F417893
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 349 | 186 | 349 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_11108381|Ga0157369_111083811 |
| Length | 131 |
| Sequence | VVGAFVHIRLPVADVPCEARGMPPNTVQPPYDQFLATAEAVALERPEVDLELAREVFLEVATLLYNGLALDGLDEHDANAVVAGLCVDLVTDDPGAAVRARSQATLEVPGDLHDPEGVSRVYLISAAILKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 72 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 101 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 103 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 104 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 105 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 106 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 107 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 108 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 112 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 113 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 114 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 116 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 117 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 118 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 120 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 121 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 122 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 123 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 124 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 125 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 126 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 127 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 128 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 129 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 130 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 131 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 132 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 133 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 140 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 141 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 142 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 143 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 144 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 145 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 148 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 149 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 150 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 151 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 154 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 155 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 180 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.43 |
| Metatranscriptomes | 0.57 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.15 |
| Nodule | 0 |
| Rhizoplane | 19.77 |
| Rhizosphere | 75.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10293964 | 3300005327 | Bacteria | 1384 |
| 2 | Ga0070658_10997872 | 3300005327 | Unclassified | 728 |
| 3 | Ga0070683_100010577 | 3300005329 | Bacteria | 7931 |
| 4 | Ga0070683_100206075 | 3300005329 | Bacteria | 1868 |
| 5 | Ga0070683_100206457 | 3300005329 | Bacteria | 1866 |
| 6 | Ga0070683_100371264 | 3300005329 | Bacteria | 1363 |
| 7 | Ga0070670_100311840 | 3300005331 | Bacteria | 1377 |
| 8 | Ga0070666_11521151 | 3300005335 | Unclassified | 501 |
| 9 | Ga0070680_100107870 | 3300005336 | Bacteria | 2316 |
| 10 | Ga0070682_100023048 | 3300005337 | Bacteria | 3695 |
| 11 | Ga0070682_100394465 | 3300005337 | Bacteria | 1045 |
| 12 | Ga0070682_100998601 | 3300005337 | Bacteria | 694 |
| 13 | Ga0068868_101132028 | 3300005338 | Unclassified | 721 |
| 14 | Ga0070660_100010467 | 3300005339 | Bacteria | 6556 |
| 15 | Ga0070661_100361725 | 3300005344 | Bacteria | 1141 |
| 16 | Ga0070668_101159045 | 3300005347 | Unclassified | 699 |
| 17 | Ga0070675_100543337 | 3300005354 | Bacteria | 1050 |
| 18 | Ga0070674_100305245 | 3300005356 | Bacteria | 1270 |
| 19 | Ga0070673_101450932 | 3300005364 | Bacteria | 646 |
| 20 | Ga0070659_100028278 | 3300005366 | Bacteria | 4328 |
| 21 | Ga0070659_100263581 | 3300005366 | Bacteria | 1430 |
| 22 | Ga0070659_100511754 | 3300005366 | Bacteria | 1024 |
| 23 | Ga0070667_102040263 | 3300005367 | Unclassified | 540 |
| 24 | Ga0070709_11689684 | 3300005434 | Unclassified | 517 |
| 25 | Ga0070714_101275268 | 3300005435 | Bacteria | 717 |
| 26 | Ga0070713_101031607 | 3300005436 | Bacteria | 794 |
| 27 | Ga0070678_100746592 | 3300005456 | Bacteria | 885 |
| 28 | Ga0070662_100946315 | 3300005457 | Bacteria | 736 |
| 29 | Ga0070685_10585143 | 3300005466 | Bacteria | 801 |
| 30 | Ga0070679_100524942 | 3300005530 | Unclassified | 1128 |
| 31 | Ga0070679_101315810 | 3300005530 | Bacteria | 668 |
| 32 | Ga0070684_100183857 | 3300005535 | Bacteria | 1901 |
| 33 | Ga0070684_100432739 | 3300005535 | Unclassified | 1215 |
| 34 | Ga0070684_100466925 | 3300005535 | Bacteria | 1167 |
| 35 | Ga0070684_101680702 | 3300005535 | Bacteria | 599 |
| 36 | Ga0068853_100314345 | 3300005539 | Bacteria | 1451 |
| 37 | Ga0070686_100106776 | 3300005544 | Bacteria | 1901 |
| 38 | Ga0070686_100778737 | 3300005544 | Unclassified | 769 |
| 39 | Ga0070693_100143970 | 3300005547 | Bacteria | 1503 |
| 40 | Ga0070693_100292182 | 3300005547 | Bacteria | 1095 |
| 41 | Ga0070665_100511933 | 3300005548 | Bacteria | 1212 |
| 42 | Ga0070665_101203776 | 3300005548 | Bacteria | 768 |
| 43 | Ga0068855_100443250 | 3300005563 | Unclassified | 1418 |
| 44 | Ga0068855_101589793 | 3300005563 | Unclassified | 669 |
| 45 | Ga0068855_101792677 | 3300005563 | Unclassified | 624 |
| 46 | Ga0070664_101408592 | 3300005564 | Bacteria | 659 |
| 47 | Ga0068857_100095323 | 3300005577 | Bacteria | 2666 |
| 48 | Ga0068857_101607871 | 3300005577 | Bacteria | 634 |
| 49 | Ga0068857_102063972 | 3300005577 | Unclassified | 559 |
| 50 | Ga0068856_100030864 | 3300005614 | Bacteria | 5241 |
| 51 | Ga0068856_101539348 | 3300005614 | Bacteria | 679 |
| 52 | Ga0070702_100691741 | 3300005615 | Bacteria | 776 |
| 53 | Ga0068852_100162580 | 3300005616 | Bacteria | 2086 |
| 54 | Ga0068864_100213961 | 3300005618 | Bacteria | 1776 |
| 55 | Ga0068864_100525579 | 3300005618 | Bacteria | 1141 |
| 56 | Ga0068866_10225932 | 3300005718 | Unclassified | 1132 |
| 57 | Ga0068866_10731323 | 3300005718 | Unclassified | 682 |
