga0496100_1549370 Ga0496100_1549370_128_460 110
246 3300048904 Ga0496101_0065131 Ga0496101_0065131_2004_2336 110
247 3300048904 Ga0496101_0102035 Ga0496101_0102035_1777_2109 110
248 3300048904 Ga0496101_0191570 Ga0496101_0191570_876_1208 110
249 3300048904 Ga0496101_0556514 Ga0496101_0556514_245_577 110
250 3300048905 Ga0496102_0001614 Ga0496102_0001614_4596_4928 110
251 3300048905 Ga0496102_0040032 Ga0496102_0040032_807_1139 110
252 3300048905 Ga0496102_0193257 Ga0496102_0193257_747_1079 110
253 3300048905 Ga0496102_0470231 Ga0496102_0470231_66_461 110
254 3300048906 Ga0496103_0007504 Ga0496103_0007504_572_904 110
255 3300048906 Ga0496103_0122947 Ga0496103_0122947_30_362 110
256 3300048907 Ga0496104_0218822 Ga0496104_0218822_462_794 110
257 3300048907 Ga0496104_0641427 Ga0496104_0641427_150_482 110
258 3300048907 Ga0496104_0641482 Ga0496104_0641482_360_695 110
259 3300048908 Ga0496105_0001223 Ga0496105_0001223_2430_2762 110
260 3300048908 Ga0496105_0059220 Ga0496105_0059220_2329_2664 110
261 3300048908 Ga0496105_0212913 Ga0496105_0212913_953_1348 110
262 3300048908 Ga0496105_1216767 Ga0496105_1216767_173_505 110
263 3300048909 Ga0496106_0092285 Ga0496106_0092285_1906_2238 110
264 3300048909 Ga0496106_0156179 Ga0496106_0156179_925_1257 110
265 3300048910 Ga0496107_0037831 Ga0496107_0037831_551_883 110
266 3300048910 Ga0496107_0078200 Ga0496107_0078200_766_1098 110
267 3300048910 Ga0496107_0144343 Ga0496107_0144343_1100_1432 110
268 3300048910 Ga0496107_0229229 Ga0496107_0229229_44_439 110
269 3300048911 Ga0496108_0032472 Ga0496108_0032472_3590_3922 110
270 3300048911 Ga0496108_0198417 Ga0496108_0198417_245_577 110
271 3300048911 Ga0496108_0547530 Ga0496108_0547530_297_629 110
272 3300048911 Ga0496108_0623466 Ga0496108_0623466_241_573 110
273 3300048912 Ga0496109_0009202 Ga0496109_0009202_1982_2314 110
274 3300048912 Ga0496109_0057438 Ga0496109_0057438_2709_3041 110
275 3300048912 Ga0496109_0069340 Ga0496109_0069340_35_367 110
276 3300048912 Ga0496109_0205448 Ga0496109_0205448_963_1295 110
277 3300048912 Ga0496109_0521998 Ga0496109_0521998_746_1078 110
278 3300048912 Ga0496109_0707567 Ga0496109_0707567_220_552 110
279 3300048913 Ga0496110_0315188 Ga0496110_0315188_394_726 110
280 3300048913 Ga0496110_0575528 Ga0496110_0575528_224_556 110
281 3300048913 Ga0496110_0817709 Ga0496110_0817709_368_700 110
282 3300048913 Ga0496110_0873035 Ga0496110_0873035_459_791 110
283 3300048914 Ga0496111_0035789 Ga0496111_0035789_190_522 110
284 3300048914 Ga0496111_0379125 Ga0496111_0379125_622_954 110
285 3300048914 Ga0496111_0646010 Ga0496111_0646010_418_750 110
286 3300048915 Ga0496112_0998233 Ga0496112_0998233_349_681 110
287 3300048916 Ga0496113_0068352 Ga0496113_0068352_2265_2597 110
288 3300048916 Ga0496113_0223574 Ga0496113_0223574_215_547 110
289 3300048917 Ga0496114_0016166 Ga0496114_0016166_247_642 110