| 58 | Ga0068861_100426919 | 3300005719 | Bacteria | 1182 |
| 59 | Ga0068851_10154436 | 3300005834 | Bacteria | 1257 |
| 60 | Ga0068851_10950212 | 3300005834 | Unclassified | 540 |
| 61 | Ga0068870_11088427 | 3300005840 | Bacteria | 574 |
| 62 | Ga0068863_100556814 | 3300005841 | Bacteria | 1132 |
| 63 | Ga0068858_100813796 | 3300005842 | Bacteria | 912 |
| 64 | Ga0068858_101145331 | 3300005842 | Bacteria | 764 |
| 65 | Ga0068862_100543124 | 3300005844 | Bacteria | 1109 |
| 66 | Ga0075365_10025856 | 3300006038 | Bacteria | 3720 |
| 67 | Ga0075365_11029808 | 3300006038 | Bacteria | 580 |
| 68 | Ga0075432_10325429 | 3300006058 | Bacteria | 645 |
| 69 | Ga0070712_100163103 | 3300006175 | Bacteria | 1723 |
| 70 | Ga0075428_100796149 | 3300006844 | Bacteria | 1005 |
| 71 | Ga0068865_100334473 | 3300006881 | Unclassified | 1222 |
| 72 | Ga0105240_10733775 | 3300009093 | Bacteria | 1075 |
| 73 | Ga0111539_10056168 | 3300009094 | Bacteria | 4680 |
| 74 | Ga0105245_10001722 | 3300009098 | Bacteria | 19953 |
| 75 | Ga0105245_10115674 | 3300009098 | Bacteria | 2499 |
| 76 | Ga0105245_10385392 | 3300009098 | Bacteria | 1397 |
| 77 | Ga0105245_10401946 | 3300009098 | Bacteria | 1369 |
| 78 | Ga0105245_11387289 | 3300009098 | Unclassified | 752 |
| 79 | Ga0105245_11999705 | 3300009098 | Bacteria | 633 |
| 80 | Ga0105247_11556264 | 3300009101 | Unclassified | 541 |
| 81 | Ga0105243_10150801 | 3300009148 | Bacteria | 1994 |
| 82 | Ga0105243_10234823 | 3300009148 | Bacteria | 1629 |
| 83 | Ga0105243_10329720 | 3300009148 | Bacteria | 1394 |
| 84 | Ga0105243_12183634 | 3300009148 | Unclassified | 590 |
| 85 | Ga0105243_12823481 | 3300009148 | Bacteria | 526 |
| 86 | Ga0105237_10095320 | 3300009545 | Bacteria | 2965 |
| 87 | Ga0105237_12110175 | 3300009545 | Bacteria | 573 |
| 88 | Ga0105238_10357954 | 3300009551 | Bacteria | 1449 |
| 89 | Ga0105238_10474680 | 3300009551 | Bacteria | 1250 |
| 90 | Ga0105238_11349789 | 3300009551 | Unclassified | 740 |
| 91 | Ga0105249_10194220 | 3300009553 | Bacteria | 1983 |
| 92 | Ga0105249_10197790 | 3300009553 | Bacteria | 1965 |
| 93 | Ga0105249_12017415 | 3300009553 | Unclassified | 650 |
| 94 | Ga0105239_10001349 | 3300010375 | Bacteria | 33078 |
| 95 | Ga0105246_10004154 | 3300011119 | Bacteria | 8796 |
| 96 | Ga0105246_10249743 | 3300011119 | Bacteria | 1407 |
| 97 | Ga0105246_10747677 | 3300011119 | Bacteria | 862 |
| 98 | Ga0105246_11061883 | 3300011119 | Bacteria | 737 |
| 99 | Ga0157370_12129810 | 3300013104 | Unclassified | 502 |
| 100 | Ga0157369_10024241 | 3300013105 | Bacteria | 6754 |
| 101 | Ga0157369_10130481 | 3300013105 | Bacteria | 2664 |
| 102 | Ga0157369_10330623 | 3300013105 | Bacteria | 1584 |
| 103 | Ga0157369_11108381 | 3300013105 | Bacteria | 809 |
| 104 | Ga0157369_12106379 | 3300013105 | Bacteria | 572 |
| 105 | Ga0157378_11689358 | 3300013297 | Bacteria | 680 |
| 106 | Ga0163162_10024710 | 3300013306 | Bacteria | 5934 |
| 107 | Ga0163162_10505465 | 3300013306 | Bacteria | 1339 |
| 108 | Ga0163162_10938472 | 3300013306 | Bacteria | 977 |
| 109 | Ga0157372_10333735 | 3300013307 | Bacteria | 1766 |
| 110 | Ga0157372_10337220 | 3300013307 | Bacteria | 1756 |
| 111 | Ga0157372_10744544 | 3300013307 | Bacteria | 1140 |
| 112 | Ga0157372_12586004 | 3300013307 | Bacteria | 583 |
| 113 | Ga0157375_10008571 | 3300013308 | Bacteria | 8952 |
| 114 | Ga0157375_10046518 | 3300013308 | Bacteria | 4232 |
| 115 | Ga0157375_10573084 | 3300013308 | Bacteria | 1289 |
| 116 | Ga0157375_12065663 | 3300013308 | Bacteria | 678 |
| 117 | Ga0157375_12608034 | 3300013308 | Bacteria | 604 |
| 118 | Ga0163163_10527076 | 3300014325 | Bacteria | 1244 |
| 119 | Ga0163163_11046678 | 3300014325 | Unclassified | 879 |
| 120 | Ga0163163_11406279 | 3300014325 | Bacteria | 759 |
| 121 | Ga0157380_10286372 | 3300014326 | Bacteria | 1510 |
| 122 | Ga0157377_10187554 | 3300014745 | Bacteria | 1305 |
| 123 | Ga0157377_10335815 | 3300014745 | Bacteria | 1009 |
| 124 | Ga0157379_10065021 | 3300014968 | Bacteria | 3260 |
| 125 | Ga0157379_10378989 | 3300014968 | Bacteria | 1298 |
| 126 | Ga0157376_10979238 | 3300014969 | Bacteria | 867 |
| 127 | Ga0163161_10206524 | 3300017792 | Bacteria | 1515 |
| 128 | Ga0163161_10268585 | 3300017792 | Bacteria | 1334 |
| 129 | Ga0163161_10747523 | 3300017792 | Unclassified | 818 |
| 130 | Ga0163161_10994715 | 3300017792 | Bacteria | 716 |
| 131 | Ga0197907_11264205 | 3300020069 | Unclassified | 536 |
| 132 | Ga0206353_10952417 | 3300020082 | Unclassified | 1298 |
| 133 | Ga0213876_10066040 | 3300021384 | Bacteria | 1910 |
| 134 | Ga0207642_10634893 | 3300025899 | Unclassified | 668 |
| 135 | Ga0207688_10030686 | 3300025901 | Bacteria | 2964 |
| 136 | Ga0207647_10333077 | 3300025904 | Bacteria | 861 |
| 137 | Ga0207705_10416872 | 3300025909 | Bacteria | 1039 |
| 138 | Ga0207705_10689251 | 3300025909 | Unclassified | 794 |
| 139 | Ga0207660_10087920 | 3300025917 | Bacteria | 2297 |
| 140 | Ga0207657_10005803 | 3300025919 | Bacteria | 12864 |
| 141 | Ga0207649_10348317 | 3300025920 | Bacteria | 1096 |
| 142 | Ga0207652_10033306 | 3300025921 | Bacteria | 4338 |
| 143 | Ga0207652_10776601 | 3300025921 | Unclassified | 852 |
| 144 | Ga0207652_10998663 | 3300025921 | Bacteria | 736 |
| 145 | Ga0207694_10720563 | 3300025924 | Bacteria | 841 |
| 146 | Ga0207687_10108872 | 3300025927 | Bacteria | 2052 |
| 147 | Ga0207687_10286874 | 3300025927 | Bacteria | 1321 |
| 148 | Ga0207687_11362157 | 3300025927 | Unclassified | 610 |
| 149 | Ga0207687_11763762 | 3300025927 | Unclassified | 530 |
| 150 | Ga0207664_11079771 | 3300025929 | Bacteria | 718 |
| 151 | Ga0207690_10154487 | 3300025932 | Bacteria | 1704 |
| 152 | Ga0207709_10268733 | 3300025935 | Bacteria | 1254 |
| 153 | Ga0207709_11728688 | 3300025935 | Unclassified | 520 |
| 154 | Ga0207669_10292110 | 3300025937 | Bacteria | 1235 |
| 155 | Ga0207704_10287240 | 3300025938 | Unclassified | 1253 |
| 156 | Ga0207691_10289588 | 3300025940 | Bacteria | 1408 |
| 157 | Ga0207711_10091413 | 3300025941 | Bacteria | 2677 |
| 158 | Ga0207661_10014311 | 3300025944 | Bacteria | 5812 |
| 159 | Ga0207661_10101107 | 3300025944 | Bacteria | 2421 |
| 160 | Ga0207661_10479235 | 3300025944 | Bacteria | 1136 |
| 161 | Ga0207661_10568888 | 3300025944 | Bacteria | 1039 |
| 162 | Ga0207661_11920398 | 3300025944 | Unclassified | 538 |
| 163 | Ga0207679_10231131 | 3300025945 | Bacteria | 1561 |
| 164 | Ga0207668_11303374 | 3300025972 | Unclassified | 654 |
| 165 | Ga0207703_11633493 | 3300026035 | Bacteria | 620 |
| 166 | Ga0207702_10170493 | 3300026078 | Bacteria | 1995 |
| 167 | Ga0207702_11213807 | 3300026078 | Bacteria | 748 |
| 168 | Ga0207641_10383710 | 3300026088 | Bacteria | 1346 |
| 169 | Ga0207676_10443826 | 3300026095 | Bacteria | 1222 |
| 170 | Ga0207674_11915449 | 3300026116 | Unclassified | 559 |
| 171 | Ga0207675_100883546 | 3300026118 | Unclassified | 909 |
| 172 | Ga0207683_10355054 | 3300026121 | Bacteria | 1346 |
| 173 | Ga0207698_11472384 | 3300026142 | Bacteria | 696 |
| 174 | Ga0207698_12423621 | 3300026142 | Bacteria | 536 |
| 175 | Ga0207428_10359229 | 3300027907 | Bacteria | 1071 |
| 176 | Ga0268265_10455482 | 3300028380 | Bacteria | 1196 |
| 177 | Ga0316575_10241152 | 3300031665 | Unclassified | 757 |
| 178 | Ga0316578_10862565 | 3300031728 | Bacteria | 523 |
| 179 | Ga0316577_10014350 | 3300031733 | Bacteria | 4348 |
| 180 | Ga0307413_11237438 | 3300031824 | Bacteria | 651 |
| 181 | Ga0307410_10042082 | 3300031852 | Bacteria | 3017 |
| 182 | Ga0307406_10061568 | 3300031901 | Unclassified | 2424 |
| 183 | Ga0307406_10582901 | 3300031901 | Bacteria | 920 |
| 184 | Ga0307407_10303580 | 3300031903 | Bacteria | 1114 |
| 185 | Ga0307407_10889218 | 3300031903 | Bacteria | 683 |
| 186 | Ga0307409_100005330 | 3300031995 | Bacteria | 7384 |
| 187 | Ga0307409_100301092 | 3300031995 | Bacteria | 1492 |
| 188 | Ga0307409_100304850 | 3300031995 | Unclassified | 1483 |
| 189 | Ga0307416_100640911 | 3300032002 | Unclassified | 1146 |
| 190 | Ga0307416_101120459 | 3300032002 | Bacteria | 892 |
| 191 | Ga0307416_101237092 | 3300032002 | Bacteria | 852 |
| 192 | Ga0307416_102276050 | 3300032002 | Bacteria | 643 |
| 193 | Ga0307416_102297424 | 3300032002 | Unclassified | 640 |
| 194 | Ga0307415_100228651 | 3300032126 | Unclassified | 1496 |
| 195 | Ga0316580_10017959 | 3300032139 | Bacteria | 2176 |
| 196 | Ga0316574_0069181 | 3300035398 | Bacteria | 2227 |
| 197 | Ga0373931_0329385 | 3300035691 | Bacteria | 951 |
| 198 | Ga0316584_0255852 | 3300036712 | Bacteria | 1278 |
| 199 | Ga0436365_1297167 | 3300039437 | Bacteria | 2434 |
| 200 | Ga0436365_1374999 | 3300039437 | Bacteria | 1918 |
| 201 | Ga0436365_1465922 | 3300039437 | Bacteria | 1045 |
| 202 | Ga0439436_0038467 | 3300041404 | Bacteria | 1376 |
| 203 | Ga0439436_0225624 | 3300041404 | Bacteria | 540 |
| 204 | Ga0451802_2059427 | 3300041460 | Unclassified | 540 |
| 205 | Ga0451841_0613821 | 3300041498 | Unclassified | 965 |
| 206 | Ga0451853_0823676 | 3300041512 | Bacteria | 803 |
| 207 | Ga0451853_0884934 | 3300041512 | Unclassified | 601 |
| 208 | Ga0451853_3014048 | 3300041512 | Bacteria | 560 |
| 209 | Ga0439457_025652 | 3300042014 | Bacteria | 1304 |
| 210 | Ga0439462_0093986 | 3300042015 | Bacteria | 823 |
| 211 | Ga0466972_0479137 | 3300044658 | Bacteria | 585 |
| 212 | Ga0466965_0200588 | 3300044683 | Bacteria | 1058 |
| 213 | Ga0466966_0144652 | 3300044684 | Bacteria | 1452 |
| 214 | Ga0466961_0881414 | 3300044693 | Bacteria | 533 |
| 215 | Ga0466964_0036721 | 3300044706 | Bacteria | 1966 |
| 216 | Ga0466970_0571749 | 3300044765 | Bacteria | 654 |
| 217 | Ga0466960_0055198 | 3300044901 | Bacteria | 1931 |
| 218 | Ga0466960_0178884 | 3300044901 | Bacteria | 1149 |
| 219 | Ga0466960_0408927 | 3300044901 | Bacteria | 783 |
| 220 | Ga0466960_0849192 | 3300044901 | Bacteria | 555 |
| 221 | Ga0451576_0783060 | 3300045051 | Bacteria | 1002 |
| 222 | Ga0466958_0378966 | 3300045836 | Bacteria | 912 |
| 223 | Ga0466967_0057288 | 3300045976 | Bacteria | 3439 |
| 224 | Ga0466967_0876541 | 3300045976 | Bacteria | 892 |
| 225 | Ga0466967_1006178 | 3300045976 | Bacteria | 830 |
| 226 | Ga0466967_1238593 | 3300045976 | Bacteria | 743 |
| 227 | Ga0466967_1389188 | 3300045976 | Bacteria | 699 |
| 228 | Ga0466967_2111468 | 3300045976 | Unclassified | 560 |
| 229 | Ga0466967_2605411 | 3300045976 | Bacteria | 500 |
| 230 | Ga0495656_0293128 | 3300046615 | Bacteria | 832 |
| 231 | Ga0495604_0661149 | 3300047317 | Bacteria | 666 |
| 232 | Ga0495604_1046275 | 3300047317 | Bacteria | 503 |
| 233 | Ga0495676_1049700 | 3300047321 | Unclassified | 519 |
| 234 | Ga0495676_1116173 | 3300047321 | Bacteria | 501 |
| 235 | Ga0495677_0369439 | 3300047445 | Unclassified | 567 |
| 236 | Ga0496100_0129256 | 3300048903 | Bacteria | 1777 |
| 237 | Ga0496100_0144924 | 3300048903 | Unclassified | 1688 |
| 238 | Ga0496100_0396490 | 3300048903 | Bacteria | 1050 |
| 239 | Ga0496100_1549370 | 3300048903 | Unclassified | 524 |
| 240 | Ga0496101_0065131 | 3300048904 | Bacteria | 2656 |
| 241 | Ga0496101_0102035 | 3300048904 | Bacteria | 2149 |
| 242 | Ga0496101_0191570 | 3300048904 | Bacteria | 1578 |
| 243 | Ga0496101_0556514 | 3300048904 | Bacteria | 907 |
| 244 | Ga0496102_0001614 | 3300048905 | Bacteria | 19876 |
| 245 | Ga0496102_0040032 | 3300048905 | Bacteria | 4238 |
| 246 | Ga0496102_0193257 | 3300048905 | Bacteria | 1918 |
| 247 | Ga0496102_0470231 | 3300048905 | Bacteria | 1178 |
| 248 | Ga0496102_1207001 | 3300048905 | Bacteria | 676 |
| 249 | Ga0496103_0007504 | 3300048906 | Bacteria | 6498 |
| 250 | Ga0496103_0122947 | 3300048906 | Bacteria | 1654 |
| 251 | Ga0496104_0218822 | 3300048907 | Bacteria | 1816 |
| 252 | Ga0496104_0641427 | 3300048907 | Bacteria | 971 |
| 253 | Ga0496104_0641482 | 3300048907 | Bacteria | 971 |
| 254 | Ga0496104_1011878 | 3300048907 | Bacteria | 735 |
| 255 | Ga0496105_0001223 | 3300048908 | Bacteria | 17907 |
| 256 | Ga0496105_0059220 | 3300048908 | Bacteria | 3161 |
| 257 | Ga0496105_0212913 | 3300048908 | Unclassified | 1574 |
| 258 | Ga0496105_0766275 | 3300048908 | Bacteria | 736 |
| 259 | Ga0496105_1216767 | 3300048908 | Unclassified | 554 |
| 260 | Ga0496106_0092285 | 3300048909 | Bacteria | 2339 |
| 261 | Ga0496106_0156179 | 3300048909 | Unclassified | 1802 |
| 262 | Ga0496107_0037831 | 3300048910 | Bacteria | 3463 |
| 263 | Ga0496107_0078200 | 3300048910 | Bacteria | 2410 |
| 264 | Ga0496107_0144343 | 3300048910 | Bacteria | 1760 |
| 265 | Ga0496107_0229229 | 3300048910 | Bacteria | 1382 |
| 266 | Ga0496108_0032472 | 3300048911 | Bacteria | 4336 |
| 267 | Ga0496108_0198417 | 3300048911 | Bacteria | 1741 |
| 268 | Ga0496108_0547530 | 3300048911 | Bacteria | 1010 |
| 269 | Ga0496108_0623466 | 3300048911 | Bacteria | 939 |
| 270 | Ga0496109_0009202 | 3300048912 | Bacteria | 8414 |
| 271 | Ga0496109_0057438 | 3300048912 | Bacteria | 3552 |