290 3300048917 Ga0496114_0028798 Ga0496114_0028798_1489_1821 110
291 3300048917 Ga0496114_0049658 Ga0496114_0049658_1634_1966 110
292 3300048917 Ga0496114_0088717 Ga0496114_0088717_134_466 110
293 3300048917 Ga0496114_0162377 Ga0496114_0162377_294_626 110
294 3300048917 Ga0496114_0273946 Ga0496114_0273946_59_391 110
295 3300048917 Ga0496114_0285840 Ga0496114_0285840_535_867 110
296 3300048917 Ga0496114_0369861 Ga0496114_0369861_360_692 110
297 3300048917 Ga0496114_0518163 Ga0496114_0518163_389_721 110
298 3300048917 Ga0496114_0620271 Ga0496114_0620271_86_418 110
299 3300048917 Ga0496114_0944130 Ga0496114_0944130_399_731 110
300 3300048917 Ga0496114_1190810 Ga0496114_1190810_15_350 110
301 3300048918 Ga0496115_0049753 Ga0496115_0049753_1804_2199 110
302 3300048918 Ga0496115_0057866 Ga0496115_0057866_2166_2498 110
303 3300048918 Ga0496115_0987702 Ga0496115_0987702_12_344 110
304 3300048927 Ga0496124_0791233 Ga0496124_0791233_241_573 110
305 3300048929 Ga0496126_0097283 Ga0496126_0097283_1809_2141 110
306 3300048929 Ga0496126_0852079 Ga0496126_0852079_291_623 110
307 3300049568 Ga0501031_0003404 Ga0501031_0003404_2332_2664 110
308 3300049568 Ga0501031_0355672 Ga0501031_0355672_351_683 110
309 3300049569 Ga0501032_0054108 Ga0501032_0054108_1768_2100 110
310 3300049570 Ga0501033_0232838 Ga0501033_0232838_194_526 110
311 3300049572 Ga0501036_0154205 Ga0501036_0154205_434_766 110
312 3300049574 Ga0501038_0016519 Ga0501038_0016519_221_553 110
313 3300049575 Ga0501039_0012631 Ga0501039_0012631_2158_2490 110
314 3300049576 Ga0501040_0041351 Ga0501040_0041351_2425_2757 110
315 3300049576 Ga0501040_1362577 Ga0501040_1362577_46_378 110
316 3300049577 Ga0501041_0024846 Ga0501041_0024846_926_1258 110
317 3300049578 Ga0501042_1204551 Ga0501042_1204551_207_539 110
318 3300049579 Ga0501043_0107671 Ga0501043_0107671_1592_1924 110
319 3300049580 Ga0501046_0008641 Ga0501046_0008641_932_1264 110
320 3300049582 Ga0501048_0007832 Ga0501048_0007832_1741_2073 110
321 3300049582 Ga0501048_0696846 Ga0501048_0696846_292_624 110
322 3300049583 Ga0501067_0013709 Ga0501067_0013709_2424_2756 110
323 3300049583 Ga0501067_0066254 Ga0501067_0066254_811_1143 110
324 3300049584 Ga0501068_0116235 Ga0501068_0116235_590_922 110
325 3300049584 Ga0501068_0612562 Ga0501068_0612562_252_584 110
326 3300049585 Ga0501069_0025305 Ga0501069_0025305_1280_1612 110
327 3300049585 Ga0501069_0044281 Ga0501069_0044281_818_1150 110
328 3300049586 Ga0501070_0029868 Ga0501070_0029868_2034_2366 110
329 3300049586 Ga0501070_0568604 Ga0501070_0568604_287_619 110
330 3300049587 Ga0501071_0338144 Ga0501071_0338144_631_963 110
331 3300049588 Ga0501072_0041184 Ga0501072_0041184_810_1142 110
332 3300049592 Ga0501076_0016415 Ga0501076_0016415_1383_1715 110
333 3300049593 Ga0501077_0034666 Ga0501077_0034666_2152_2484 110
334 3300049741 Ga0501079_0044977 Ga0501079_0044977_2264_2596 110