| 272 | Ga0496109_0069340 | 3300048912 | Bacteria | 3233 |
| 273 | Ga0496109_0205448 | 3300048912 | Unclassified | 1852 |
| 274 | Ga0496109_0521998 | 3300048912 | Unclassified | 1121 |
| 275 | Ga0496109_0707567 | 3300048912 | Bacteria | 945 |
| 276 | Ga0496110_0315188 | 3300048913 | Bacteria | 1424 |
| 277 | Ga0496110_0575528 | 3300048913 | Bacteria | 1023 |
| 278 | Ga0496110_0673059 | 3300048913 | Bacteria | 935 |
| 279 | Ga0496110_0817709 | 3300048913 | Bacteria | 836 |
| 280 | Ga0496110_0873035 | 3300048913 | Unclassified | 805 |
| 281 | Ga0496111_0035789 | 3300048914 | Bacteria | 3549 |
| 282 | Ga0496111_0379125 | 3300048914 | Bacteria | 1046 |
| 283 | Ga0496111_0646010 | 3300048914 | Unclassified | 772 |
| 284 | Ga0496112_0998233 | 3300048915 | Unclassified | 757 |
| 285 | Ga0496113_0068352 | 3300048916 | Bacteria | 2696 |
| 286 | Ga0496113_0223574 | 3300048916 | Bacteria | 1501 |
| 287 | Ga0496113_1193802 | 3300048916 | Bacteria | 594 |
| 288 | Ga0496114_0016166 | 3300048917 | Bacteria | 6006 |
| 289 | Ga0496114_0028798 | 3300048917 | Bacteria | 4561 |
| 290 | Ga0496114_0049658 | 3300048917 | Bacteria | 3491 |
| 291 | Ga0496114_0088717 | 3300048917 | Bacteria | 2623 |
| 292 | Ga0496114_0162377 | 3300048917 | Bacteria | 1943 |
| 293 | Ga0496114_0273946 | 3300048917 | Bacteria | 1487 |
| 294 | Ga0496114_0285840 | 3300048917 | Bacteria | 1455 |
| 295 | Ga0496114_0369861 | 3300048917 | Bacteria | 1269 |
| 296 | Ga0496114_0518163 | 3300048917 | Bacteria | 1054 |
| 297 | Ga0496114_0620271 | 3300048917 | Unclassified | 953 |
| 298 | Ga0496114_0944130 | 3300048917 | Bacteria | 745 |
| 299 | Ga0496114_1190810 | 3300048917 | Bacteria | 648 |
| 300 | Ga0496115_0049753 | 3300048918 | Bacteria | 3356 |
| 301 | Ga0496115_0057866 | 3300048918 | Bacteria | 3118 |
| 302 | Ga0496115_0088233 | 3300048918 | Bacteria | 2532 |
| 303 | Ga0496115_0987702 | 3300048918 | Bacteria | 644 |
| 304 | Ga0496124_0791233 | 3300048927 | Bacteria | 589 |
| 305 | Ga0496126_0097283 | 3300048929 | Bacteria | 2580 |
| 306 | Ga0496126_0852079 | 3300048929 | Unclassified | 695 |
| 307 | Ga0501031_0003404 | 3300049568 | Bacteria | 10207 |
| 308 | Ga0501031_0355672 | 3300049568 | Unclassified | 948 |
| 309 | Ga0501032_0054108 | 3300049569 | Bacteria | 2702 |
| 310 | Ga0501033_0232838 | 3300049570 | Bacteria | 1308 |
| 311 | Ga0501036_0154205 | 3300049572 | Bacteria | 1937 |
| 312 | Ga0501038_0016519 | 3300049574 | Bacteria | 6690 |
| 313 | Ga0501039_0012631 | 3300049575 | Bacteria | 6454 |
| 314 | Ga0501040_0041351 | 3300049576 | Bacteria | 3139 |
| 315 | Ga0501040_1362577 | 3300049576 | Unclassified | 515 |
| 316 | Ga0501041_0024846 | 3300049577 | Bacteria | 3598 |
| 317 | Ga0501042_1204551 | 3300049578 | Unclassified | 552 |
| 318 | Ga0501043_0107671 | 3300049579 | Bacteria | 2189 |
| 319 | Ga0501046_0008641 | 3300049580 | Bacteria | 8855 |
| 320 | Ga0501048_0007832 | 3300049582 | Bacteria | 8094 |
| 321 | Ga0501048_0696846 | 3300049582 | Unclassified | 729 |
| 322 | Ga0501067_0013709 | 3300049583 | Bacteria | 4490 |
| 323 | Ga0501067_0066254 | 3300049583 | Bacteria | 1999 |
| 324 | Ga0501068_0116235 | 3300049584 | Bacteria | 1666 |
| 325 | Ga0501068_0612562 | 3300049584 | Unclassified | 710 |
| 326 | Ga0501069_0025305 | 3300049585 | Bacteria | 3243 |
| 327 | Ga0501069_0044281 | 3300049585 | Bacteria | 2464 |
| 328 | Ga0501070_0029868 | 3300049586 | Bacteria | 4567 |
| 329 | Ga0501070_0568604 | 3300049586 | Bacteria | 906 |
| 330 | Ga0501071_0338144 | 3300049587 | Bacteria | 1144 |
| 331 | Ga0501072_0041184 | 3300049588 | Bacteria | 3627 |
| 332 | Ga0501076_0016415 | 3300049592 | Bacteria | 5614 |
| 333 | Ga0501077_0034666 | 3300049593 | Bacteria | 3212 |
| 334 | Ga0501079_0044977 | 3300049741 | Bacteria | 3407 |
| 335 | Ga0501079_0281760 | 3300049741 | Bacteria | 1300 |
| 336 | Ga0501081_0055570 | 3300049743 | Bacteria | 2735 |
| 337 | Ga0501035_0135658 | 3300049822 | Bacteria | 2143 |
| 338 | Ga0501045_0009840 | 3300049824 | Bacteria | 6690 |
| 339 | Ga0501045_0295306 | 3300049824 | Bacteria | 1206 |
| 340 | nmdc:mga0yw44_510773_c1 | 3300050492 | Bacteria | 815 |
| 341 | nmdc:mga0yw44_74778_c1 | 3300050492 | Bacteria | 2111 |
| 342 | nmdc:mga08y16_96490_c1 | 3300050511 | Bacteria | 3079 |
| 343 | Ga0495601_0486657 | 3300053077 | Bacteria | 797 |
| 344 | Ga0495595_0562245 | 3300053084 | Bacteria | 583 |
| 345 | Ga0495619_0023977 | 3300053085 | Bacteria | 3913 |
| 346 | Ga0501084_0007169 | 3300054114 | Bacteria | 9182 |
| 347 | Ga0501082_0533162 | 3300060353 | Bacteria | 1026 |
| 348 | Ga0530510_0011878 | 3300061734 | Bacteria | 6111 |
| 349 | Ga0530510_1377287 | 3300061734 | Unclassified | 541 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0088233 | Ga0496115_0088233_440_760 | 106 |
| 2 | 3300005366 | Ga0070659_100263581 | Ga0070659_1002635811 | 108 |
| 3 | 3300032002 | Ga0307416_102276050 | Ga0307416_1022760502 | 108 |
| 4 | 3300045976 | Ga0466967_1238593 | Ga0466967_1238593_71_397 | 108 |
| 5 | 3300005329 | Ga0070683_100206075 | Ga0070683_1002060752 | 109 |
| 6 | 3300005335 | Ga0070666_11521151 | Ga0070666_115211511 | 109 |
| 7 | 3300005337 | Ga0070682_100998601 | Ga0070682_1009986012 | 109 |
| 8 | 3300005356 | Ga0070674_100305245 | Ga0070674_1003052452 | 109 |
| 9 | 3300005366 | Ga0070659_100511754 | Ga0070659_1005117542 | 109 |
| 10 | 3300005530 | Ga0070679_101315810 | Ga0070679_1013158101 | 109 |
| 11 | 3300005544 | Ga0070686_100778737 | Ga0070686_1007787372 | 109 |
| 12 | 3300005548 | Ga0070665_101203776 | Ga0070665_1012037762 | 109 |
| 13 | 3300005564 | Ga0070664_101408592 | Ga0070664_1014085922 | 109 |
| 14 | 3300005577 | Ga0068857_102063972 | Ga0068857_1020639722 | 109 |
| 15 | 3300005718 | Ga0068866_10731323 | Ga0068866_107313231 | 109 |
| 16 | 3300005834 | Ga0068851_10950212 | Ga0068851_109502121 | 109 |
| 17 | 3300006175 | Ga0070712_100163103 | Ga0070712_1001631032 | 109 |
| 18 | 3300009148 | Ga0105243_10234823 | Ga0105243_102348231 | 109 |
| 19 | 3300009148 | Ga0105243_12823481 | Ga0105243_128234811 | 109 |
| 20 | 3300009553 | Ga0105249_12017415 | Ga0105249_120174152 | 109 |
| 21 | 3300011119 | Ga0105246_10249743 | Ga0105246_102497432 | 109 |
| 22 | 3300011119 | Ga0105246_11061883 | Ga0105246_110618832 | 109 |
| 23 | 3300014325 | Ga0163163_11046678 | Ga0163163_110466782 | 109 |
| 24 | 3300014325 | Ga0163163_11406279 | Ga0163163_114062791 | 109 |
| 25 | 3300014326 | Ga0157380_10286372 | Ga0157380_102863722 | 109 |
| 26 | 3300017792 | Ga0163161_10747523 | Ga0163161_107475232 | 109 |
| 27 | 3300025899 | Ga0207642_10634893 | Ga0207642_106348931 | 109 |
| 28 | 3300025909 | Ga0207705_10689251 | Ga0207705_106892512 | 109 |
| 29 | 3300025921 | Ga0207652_10998663 | Ga0207652_109986632 | 109 |
| 30 | 3300025935 | Ga0207709_11728688 | Ga0207709_117286881 | 109 |
| 31 | 3300025941 | Ga0207711_10091413 | Ga0207711_100914133 | 109 |
| 32 | 3300025944 | Ga0207661_10479235 | Ga0207661_104792352 | 109 |
| 33 | 3300025944 | Ga0207661_10568888 | Ga0207661_105688882 | 109 |
| 34 | 3300026116 | Ga0207674_11915449 | Ga0207674_119154492 | 109 |
| 35 | 3300031903 | Ga0307407_10889218 | Ga0307407_108892181 | 109 |
| 36 | 3300048905 | Ga0496102_1207001 | Ga0496102_1207001_313_642 | 109 |
| 37 | 3300048907 | Ga0496104_1011878 | Ga0496104_1011878_113_442 | 109 |
| 38 | 3300048908 | Ga0496105_0766275 | Ga0496105_0766275_342_671 | 109 |
| 39 | 3300048913 | Ga0496110_0673059 | Ga0496110_0673059_430_759 | 109 |
| 40 | 3300048916 | Ga0496113_1193802 | Ga0496113_1193802_179_508 | 109 |
| 41 | 3300005327 | Ga0070658_10293964 | Ga0070658_102939642 | 110 |
| 42 | 3300005327 | Ga0070658_10997872 | Ga0070658_109978721 | 110 |
| 43 | 3300005329 | Ga0070683_100010577 | Ga0070683_1000105777 | 110 |
| 44 | 3300005329 | Ga0070683_100206457 | Ga0070683_1002064572 | 110 |
| 45 | 3300005329 | Ga0070683_100371264 | Ga0070683_1003712642 | 110 |
| 46 | 3300005331 | Ga0070670_100311840 | Ga0070670_1003118401 | 110 |
| 47 | 3300005336 | Ga0070680_100107870 | Ga0070680_1001078702 | 110 |
| 48 | 3300005337 | Ga0070682_100023048 | Ga0070682_1000230482 | 110 |
| 49 | 3300005337 | Ga0070682_100394465 | Ga0070682_1003944651 | 110 |
| 50 | 3300005338 | Ga0068868_101132028 | Ga0068868_1011320282 | 110 |
| 51 | 3300005339 | Ga0070660_100010467 | Ga0070660_1000104677 | 110 |
| 52 | 3300005344 | Ga0070661_100361725 | Ga0070661_1003617252 | 110 |
| 53 | 3300005347 | Ga0070668_101159045 | Ga0070668_1011590451 | 110 |
| 54 | 3300005354 | Ga0070675_100543337 | Ga0070675_1005433372 | 110 |
| 55 | 3300005364 | Ga0070673_101450932 | Ga0070673_1014509321 | 110 |
| 56 | 3300005366 | Ga0070659_100028278 | Ga0070659_1000282782 | 110 |
| 57 | 3300005367 | Ga0070667_102040263 | Ga0070667_1020402631 | 110 |
| 58 | 3300005434 | Ga0070709_11689684 | Ga0070709_116896841 | 110 |
| 59 | 3300005435 | Ga0070714_101275268 | Ga0070714_1012752681 | 110 |
| 60 | 3300005436 | Ga0070713_101031607 | Ga0070713_1010316072 | 110 |
| 61 | 3300005456 | Ga0070678_100746592 | Ga0070678_1007465922 | 110 |
| 62 | 3300005457 | Ga0070662_100946315 | Ga0070662_1009463151 | 110 |
| 63 | 3300005466 | Ga0070685_10585143 | Ga0070685_105851431 | 110 |
| 64 | 3300005530 | Ga0070679_100524942 | Ga0070679_1005249421 | 110 |
| 65 | 3300005535 | Ga0070684_100183857 | Ga0070684_1001838572 | 110 |
| 66 | 3300005535 | Ga0070684_100432739 | Ga0070684_1004327391 | 110 |
| 67 | 3300005535 | Ga0070684_100466925 | Ga0070684_1004669252 | 110 |
| 68 | 3300005535 | Ga0070684_101680702 | Ga0070684_1016807022 | 110 |
| 69 | 3300005539 | Ga0068853_100314345 | Ga0068853_1003143452 | 110 |
| 70 | 3300005544 | Ga0070686_100106776 | Ga0070686_1001067762 | 110 |
| 71 | 3300005547 | Ga0070693_100143970 | Ga0070693_1001439701 | 110 |
| 72 | 3300005547 | Ga0070693_100292182 | Ga0070693_1002921822 | 110 |
| 73 | 3300005548 | Ga0070665_100511933 | Ga0070665_1005119331 | 110 |
| 74 | 3300005563 | Ga0068855_100443250 | Ga0068855_1004432502 | 110 |
| 75 | 3300005563 | Ga0068855_101589793 | Ga0068855_1015897932 | 110 |
| 76 | 3300005563 | Ga0068855_101792677 | Ga0068855_1017926771 | 110 |
| 77 | 3300005577 | Ga0068857_100095323 | Ga0068857_1000953232 | 110 |
| 78 | 3300005577 | Ga0068857_101607871 | Ga0068857_1016078711 | 110 |
| 79 | 3300005614 | Ga0068856_100030864 | Ga0068856_1000308643 | 110 |
| 80 | 3300005614 | Ga0068856_101539348 | Ga0068856_1015393481 | 110 |
| 81 | 3300005615 | Ga0070702_100691741 | Ga0070702_1006917411 | 110 |
| 82 | 3300005616 | Ga0068852_100162580 | Ga0068852_1001625802 | 110 |
| 83 | 3300005618 | Ga0068864_100213961 | Ga0068864_1002139612 | 110 |
| 84 | 3300005618 | Ga0068864_100525579 | Ga0068864_1005255792 | 110 |
| 85 | 3300005718 | Ga0068866_10225932 | Ga0068866_102259322 | 110 |
| 86 | 3300005719 | Ga0068861_100426919 | Ga0068861_1004269192 | 110 |
| 87 | 3300005834 | Ga0068851_10154436 | Ga0068851_101544362 | 110 |
| 88 | 3300005840 | Ga0068870_11088427 | Ga0068870_110884272 | 110 |
| 89 | 3300005841 | Ga0068863_100556814 | Ga0068863_1005568142 | 110 |
| 90 | 3300005842 | Ga0068858_100813796 | Ga0068858_1008137962 | 110 |
| 91 | 3300005842 | Ga0068858_101145331 | Ga0068858_1011453312 | 110 |
| 92 | 3300005844 | Ga0068862_100543124 | Ga0068862_1005431242 | 110 |
| 93 | 3300006038 | Ga0075365_10025856 | Ga0075365_100258565 | 110 |
| 94 | 3300006038 | Ga0075365_11029808 | Ga0075365_110298081 | 110 |
| 95 | 3300006058 | Ga0075432_10325429 | Ga0075432_103254292 | 110 |
| 96 | 3300006844 | Ga0075428_100796149 | Ga0075428_1007961493 | 110 |
| 97 | 3300006881 | Ga0068865_100334473 | Ga0068865_1003344731 | 110 |
| 98 | 3300009093 | Ga0105240_10733775 | Ga0105240_107337753 | 110 |
| 99 | 3300009094 | Ga0111539_10056168 | Ga0111539_100561683 | 110 |
| 100 | 3300009098 | Ga0105245_10001722 | Ga0105245_100017222 | 110 |
| 101 | 3300009098 | Ga0105245_10115674 | Ga0105245_101156743 | 110 |
| 102 | 3300009098 | Ga0105245_10385392 | Ga0105245_103853922 | 110 |
| 103 | 3300009098 | Ga0105245_10401946 | Ga0105245_104019462 | 110 |
| 104 | 3300009098 | Ga0105245_11387289 | Ga0105245_113872891 | 110 |
| 105 | 3300009098 | Ga0105245_11999705 | Ga0105245_119997051 | 110 |
| 106 | 3300009101 | Ga0105247_11556264 | Ga0105247_115562641 | 110 |
| 107 | 3300009148 | Ga0105243_10150801 | Ga0105243_101508012 | 110 |
| 108 | 3300009148 | Ga0105243_10329720 | Ga0105243_103297202 | 110 |
| 109 | 3300009148 | Ga0105243_12183634 | Ga0105243_121836342 | 110 |
| 110 | 3300009545 | Ga0105237_10095320 | Ga0105237_100953203 | 110 |
| 111 | 3300009545 | Ga0105237_12110175 | Ga0105237_121101752 | 110 |
| 112 | 3300009551 | Ga0105238_10357954 | Ga0105238_103579542 | 110 |
| 113 | 3300009551 | Ga0105238_10474680 | Ga0105238_104746802 | 110 |
| 114 | 3300009551 | Ga0105238_11349789 | Ga0105238_113497892 | 110 |
| 115 | 3300009553 | Ga0105249_10194220 | Ga0105249_101942203 | 110 |
| 116 | 3300009553 | Ga0105249_10197790 | Ga0105249_101977902 | 110 |