335 3300049741 Ga0501079_0281760 Ga0501079_0281760_877_1209 110
336 3300049743 Ga0501081_0055570 Ga0501081_0055570_250_582 110
337 3300049822 Ga0501035_0135658 Ga0501035_0135658_1566_1898 110
338 3300049824 Ga0501045_0009840 Ga0501045_0009840_1172_1504 110
339 3300049824 Ga0501045_0295306 Ga0501045_0295306_665_997 110
340 3300050492 nmdc:mga0yw44_510773_c1 nmdc:mga0yw44_510773_c1_413_745 110
341 3300050492 nmdc:mga0yw44_74778_c1 nmdc:mga0yw44_74778_c1_861_1193 110
342 3300050511 nmdc:mga08y16_96490_c1 nmdc:mga08y16_96490_c1_2252_2584 110
343 3300053077 Ga0495601_0486657 Ga0495601_0486657_318_650 110
344 3300053084 Ga0495595_0562245 Ga0495595_0562245_180_512 110
345 3300053085 Ga0495619_0023977 Ga0495619_0023977_3484_3816 110
346 3300054114 Ga0501084_0007169 Ga0501084_0007169_933_1265 110
347 3300060353 Ga0501082_0533162 Ga0501082_0533162_277_609 110
348 3300061734 Ga0530510_0011878 Ga0530510_0011878_5492_5824 110
349 3300061734 Ga0530510_1377287 Ga0530510_1377287_64_396 110

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cwg-assembly1.cif.gz_A crystal structure of de novo designed helical repeat protein dhr10 0.5262 10 107
5cwc-assembly1.cif.gz_A crystal structure of de novo designed helical repeat protein dhr5 0.5196 10 107
5a0l-assembly2.cif.gz_B n-terminal thioester domain of fibronectin-binding protein sfbi from streptococcus pyogenes 0.5005 32 108
3daf-assembly1.cif.gz_A the crystal structure of [fe]-hydrogenase holoenzyme (hmd) from methanocaldococcus jannaschii cocrystallized with cyanide 0.423 10 106
5cwg-assembly1.cif.gz_A crystal structure of de novo designed helical repeat protein dhr10 0.4035 10 107
ID Description Score Start End Superfamily
af_C4J362_195_322_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.5445 9 109 1.10.472.10
af_A0A2R8Q7P4_194_306_1.10.472.30 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Transcription elongation factor S-II, central domain 0.506 10 98 1.10.472.30
af_C4J362_195_322_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4963 9 109 1.10.472.10
af_P49373_112_221_1.10.472.30 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Transcription elongation factor S-II, central domain 0.4888 7 102 1.10.472.30
af_Q4DFA6_280_376_1.20.1150.12 Mainly Alpha;Up-down Bundle;Endoplasmic reticulum protein erp29;Endoplasmic reticulum resident protein 29, C-terminal domain 0.4327 11 107 1.20.1150.12
ID Description Score Start End GO Terms
AF-A0A6G6W9N7-F1-model_v4 Uncharacterized protein 0.9858 7 110
AF-A0A0Q6VHF0-F1-model_v4 Uncharacterized protein 0.9711 10 110
AF-A0A0T2II78-F1-model_v4 Uncharacterized protein 0.9661 10 110
AF-A0A6G6W9N7-F1-model_v4 Uncharacterized protein 0.9326 7 110
AF-A0A1G9E7Q4-F1-model_v4 HEAT repeat domain-containing protein 0.9161 4 110

Feature Viewer

pLDDT pTM Quality
89.09 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map