| 117 | 3300010375 | Ga0105239_10001349 | Ga0105239_1000134931 | 110 |
| 118 | 3300011119 | Ga0105246_10004154 | Ga0105246_100041547 | 110 |
| 119 | 3300011119 | Ga0105246_10747677 | Ga0105246_107476772 | 110 |
| 120 | 3300013104 | Ga0157370_12129810 | Ga0157370_121298101 | 110 |
| 121 | 3300013105 | Ga0157369_10024241 | Ga0157369_100242417 | 110 |
| 122 | 3300013105 | Ga0157369_10130481 | Ga0157369_101304812 | 110 |
| 123 | 3300013105 | Ga0157369_10330623 | Ga0157369_103306232 | 110 |
| 124 | 3300013105 | Ga0157369_11108381 | Ga0157369_111083811 | 110 |
| 125 | 3300013105 | Ga0157369_12106379 | Ga0157369_121063791 | 110 |
| 126 | 3300013297 | Ga0157378_11689358 | Ga0157378_116893581 | 110 |
| 127 | 3300013306 | Ga0163162_10024710 | Ga0163162_100247101 | 110 |
| 128 | 3300013306 | Ga0163162_10505465 | Ga0163162_105054652 | 110 |
| 129 | 3300013306 | Ga0163162_10938472 | Ga0163162_109384722 | 110 |
| 130 | 3300013307 | Ga0157372_10333735 | Ga0157372_103337352 | 110 |
| 131 | 3300013307 | Ga0157372_10337220 | Ga0157372_103372202 | 110 |
| 132 | 3300013307 | Ga0157372_10744544 | Ga0157372_107445442 | 110 |
| 133 | 3300013307 | Ga0157372_12586004 | Ga0157372_125860042 | 110 |
| 134 | 3300013308 | Ga0157375_10008571 | Ga0157375_100085715 | 110 |
| 135 | 3300013308 | Ga0157375_10046518 | Ga0157375_100465183 | 110 |
| 136 | 3300013308 | Ga0157375_10573084 | Ga0157375_105730841 | 110 |
| 137 | 3300013308 | Ga0157375_12065663 | Ga0157375_120656632 | 110 |
| 138 | 3300013308 | Ga0157375_12608034 | Ga0157375_126080342 | 110 |
| 139 | 3300014325 | Ga0163163_10527076 | Ga0163163_105270762 | 110 |
| 140 | 3300014745 | Ga0157377_10187554 | Ga0157377_101875542 | 110 |
| 141 | 3300014745 | Ga0157377_10335815 | Ga0157377_103358152 | 110 |
| 142 | 3300014968 | Ga0157379_10065021 | Ga0157379_100650213 | 110 |
| 143 | 3300014968 | Ga0157379_10378989 | Ga0157379_103789893 | 110 |
| 144 | 3300014969 | Ga0157376_10979238 | Ga0157376_109792382 | 110 |
| 145 | 3300017792 | Ga0163161_10206524 | Ga0163161_102065242 | 110 |
| 146 | 3300017792 | Ga0163161_10268585 | Ga0163161_102685851 | 110 |
| 147 | 3300017792 | Ga0163161_10994715 | Ga0163161_109947151 | 110 |
| 148 | 3300020069 | Ga0197907_11264205 | Ga0197907_112642051 | 110 |
| 149 | 3300020082 | Ga0206353_10952417 | Ga0206353_109524172 | 110 |
| 150 | 3300021384 | Ga0213876_10066040 | Ga0213876_100660401 | 110 |
| 151 | 3300025901 | Ga0207688_10030686 | Ga0207688_100306862 | 110 |
| 152 | 3300025904 | Ga0207647_10333077 | Ga0207647_103330771 | 110 |
| 153 | 3300025909 | Ga0207705_10416872 | Ga0207705_104168722 | 110 |
| 154 | 3300025917 | Ga0207660_10087920 | Ga0207660_100879202 | 110 |
| 155 | 3300025919 | Ga0207657_10005803 | Ga0207657_100058036 | 110 |
| 156 | 3300025920 | Ga0207649_10348317 | Ga0207649_103483172 | 110 |
| 157 | 3300025921 | Ga0207652_10033306 | Ga0207652_100333063 | 110 |
| 158 | 3300025921 | Ga0207652_10776601 | Ga0207652_107766011 | 110 |
| 159 | 3300025924 | Ga0207694_10720563 | Ga0207694_107205632 | 110 |
| 160 | 3300025927 | Ga0207687_10108872 | Ga0207687_101088723 | 110 |
| 161 | 3300025927 | Ga0207687_10286874 | Ga0207687_102868742 | 110 |
| 162 | 3300025927 | Ga0207687_11362157 | Ga0207687_113621571 | 110 |
| 163 | 3300025927 | Ga0207687_11763762 | Ga0207687_117637621 | 110 |
| 164 | 3300025929 | Ga0207664_11079771 | Ga0207664_110797712 | 110 |
| 165 | 3300025932 | Ga0207690_10154487 | Ga0207690_101544872 | 110 |
| 166 | 3300025935 | Ga0207709_10268733 | Ga0207709_102687332 | 110 |
| 167 | 3300025937 | Ga0207669_10292110 | Ga0207669_102921102 | 110 |
| 168 | 3300025938 | Ga0207704_10287240 | Ga0207704_102872401 | 110 |
| 169 | 3300025940 | Ga0207691_10289588 | Ga0207691_102895882 | 110 |
| 170 | 3300025944 | Ga0207661_10014311 | Ga0207661_100143114 | 110 |
| 171 | 3300025944 | Ga0207661_10101107 | Ga0207661_101011072 | 110 |
| 172 | 3300025944 | Ga0207661_11920398 | Ga0207661_119203981 | 110 |
| 173 | 3300025945 | Ga0207679_10231131 | Ga0207679_102311312 | 110 |
| 174 | 3300025972 | Ga0207668_11303374 | Ga0207668_113033741 | 110 |
| 175 | 3300026035 | Ga0207703_11633493 | Ga0207703_116334931 | 110 |
| 176 | 3300026078 | Ga0207702_10170493 | Ga0207702_101704933 | 110 |
| 177 | 3300026078 | Ga0207702_11213807 | Ga0207702_112138072 | 110 |
| 178 | 3300026088 | Ga0207641_10383710 | Ga0207641_103837102 | 110 |
| 179 | 3300026095 | Ga0207676_10443826 | Ga0207676_104438262 | 110 |
| 180 | 3300026118 | Ga0207675_100883546 | Ga0207675_1008835462 | 110 |
| 181 | 3300026121 | Ga0207683_10355054 | Ga0207683_103550542 | 110 |
| 182 | 3300026142 | Ga0207698_11472384 | Ga0207698_114723842 | 110 |
| 183 | 3300026142 | Ga0207698_12423621 | Ga0207698_124236211 | 110 |
| 184 | 3300027907 | Ga0207428_10359229 | Ga0207428_103592291 | 110 |
| 185 | 3300028380 | Ga0268265_10455482 | Ga0268265_104554822 | 110 |
| 186 | 3300031665 | Ga0316575_10241152 | Ga0316575_102411521 | 110 |
| 187 | 3300031728 | Ga0316578_10862565 | Ga0316578_108625651 | 110 |
| 188 | 3300031733 | Ga0316577_10014350 | Ga0316577_100143502 | 110 |
| 189 | 3300031824 | Ga0307413_11237438 | Ga0307413_112374382 | 110 |
| 190 | 3300031852 | Ga0307410_10042082 | Ga0307410_100420821 | 110 |
| 191 | 3300031901 | Ga0307406_10061568 | Ga0307406_100615682 | 110 |
| 192 | 3300031901 | Ga0307406_10582901 | Ga0307406_105829012 | 110 |
| 193 | 3300031903 | Ga0307407_10303580 | Ga0307407_103035802 | 110 |
| 194 | 3300031995 | Ga0307409_100005330 | Ga0307409_1000053304 | 110 |
| 195 | 3300031995 | Ga0307409_100301092 | Ga0307409_1003010922 | 110 |
| 196 | 3300031995 | Ga0307409_100304850 | Ga0307409_1003048502 | 110 |
| 197 | 3300032002 | Ga0307416_100640911 | Ga0307416_1006409112 | 110 |
| 198 | 3300032002 | Ga0307416_101120459 | Ga0307416_1011204592 | 110 |
| 199 | 3300032002 | Ga0307416_101237092 | Ga0307416_1012370922 | 110 |
| 200 | 3300032002 | Ga0307416_102297424 | Ga0307416_1022974241 | 110 |
| 201 | 3300032126 | Ga0307415_100228651 | Ga0307415_1002286512 | 110 |
| 202 | 3300032139 | Ga0316580_10017959 | Ga0316580_100179592 | 110 |
| 203 | 3300035398 | Ga0316574_0069181 | Ga0316574_0069181_143_475 | 110 |
| 204 | 3300035691 | Ga0373931_0329385 | Ga0373931_0329385_27_359 | 110 |
| 205 | 3300036712 | Ga0316584_0255852 | Ga0316584_0255852_199_531 | 110 |
| 206 | 3300039437 | Ga0436365_1297167 | Ga0436365_1297167_372_704 | 110 |
| 207 | 3300039437 | Ga0436365_1374999 | Ga0436365_1374999_667_999 | 110 |
| 208 | 3300039437 | Ga0436365_1465922 | Ga0436365_1465922_274_606 | 110 |
| 209 | 3300041404 | Ga0439436_0038467 | Ga0439436_0038467_559_891 | 110 |
| 210 | 3300041404 | Ga0439436_0225624 | Ga0439436_0225624_48_380 | 110 |
| 211 | 3300041460 | Ga0451802_2059427 | Ga0451802_2059427_78_410 | 110 |
| 212 | 3300041498 | Ga0451841_0613821 | Ga0451841_0613821_397_729 | 110 |
| 213 | 3300041512 | Ga0451853_0823676 | Ga0451853_0823676_101_433 | 110 |
| 214 | 3300041512 | Ga0451853_0884934 | Ga0451853_0884934_76_408 | 110 |
| 215 | 3300041512 | Ga0451853_3014048 | Ga0451853_3014048_108_440 | 110 |
| 216 | 3300042014 | Ga0439457_025652 | Ga0439457_025652_915_1247 | 110 |
| 217 | 3300042015 | Ga0439462_0093986 | Ga0439462_0093986_432_764 | 110 |
| 218 | 3300044658 | Ga0466972_0479137 | Ga0466972_0479137_72_404 | 110 |
| 219 | 3300044683 | Ga0466965_0200588 | Ga0466965_0200588_376_708 | 110 |
| 220 | 3300044684 | Ga0466966_0144652 | Ga0466966_0144652_644_976 | 110 |
| 221 | 3300044693 | Ga0466961_0881414 | Ga0466961_0881414_14_346 | 110 |
| 222 | 3300044706 | Ga0466964_0036721 | Ga0466964_0036721_1444_1776 | 110 |
| 223 | 3300044765 | Ga0466970_0571749 | Ga0466970_0571749_94_426 | 110 |
| 224 | 3300044901 | Ga0466960_0055198 | Ga0466960_0055198_1456_1788 | 110 |
| 225 | 3300044901 | Ga0466960_0178884 | Ga0466960_0178884_731_1063 | 110 |
| 226 | 3300044901 | Ga0466960_0408927 | Ga0466960_0408927_431_763 | 110 |
| 227 | 3300044901 | Ga0466960_0849192 | Ga0466960_0849192_207_539 | 110 |
| 228 | 3300045051 | Ga0451576_0783060 | Ga0451576_0783060_595_927 | 110 |
| 229 | 3300045836 | Ga0466958_0378966 | Ga0466958_0378966_497_829 | 110 |
| 230 | 3300045976 | Ga0466967_0057288 | Ga0466967_0057288_838_1170 | 110 |
| 231 | 3300045976 | Ga0466967_0876541 | Ga0466967_0876541_239_571 | 110 |
| 232 | 3300045976 | Ga0466967_1006178 | Ga0466967_1006178_35_367 | 110 |
| 233 | 3300045976 | Ga0466967_1389188 | Ga0466967_1389188_169_501 | 110 |
| 234 | 3300045976 | Ga0466967_2111468 | Ga0466967_2111468_65_397 | 110 |
| 235 | 3300045976 | Ga0466967_2605411 | Ga0466967_2605411_105_437 | 110 |
| 236 | 3300046615 | Ga0495656_0293128 | Ga0495656_0293128_233_565 | 110 |
| 237 | 3300047317 | Ga0495604_0661149 | Ga0495604_0661149_308_643 | 110 |
| 238 | 3300047317 | Ga0495604_1046275 | Ga0495604_1046275_122_454 | 110 |
| 239 | 3300047321 | Ga0495676_1049700 | Ga0495676_1049700_39_374 | 110 |
| 240 | 3300047321 | Ga0495676_1116173 | Ga0495676_1116173_139_471 | 110 |
| 241 | 3300047445 | Ga0495677_0369439 | Ga0495677_0369439_74_409 | 110 |
| 242 | 3300048903 | Ga0496100_0129256 | Ga0496100_0129256_182_514 | 110 |
| 243 | 3300048903 | Ga0496100_0144924 | Ga0496100_0144924_926_1321 | 110 |
| 244 | 3300048903 | Ga0496100_0396490 | Ga0496100_0396490_362_694 | 110 |
| 245 | 3300048903 | Ga0496100_1549370 | Ga0496100_1549370_128_460 | 110 |
| 246 | 3300048904 | Ga0496101_0065131 | Ga0496101_0065131_2004_2336 | 110 |
| 247 | 3300048904 | Ga0496101_0102035 | Ga0496101_0102035_1777_2109 | 110 |
| 248 | 3300048904 | Ga0496101_0191570 | Ga0496101_0191570_876_1208 | 110 |
| 249 | 3300048904 | Ga0496101_0556514 | Ga0496101_0556514_245_577 | 110 |
| 250 | 3300048905 | Ga0496102_0001614 | Ga0496102_0001614_4596_4928 | 110 |
| 251 | 3300048905 | Ga0496102_0040032 | Ga0496102_0040032_807_1139 | 110 |
| 252 | 3300048905 | Ga0496102_0193257 | Ga0496102_0193257_747_1079 | 110 |
| 253 | 3300048905 | Ga0496102_0470231 | Ga0496102_0470231_66_461 | 110 |
| 254 | 3300048906 | Ga0496103_0007504 | Ga0496103_0007504_572_904 | 110 |
| 255 | 3300048906 | Ga0496103_0122947 | Ga0496103_0122947_30_362 | 110 |
| 256 | 3300048907 | Ga0496104_0218822 | Ga0496104_0218822_462_794 | 110 |
| 257 | 3300048907 | Ga0496104_0641427 | Ga0496104_0641427_150_482 | 110 |
| 258 | 3300048907 | Ga0496104_0641482 | Ga0496104_0641482_360_695 | 110 |
| 259 | 3300048908 | Ga0496105_0001223 | Ga0496105_0001223_2430_2762 | 110 |
| 260 | 3300048908 | Ga0496105_0059220 | Ga0496105_0059220_2329_2664 | 110 |
| 261 | 3300048908 | Ga0496105_0212913 | Ga0496105_0212913_953_1348 | 110 |
| 262 | 3300048908 | Ga0496105_1216767 | Ga0496105_1216767_173_505 | 110 |
| 263 | 3300048909 | Ga0496106_0092285 | Ga0496106_0092285_1906_2238 | 110 |
| 264 | 3300048909 | Ga0496106_0156179 | Ga0496106_0156179_925_1257 | 110 |
| 265 | 3300048910 | Ga0496107_0037831 | Ga0496107_0037831_551_883 | 110 |
| 266 | 3300048910 | Ga0496107_0078200 | Ga0496107_0078200_766_1098 | 110 |
| 267 | 3300048910 | Ga0496107_0144343 | Ga0496107_0144343_1100_1432 | 110 |
| 268 | 3300048910 | Ga0496107_0229229 | Ga0496107_0229229_44_439 | 110 |
| 269 | 3300048911 | Ga0496108_0032472 | Ga0496108_0032472_3590_3922 | 110 |
| 270 | 3300048911 | Ga0496108_0198417 | Ga0496108_0198417_245_577 | 110 |
| 271 | 3300048911 | Ga0496108_0547530 | Ga0496108_0547530_297_629 | 110 |
| 272 | 3300048911 | Ga0496108_0623466 | Ga0496108_0623466_241_573 | 110 |
| 273 | 3300048912 | Ga0496109_0009202 | Ga0496109_0009202_1982_2314 | 110 |
| 274 | 3300048912 | Ga0496109_0057438 | Ga0496109_0057438_2709_3041 | 110 |
| 275 | 3300048912 | Ga0496109_0069340 | Ga0496109_0069340_35_367 | 110 |
| 276 | 3300048912 | Ga0496109_0205448 | Ga0496109_0205448_963_1295 | 110 |
| 277 | 3300048912 | Ga0496109_0521998 | Ga0496109_0521998_746_1078 | 110 |
| 278 | 3300048912 | Ga0496109_0707567 | Ga0496109_0707567_220_552 | 110 |
| 279 | 3300048913 | Ga0496110_0315188 | Ga0496110_0315188_394_726 | 110 |
| 280 | 3300048913 | Ga0496110_0575528 | Ga0496110_0575528_224_556 | 110 |
| 281 | 3300048913 | Ga0496110_0817709 | Ga0496110_0817709_368_700 | 110 |
| 282 | 3300048913 | Ga0496110_0873035 | Ga0496110_0873035_459_791 | 110 |
| 283 | 3300048914 | Ga0496111_0035789 | Ga0496111_0035789_190_522 | 110 |
| 284 | 3300048914 | Ga0496111_0379125 | Ga0496111_0379125_622_954 | 110 |
| 285 | 3300048914 | Ga0496111_0646010 | Ga0496111_0646010_418_750 | 110 |
| 286 | 3300048915 | Ga0496112_0998233 | Ga0496112_0998233_349_681 | 110 |
| 287 | 3300048916 | Ga0496113_0068352 | Ga0496113_0068352_2265_2597 | 110 |
| 288 | 3300048916 | Ga0496113_0223574 | Ga0496113_0223574_215_547 | 110 |
| 289 | 3300048917 | Ga0496114_0016166 | Ga0496114_0016166_247_642 | 110 |
| 290 | 3300048917 | Ga0496114_0028798 | Ga0496114_0028798_1489_1821 | 110 |
| 291 | 3300048917 | Ga0496114_0049658 | Ga0496114_0049658_1634_1966 | 110 |
| 292 | 3300048917 | Ga0496114_0088717 | Ga0496114_0088717_134_466 | 110 |
| 293 | 3300048917 | Ga0496114_0162377 | Ga0496114_0162377_294_626 | 110 |
| 294 | 3300048917 | Ga0496114_0273946 | Ga0496114_0273946_59_391 | 110 |
| 295 | 3300048917 | Ga0496114_0285840 | Ga0496114_0285840_535_867 | 110 |
| 296 | 3300048917 | Ga0496114_0369861 | Ga0496114_0369861_360_692 | 110 |
| 297 | 3300048917 | Ga0496114_0518163 | Ga0496114_0518163_389_721 | 110 |
| 298 | 3300048917 | Ga0496114_0620271 | Ga0496114_0620271_86_418 | 110 |
| 299 | 3300048917 | Ga0496114_0944130 | Ga0496114_0944130_399_731 | 110 |
| 300 | 3300048917 | Ga0496114_1190810 | Ga0496114_1190810_15_350 | 110 |
| 301 | 3300048918 | Ga0496115_0049753 | Ga0496115_0049753_1804_2199 | 110 |
| 302 | 3300048918 | Ga0496115_0057866 | Ga0496115_0057866_2166_2498 | 110 |
| 303 | 3300048918 | Ga0496115_0987702 | Ga0496115_0987702_12_344 | 110 |
| 304 | 3300048927 | Ga0496124_0791233 | Ga0496124_0791233_241_573 | 110 |
| 305 | 3300048929 | Ga0496126_0097283 | Ga0496126_0097283_1809_2141 | 110 |
| 306 | 3300048929 | Ga0496126_0852079 | Ga0496126_0852079_291_623 | 110 |
| 307 | 3300049568 | Ga0501031_0003404 | Ga0501031_0003404_2332_2664 | 110 |
| 308 | 3300049568 | Ga0501031_0355672 | Ga0501031_0355672_351_683 | 110 |
| 309 | 3300049569 | Ga0501032_0054108 | Ga0501032_0054108_1768_2100 | 110 |
| 310 | 3300049570 | Ga0501033_0232838 | Ga0501033_0232838_194_526 | 110 |
| 311 | 3300049572 | Ga0501036_0154205 | Ga0501036_0154205_434_766 | 110 |
| 312 | 3300049574 | Ga0501038_0016519 | Ga0501038_0016519_221_553 | 110 |
| 313 | 3300049575 | Ga0501039_0012631 | Ga0501039_0012631_2158_2490 | 110 |
| 314 | 3300049576 | Ga0501040_0041351 | Ga0501040_0041351_2425_2757 | 110 |
| 315 | 3300049576 | Ga0501040_1362577 | Ga0501040_1362577_46_378 | 110 |
| 316 | 3300049577 | Ga0501041_0024846 | Ga0501041_0024846_926_1258 | 110 |
| 317 | 3300049578 | Ga0501042_1204551 | Ga0501042_1204551_207_539 | 110 |
| 318 | 3300049579 | Ga0501043_0107671 | Ga0501043_0107671_1592_1924 | 110 |
| 319 | 3300049580 | Ga0501046_0008641 | Ga0501046_0008641_932_1264 | 110 |
| 320 | 3300049582 | Ga0501048_0007832 | Ga0501048_0007832_1741_2073 | 110 |
| 321 | 3300049582 | Ga0501048_0696846 | Ga0501048_0696846_292_624 | 110 |
| 322 | 3300049583 | Ga0501067_0013709 | Ga0501067_0013709_2424_2756 | 110 |
| 323 | 3300049583 | Ga0501067_0066254 | Ga0501067_0066254_811_1143 | 110 |
| 324 | 3300049584 | Ga0501068_0116235 | Ga0501068_0116235_590_922 | 110 |
| 325 | 3300049584 | Ga0501068_0612562 | Ga0501068_0612562_252_584 | 110 |
| 326 | 3300049585 | Ga0501069_0025305 | Ga0501069_0025305_1280_1612 | 110 |
| 327 | 3300049585 | Ga0501069_0044281 | Ga0501069_0044281_818_1150 | 110 |
| 328 | 3300049586 | Ga0501070_0029868 | Ga0501070_0029868_2034_2366 | 110 |
| 329 | 3300049586 | Ga0501070_0568604 | Ga0501070_0568604_287_619 | 110 |
| 330 | 3300049587 | Ga0501071_0338144 | Ga0501071_0338144_631_963 | 110 |
| 331 | 3300049588 | Ga0501072_0041184 | Ga0501072_0041184_810_1142 | 110 |
| 332 | 3300049592 | Ga0501076_0016415 | Ga0501076_0016415_1383_1715 | 110 |
| 333 | 3300049593 | Ga0501077_0034666 | Ga0501077_0034666_2152_2484 | 110 |
| 334 | 3300049741 | Ga0501079_0044977 | Ga0501079_0044977_2264_2596 | 110 |
| 335 | 3300049741 | Ga0501079_0281760 | Ga0501079_0281760_877_1209 | 110 |
| 336 | 3300049743 | Ga0501081_0055570 | Ga0501081_0055570_250_582 | 110 |
| 337 | 3300049822 | Ga0501035_0135658 | Ga0501035_0135658_1566_1898 | 110 |
| 338 | 3300049824 | Ga0501045_0009840 | Ga0501045_0009840_1172_1504 | 110 |
| 339 | 3300049824 | Ga0501045_0295306 | Ga0501045_0295306_665_997 | 110 |
| 340 | 3300050492 | nmdc:mga0yw44_510773_c1 | nmdc:mga0yw44_510773_c1_413_745 | 110 |
| 341 | 3300050492 | nmdc:mga0yw44_74778_c1 | nmdc:mga0yw44_74778_c1_861_1193 | 110 |
| 342 | 3300050511 | nmdc:mga08y16_96490_c1 | nmdc:mga08y16_96490_c1_2252_2584 | 110 |
| 343 | 3300053077 | Ga0495601_0486657 | Ga0495601_0486657_318_650 | 110 |
| 344 | 3300053084 | Ga0495595_0562245 | Ga0495595_0562245_180_512 | 110 |
| 345 | 3300053085 | Ga0495619_0023977 | Ga0495619_0023977_3484_3816 | 110 |
| 346 | 3300054114 | Ga0501084_0007169 | Ga0501084_0007169_933_1265 | 110 |
| 347 | 3300060353 | Ga0501082_0533162 | Ga0501082_0533162_277_609 | 110 |
| 348 | 3300061734 | Ga0530510_0011878 | Ga0530510_0011878_5492_5824 | 110 |
| 349 | 3300061734 | Ga0530510_1377287 | Ga0530510_1377287_64_396 | 110 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5cwg-assembly1.cif.gz_A | crystal structure of de novo designed helical repeat protein dhr10 | 0.5262 | 10 | 107 |
| 5cwc-assembly1.cif.gz_A | crystal structure of de novo designed helical repeat protein dhr5 | 0.5196 | 10 | 107 |
| 5a0l-assembly2.cif.gz_B | n-terminal thioester domain of fibronectin-binding protein sfbi from streptococcus pyogenes | 0.5005 | 32 | 108 |
| 3daf-assembly1.cif.gz_A | the crystal structure of [fe]-hydrogenase holoenzyme (hmd) from methanocaldococcus jannaschii cocrystallized with cyanide | 0.423 | 10 | 106 |
| 5cwg-assembly1.cif.gz_A | crystal structure of de novo designed helical repeat protein dhr10 | 0.4035 | 10 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C4J362_195_322_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.5445 | 9 | 109 | 1.10.472.10 |
| af_A0A2R8Q7P4_194_306_1.10.472.30 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Transcription elongation factor S-II, central domain | 0.506 | 10 | 98 | 1.10.472.30 |
| af_C4J362_195_322_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.4963 | 9 | 109 | 1.10.472.10 |
| af_P49373_112_221_1.10.472.30 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Transcription elongation factor S-II, central domain | 0.4888 | 7 | 102 | 1.10.472.30 |
| af_Q4DFA6_280_376_1.20.1150.12 | Mainly Alpha;Up-down Bundle;Endoplasmic reticulum protein erp29;Endoplasmic reticulum resident protein 29, C-terminal domain | 0.4327 | 11 | 107 | 1.20.1150.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G6W9N7-F1-model_v4 | Uncharacterized protein | 0.9858 | 7 | 110 |
|
| AF-A0A0Q6VHF0-F1-model_v4 | Uncharacterized protein | 0.9711 | 10 | 110 |
|
| AF-A0A0T2II78-F1-model_v4 | Uncharacterized protein | 0.9661 | 10 | 110 |
|
| AF-A0A6G6W9N7-F1-model_v4 | Uncharacterized protein | 0.9326 | 7 | 110 |
|
| AF-A0A1G9E7Q4-F1-model_v4 | HEAT repeat domain-containing protein | 0.9161 | 4 | 110 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar