F417762

General Info

Members Datasets Scaffolds Average Seq Length
349 272 698 141

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10014944|JGI25151J46595_100149443
Length 149
Sequence MSLLERLNSDMKQAMKEKNKDKLNVIRMVKASLQNEVISLGNNVTLSADQELTILTREVKQRKDSLLEFEKAGRADLVDKLKQELLILEEYLPQQLSEEELLEIVRVTISEVGATSKADMGKVMSAVMPKVKGQADGSSVNKAVASLLK

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
9 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
10 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
11 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
12 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
13 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
14 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
15 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
16 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
17 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
18 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
19 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
20 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
21 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
26 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
27 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
28 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
29 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
30 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
31 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
32 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
33 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
34 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
35 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
36 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
37 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
38 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
39 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
40 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
41 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
42 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
43 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
44 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
45 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
46 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
47 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
48 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
49 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
50 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
51 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
52 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
53 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
54 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
55 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
56 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
93 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
94 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
95 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
107 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
108 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
109 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
110 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
111 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
112 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
113 2554235283 Bacillus safensis VK Isolate Rhizosphere
114 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
115 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
116 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
117 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
118 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
119 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
120 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
121 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
122 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
123 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
124 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
125 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
126 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
127 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
128 2643221729 Bacillus sp. Root11 Isolate Unclassified
129 2643221730 Bacillus sp. Root131 Isolate Unclassified
130 2643221735 Bacillus sp. Root920 Isolate Unclassified
131 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
132 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
133 2671180694 Paenibacillus sp. A3 Isolate Unclassified
134 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
135 2684622632 Bacillus cereus 905 Isolate Unclassified
136 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
137 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
138 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
139 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
140 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
141 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
142 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
143 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
144 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
145 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
146 2738541295 Bacillus sp. OK085 Isolate Unclassified
147 2738541358 Bacillus sp. OV752 Isolate Unclassified
148 2738543006 Bacillus sp. OK077 Isolate Unclassified
149 2738543010 Bacillus sp. YR335 Isolate Unclassified
150 2738543017 Bacillus sp. OV186 Isolate Unclassified
151 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
152 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
153 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
154 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
155 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
156 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
157 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
158 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
159 2811994870 Bacillus sp. JB4 Isolate Unclassified
160 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
161 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
162 2818991441 Niallia circulans 3243 Isolate Rhizosphere
163 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
164 2818991459 Paenibacillus sp. 597 Isolate Unclassified
165 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
166 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
167 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
168 2842682962 Bacillus sp. R-72492 Isolate Unclassified
169 2849139964 Bacillus sp. R-71875 Isolate Unclassified
170 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
171 2857581216 Bacillus sp. R-71922 Isolate Unclassified
172 2857586860 Bacillus sp. R-71935 Isolate Unclassified
173 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
174 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
175 2860837431 Bacillus sp. WR11 Isolate Unclassified
176 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
177 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
178 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
179 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
180 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
181 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
182 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
183 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
184 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
185 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
186 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
187 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
188 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
189 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
190 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
191 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
192 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
193 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
194 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
195 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
196 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
197 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
198 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
199 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
200 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
201 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
202 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
203 2919726948 Bacillus pumilus 4489 Isolate Unclassified
204 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
205 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
206 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
207 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
208 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
209 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
210 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
211 2938917290 Bacillus sp. CR71 Isolate Unclassified
212 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
213 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
214 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
215 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
216 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
217 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
218 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
219 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
220 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
221 2965761152 Bacillus sp. COPE52 Isolate Unclassified
222 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
223 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
224 2969141011 Bacillus velezensis MH25 Isolate Unclassified
225 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
226 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
227 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
228 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
229 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
230 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
231 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
232 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
233 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
234 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
235 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
236 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
237 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
238 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
239 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
240 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
241 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
242 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
243 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
244 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
245 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
246 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
247 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
248 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
249 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
250 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
251 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
252 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
253 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
254 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
255 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
256 8022653035 Bacillus sp. Rc4 Isolate Unclassified
257 8022792930 Bacillus sp. Xin Isolate Rhizosphere
258 8023438354 Bacillus sp. BH2 Isolate Unclassified
259 8023444577 Bacillus sp. BH32 Isolate Unclassified
260 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
261 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
262 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
263 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
264 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
265 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
266 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
267 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
268 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
269 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
270 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
271 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
272 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 21.2
Metatranscriptomes 30.95
Isolates 47.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 5.44
Nodule 0.29
Rhizoplane 4.01
Rhizosphere 66.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10014944 3300003187 Bacteria 3444
2 Ga0007410J51695_1008935 3300003574 Bacteria 691
3 Ga0007409J51694_1004769 3300003575 Bacteria 704
4 Ga0006562J51391_1000517 3300003578 Bacteria 748
5 Ga0006562J51391_1002291 3300003578 Bacteria 789
6 Ga0055532_1000046 3300003758 Bacteria 182389
7 Ga0055536_1021119 3300003781 Bacteria 1986
8 Ga0055534_1024461 3300003784 Bacteria 978
9 Ga0055541_1006413 3300003841 Bacteria 1995
10 Ga0105244_10033055 3300009036 Bacteria 2731
11 Ga0105244_10051786 3300009036 Bacteria 2092
12 Ga0105243_10275710 3300009148 Bacteria 1512
13 Ga0105249_10436868 3300009553 Bacteria 1345
14 Ga0105246_10148237 3300011119 Bacteria 1773
15 Ga0157371_10091929 3300013102 Bacteria 2149
16 Ga0224712_10397218 3300022467 Bacteria 657
17 Ga0209784_101957 3300025224 Bacteria 2330
18 Ga0209566_100741 3300025225 Bacteria 18145
19 Ga0209147_100014 3300025229 Bacteria 597841
20 Ga0209147_104281 3300025229 Bacteria 2432
21 Ga0209130_1002012 3300025284 Bacteria 11080
22 Ga0209130_1028034 3300025284 Bacteria 1188
23 Ga0209130_1030571 3300025284 Bacteria 1112
24 Ga0209675_1016293 3300025291 Bacteria 2171
25 Ga0209675_1019917 3300025291 Bacteria 1832
26 Ga0209025_1000539 3300025294 Bacteria 71638
27 Ga0209025_1001023 3300025294 Bacteria 41159
28 Ga0209025_1004879 3300025294 Bacteria 11303
29 Ga0209025_1005101 3300025294 Bacteria 10922
30 Ga0209025_1005789 3300025294 Bacteria 9913
31 Ga0207696_1011600 3300025711 Bacteria 3164
32 Ga0207696_1018483 3300025711 Bacteria 2287
33 Ga0207655_1003872 3300025728 Bacteria 10887
34 Ga0207655_1065421 3300025728 Bacteria 1380
35 Ga0207712_10280640 3300025961 Bacteria 1359
36 Ga0209969_1054977 3300027360 Bacteria 626
37 Ga0209984_1028407 3300027424 Bacteria 785
38 Ga0307416_103216125 3300032002 Bacteria 547
39 Ga0395898_1256748 3300037466 Bacteria 671
40 Ga0395898_1393181 3300037466 Bacteria 629
41 Ga0237819_00842 3300038705 Bacteria 9660
42 Ga0439439_0096749 3300041406 Bacteria 810
43 Ga0439433_0017121 3300041999 Bacteria 1608
44 Ga0439449_0008656 3300042007 Bacteria 3862
45 Ga0439462_0077924 3300042015 Bacteria 904
46 Ga0466967_0235166 3300045976 Bacteria 1746
47 Ga0495603_0238274 3300046455 Bacteria 1048
48 Ga0495591_034000 3300046458 Bacteria 1504
49 Ga0495584_0030614 3300046491 Bacteria 2725
50 Ga0495594_0384032 3300046499 Bacteria 799
51 Ga0495654_0066759 3300046530 Bacteria 1714
52 Ga0495622_0034326 3300046557 Bacteria 2366
53 Ga0495633_0437845 3300046558 Bacteria 591
54 Ga0495661_0070809 3300046665 Bacteria 2040
55 Ga0495649_0297522 3300046694 Bacteria 822
56 Ga0495649_0326392 3300046694 Bacteria 778
57 Ga0495660_0015905 3300046810 Bacteria 4342
58 Ga0495660_0105207 3300046810 Bacteria 1447
59 Ga0495636_0065283 3300047318 Bacteria 1546
60 Ga0495626_0040898 3300048091 Bacteria 2187
61 Ga0496102_0021870 3300048905 Bacteria 5662
62 Ga0496102_0552718 3300048905 Bacteria 1074
63 Ga0496102_1111351 3300048905 Bacteria 710
64 Ga0496103_0157521 3300048906 Bacteria 1456
65 Ga0496104_0343900 3300048907 Bacteria 1405
66 Ga0496104_1042033 3300048907 Bacteria 722
67 Ga0496109_0031640 3300048912 Bacteria 4751
68 Ga0496111_0003693 3300048914 Bacteria 9514
69 Ga0496111_0138313 3300048914 Bacteria 1804
70 Ga0496112_0280535 3300048915 Bacteria 1613
71 Ga0496113_0417772 3300048916 Bacteria 1077
72 Ga0496113_1458315 3300048916 Bacteria 529
73 Ga0496116_0068737 3300048919 Bacteria 2256
74 Ga0496116_0368749 3300048919 Bacteria 649
75 Ga0496121_0133772 3300048924 Bacteria 1851
76 Ga0496122_0035375 3300048925 Bacteria 4065
77 Ga0501306_002186 3300049127 Bacteria 1969
78 Ga0501306_013462 3300049127 Bacteria 1067
79 Ga0501306_044404 3300049127 Bacteria 697
80 Ga0501306_048175 3300049127 Bacteria 678
81 Ga0501308_000570 3300049128 Bacteria 2483
82 Ga0501309_003606 3300049129 Bacteria 1762
83 Ga0501309_042055 3300049129 Bacteria 700
84 Ga0501309_061523 3300049129 Bacteria 605
85 Ga0501309_076519 3300049129 Bacteria 556
86 Ga0501310_004123 3300049130 Bacteria 1447
87 Ga0501341_07340 3300049131 Bacteria 689
88 Ga0501341_10978 3300049131 Bacteria 601
89 Ga0501341_13456 3300049131 Bacteria 562
90 Ga0501341_14692 3300049131 Bacteria 545
91 Ga0501343_008862 3300049132 Bacteria 808
92 Ga0501304_008521 3300049160 Bacteria 865
93 Ga0501305_003237 3300049161 Bacteria 1831
94 Ga0501305_047795 3300049161 Bacteria 712
95 Ga0501305_063981 3300049161 Bacteria 637
96 Ga0501305_119041 3300049161 Bacteria 505
97 Ga0501307_003760 3300049162 Bacteria 1509
98 Ga0501307_035222 3300049162 Bacteria 710
99 Ga0501307_038731 3300049162 Bacteria 686
100 Ga0501307_073283 3300049162 Bacteria 549
101 Ga0501342_02269 3300049163 Bacteria 646
102 Ga0501311_022743 3300049527 Bacteria 863
103 Ga0501311_036286 3300049527 Bacteria 732
104 Ga0501312_004059 3300049528 Bacteria 1705
105 Ga0501312_031901 3300049528 Bacteria 830
106 Ga0501312_068347 3300049528 Bacteria 626
107 Ga0501312_078057 3300049528 Bacteria 596
108 Ga0501313_006736 3300049529 Bacteria 1251
109 Ga0501313_024110 3300049529 Bacteria 765
110 Ga0501313_028993 3300049529 Bacteria 712
111 Ga0501313_051342 3300049529 Bacteria 571
112 Ga0501314_019257 3300049530 Bacteria 700
113 Ga0501314_019775 3300049530 Bacteria 693
114 Ga0501315_028360 3300049531 Bacteria 794
115 Ga0501315_032234 3300049531 Bacteria 760
116 Ga0501315_044205 3300049531 Bacteria 683
117 Ga0501315_088014 3300049531 Bacteria 535
118 Ga0501316_000467 3300049532 Bacteria 2784
119 Ga0501316_007584 3300049532 Bacteria 1182
120 Ga0501316_020338 3300049532 Bacteria 832
121 Ga0501316_064142 3300049532 Bacteria 547
122 Ga0501316_068492 3300049532 Bacteria 534
123 Ga0501317_032067 3300049533 Bacteria 767
124 Ga0501317_033296 3300049533 Bacteria 758
125 Ga0501317_052024 3300049533 Bacteria 653
126 Ga0501317_094278 3300049533 Bacteria 533
127 Ga0501317_095026 3300049533 Bacteria 531
128 Ga0501318_032239 3300049534 Bacteria 718
129 Ga0501318_037498 3300049534 Bacteria 682
130 Ga0501318_044930 3300049534 Bacteria 642
131 Ga0501318_057754 3300049534 Bacteria 590
132 Ga0501319_012872 3300049535 Bacteria 689
133 Ga0501320_011311 3300049536 Bacteria 923
134 Ga0501320_026723 3300049536 Bacteria 699
135 Ga0501320_054352 3300049536 Bacteria 552
136 Ga0501321_018389 3300049537 Bacteria 848
137 Ga0501321_030906 3300049537 Bacteria 715
138 Ga0501322_010061 3300049538 Bacteria 724
139 Ga0501323_035618 3300049539 Bacteria 714
140 Ga0501323_039409 3300049539 Bacteria 688
141 Ga0501323_065853 3300049539 Bacteria 573
142 Ga0501323_082864 3300049539 Bacteria 526
143 Ga0501323_088256 3300049539 Bacteria 514
144 Ga0501324_012302 3300049540 Bacteria 800
145 Ga0501324_012960 3300049540 Bacteria 785
146 Ga0501324_035309 3300049540 Bacteria 558
147 Ga0501326_08336 3300049542 Bacteria 601
148 Ga0501327_04135 3300049543 Bacteria 822
149 Ga0501328_04266 3300049544 Bacteria 689
150 Ga0501329_07768 3300049545 Bacteria 634
151 Ga0501330_005889 3300049546 Bacteria 791
152 Ga0501331_06176 3300049547 Bacteria 696
153 Ga0501332_04693 3300049548 Bacteria 822
154 Ga0501332_13100 3300049548 Bacteria 575
155 Ga0501333_007982 3300049549 Bacteria 724
156 Ga0501335_015549 3300049551 Bacteria 778
157 Ga0501335_023367 3300049551 Bacteria 670
158 Ga0501335_038669 3300049551 Bacteria 557
159 Ga0501336_016143 3300049552 Bacteria 646
160 Ga0501337_004952 3300049553 Bacteria 882
161 Ga0501337_008440 3300049553 Bacteria 731
162 Ga0501338_03853 3300049554 Bacteria 898
163 Ga0501338_11136 3300049554 Bacteria 612
164 Ga0501198_092528 3300049649 Bacteria 602
165 Ga0501202_125039 3300049652 Bacteria 650
166 Ga0501208_110095 3300049655 Bacteria 598
167 Ga0587077_248360 3300059493 Bacteria 513
168 Ga0587080_057947 3300059503 Bacteria 748
169 Ga0587082_017379 3300059504 Bacteria 1133
170 Ga0587083_0021288 3300059505 Bacteria 1203
171 Ga0587083_0106879 3300059505 Bacteria 705
172 Ga0587106_035976 3300059605 Bacteria 819
173 Ga0587067_063312 3300059640 Bacteria 781
174 Ga0587067_094575 3300059640 Bacteria 683
175 Ga0587067_103954 3300059640 Bacteria 661
176 Ga0587068_051953 3300059641 Bacteria 769
177 Ga0587072_056390 3300059643 Bacteria 799
178 Ga0587072_085249 3300059643 Bacteria 689
179 Ga0587075_061887 3300059644 Bacteria 677
180 Ga0587076_044607 3300059645 Bacteria 842
181 Ga0587079_009797 3300059647 Bacteria 1502
182 Ga0587079_017627 3300059647 Bacteria 1242
183 2511700330 2511231119 Bacteria 4019861
184 2512735020 2512564039 Bacteria 8739048
185 2524186627 2524023129 Bacteria 6762600
186 2540607474 2540341094 Bacteria 4061186
187 2545557013 2545555800 Bacteria 4222588
188 2550902448 2548877040 Bacteria 7507281
189 2553393321 2551306519 Bacteria 5465154
190 2555467721 2554235283 Bacteria 3683090
191 2563926925 2563366752 Bacteria 4961801
192 2571528677 2571042143 Bacteria 6986194
193 2573038002 2571042588 Bacteria 5045676
194 2578338067 2576861424 Bacteria 5270569
195 2578931269 2576861599 Bacteria 4217202
196 2580933769 2579778775 Bacteria 5360914
197 2587737753 2585428059 Bacteria 8696589
198 2595089496 2593339131 Bacteria 5116855
199 2595316407 2593339198 Bacteria 7267884
200 2601639170 2600255286 Bacteria 5390125
201 2621276448 2619619294 Bacteria 5575484
202 2631985381 2630968484 Bacteria 3876276
203 2643737957 2643221543 Bacteria 6628015
204 2644423161 2643221676 Bacteria 8119172
205 2644708059 2643221729 Bacteria 6621700
206 2644714788 2643221730 Bacteria 6523787
207 2644740886 2643221735 Bacteria 3676263
208 2651531791 2648501850 Bacteria 3975476
209 2672337029 2671180330 Bacteria 5521719
210 2673821672 2671180694 Bacteria 7506943
211 2674418857 2671180844 Bacteria 4164150
212 2685152281 2684622632 Bacteria 5380049
213 2686997543 2684623153 Bacteria 3878815
214 2687498851 2687453109 Bacteria 3860091
215 2695628309 2695420354 Bacteria 3922431
216 2698320880 2695420987 Bacteria 6152737
217 2705996221 2703719227 Bacteria 5631989
218 2717915989 2716884898 Bacteria 3928789
219 2721507440 2718218445 Bacteria 5113413
220 2723605038 2721755693 Bacteria 6126117
221 2728534174 2728368933 Bacteria 7044283
222 2730135682 2728369359 Bacteria 5621728
223 2738813917 2738541295 Bacteria 5730091
224 2739154518 2738541358 Bacteria 5932299
225 2739208110 2738543006 Bacteria 5904091
226 2739230103 2738543010 Bacteria 5583595
227 2739270432 2738543017 Bacteria 4271950
228 2753810917 2751185905 Bacteria 6142767
229 2757567925 2757320391 Bacteria 4746095
230 2777761066 2775507177 Bacteria 4384303
231 2777839316 2775507192 Bacteria 4622234
232 2793186077 2791355222 Bacteria 5898266
233 2802437352 2802428803 Bacteria 5806948
234 2808869494 2808606364 Bacteria 4465927
235 2809055839 2808606399 Bacteria 4021018
236 2812316738 2811994870 Bacteria 3776934
237 2816862547 2816332186 Bacteria 5331395
238 2817480829 2816332295 Bacteria 4352468
239 2819569322 2818991441 Bacteria 5062707
240 2819583176 2818991443 Bacteria 6598732
241 2819670585 2818991459 Bacteria 8736032
242 2819723798 2818991468 Bacteria 3723169
243 2821114749 2821111986 Bacteria 6894338
244 2823528720 2823526263 Bacteria 3765752
245 2842684537 2842682962 Bacteria 5589973
246 2849142560 2849139964 Bacteria 5613304
247 2857459308 2857453340 Bacteria 8090534
248 2857585688 2857581216 Bacteria 5522813
249 2857590628 2857586860 Bacteria 4354574
250 2857606319 2857604169 Bacteria 5111450
251 2857610755 2857609550 Bacteria 3753890
252 2860840168 2860837431 Bacteria 4202080
253 2864735310 2864733723 Bacteria 6770668
254 2865000003 2864997549 Bacteria 5139696
255 2865003406 2865002811 Bacteria 6333767
256 2877771215 2877768649 Bacteria 3957164
257 2880172079 2880169592 Bacteria 3900066
258 2881640993 2881636855 Bacteria 5205297
259 2881644434 2881644220 Bacteria 5302661
260 2885527895 2885526491 Bacteria 7164189
261 2888580879 2888578766 Bacteria 6743310
262 2889046908 2889042446 Bacteria 7618936
263 2889050440 2889049205 Bacteria 7524325
264 2889280951 2889276214 Bacteria 5979355
265 2889296078 2889295896 Bacteria 4704906
266 2897112292 2897109615 Bacteria 4009619
267 2904118104 2904113452 Bacteria 7796941
268 2904163121 2904162308 Bacteria 7086713
269 2904493812 2904490793 Bacteria 7046938
270 2904562169 2904560550 Bacteria 4029838
271 2904598269 2904595352 Bacteria 6124848
272 2904760033 2904755435 Bacteria 7986759
273 2907205842 2907202186 Bacteria 6632024
274 2908668078 2908665501 Bacteria 3678115
275 2916973745 2916971899 Bacteria 4250608
276 2919095845 2919093281 Bacteria 3660974
277 2919162891 2919160200 Bacteria 6929020
278 2919417148 2919414237 Bacteria 5429133
279 2919427098 2919425241 Bacteria 8055701
280 2919728434 2919726948 Bacteria 3696050
281 2925330100 2925326138 Bacteria 9652120
282 2929210652 2929206907 Bacteria 5918291
283 2929237983 2929233124 Bacteria 5948380
284 2931390355 2931384279 Bacteria 7299545
285 2936341201 2936340661 Bacteria 5139038
286 2936367417 2936361878 Bacteria 5632809
287 2938650259 2938649242 Bacteria 7118381
288 2938922172 2938917290 Bacteria 5914775
289 2939679626 2939679117 Bacteria 6921672
290 2939704704 2939702853 Bacteria 5139229
291 2945997421 2945991243 Bacteria 7008369
292 2946053632 2946053406 Bacteria 6978655
293 2947431067 2947426588 Bacteria 5357194
294 2954773760 2954773129 Bacteria 3741715
295 2956902099 2956897341 Bacteria 5447711
296 2962293446 2962290636 Bacteria 4072939
297 2964378233 2964375228 Bacteria 4909004
298 2965765560 2965761152 Bacteria 5806513
299 2968564118 2968558590 Bacteria 6956864
300 2969139454 2969136845 Bacteria 3923176
301 2969143662 2969141011 Bacteria 4118468
302 2969767423 2969765954 Bacteria 4216713
303 2969773264 2969770375 Bacteria 4271280
304 2971407312 2971403814 Bacteria 7370929
305 2971417350 2971410472 Bacteria 8311090
306 2971512671 2971511577 Bacteria 5404012
307 2971895861 2971893375 Bacteria 3929648
308 2979087971 2979083700 Bacteria 5894929
309 2980125871 2980125574 Bacteria 5567337
310 2980177618 2980176882 Bacteria 5397533
311 2980184367 2980182181 Bacteria 9454109
312 2980495209 2980492589 Bacteria 4072961
313 2981287821 2981284811 Bacteria 4641497
314 2981292467 2981289755 Bacteria 4641509
315 2981983440 2981980479 Bacteria 4641628
316 2981988523 2981985349 Bacteria 4641497
317 2984530389 2984527788 Bacteria 5288478
318 2988228903 2988225383 Bacteria 7221625
319 2990277414 2990275345 Bacteria 4887158
320 2996636047 2996632988 Bacteria 6921523
321 3001268437 3001267043 Bacteria 4823521
322 3001273910 3001272096 Bacteria 4729684
323 3001897740 3001892409 Bacteria 6328293
324 3006861188 3006858327 Bacteria 4317835
325 3006881673 3006879489 Bacteria 4064221
326 3006975977 3006973921 Bacteria 4423788
327 3006981883 3006978542 Bacteria 5328100
328 3006988924 3006988479 Bacteria 4767936
329 648171106 648028048 Bacteria 5394884
330 8002323520 8002317523 Bacteria 8051857
331 8022624212 8022621104 Bacteria 5241040
332 8022631956 8022630665 Bacteria 3886130
333 8022654335 8022653035 Bacteria 4035078
334 8022796906 8022792930 Bacteria 5693794
335 8023443129 8023438354 Bacteria 5779374
336 8023445177 8023444577 Bacteria 5661597
337 8046997534 8046991243 Bacteria 8497463
338 8051955212 8051952484 Bacteria 3926774
339 8052176138 8052174270 Bacteria 3881265
340 8054281143 8054280661 Bacteria 4232245
341 8054470273 8054465665 Bacteria 7323556
342 8054804773 8054795415 Bacteria 9785225
343 8055635197 8055632911 Bacteria 5283357
344 8056540056 8056533031 Bacteria 8964429
345 8057477140 8057473075 Bacteria 5892720
346 8057586742 8057582654 Bacteria 5218944
347 8057635484 8057632132 Bacteria 4726859
348 8057737562 8057733483 Bacteria 6578323
349 8057979174 8057977335 Bacteria 5694872
350 JGI25151J46595_10014944
351 Ga0007410J51695_1008935
352 Ga0007409J51694_1004769
353 Ga0006562J51391_1000517
354 Ga0006562J51391_1002291
355 Ga0055532_1000046
356 Ga0055536_1021119
357 Ga0055534_1024461
358 Ga0055541_1006413
359 Ga0105244_10033055
360 Ga0105244_10051786
361 Ga0105243_10275710
362 Ga0105249_10436868
363 Ga0105246_10148237
364 Ga0157371_10091929
365 Ga0224712_10397218
366 Ga0209784_101957
367 Ga0209566_100741
368 Ga0209147_100014
369 Ga0209147_104281
370 Ga0209130_1002012
371 Ga0209130_1028034
372 Ga0209130_1030571
373 Ga0209675_1016293
374 Ga0209675_1019917
375 Ga0209025_1000539
376 Ga0209025_1001023
377 Ga0209025_1004879
378 Ga0209025_1005101
379 Ga0209025_1005789
380 Ga0207696_1011600
381 Ga0207696_1018483
382 Ga0207655_1003872
383 Ga0207655_1065421
384 Ga0207712_10280640
385 Ga0209969_1054977
386 Ga0209984_1028407
387 Ga0307416_103216125
388 Ga0395898_1256748
389 Ga0395898_1393181
390 Ga0237819_00842
391 Ga0439439_0096749
392 Ga0439433_0017121
393 Ga0439449_0008656
394 Ga0439462_0077924
395 Ga0466967_0235166
396 Ga0495603_0238274
397 Ga0495591_034000
398 Ga0495584_0030614
399 Ga0495594_0384032
400 Ga0495654_0066759
401 Ga0495622_0034326
402 Ga0495633_0437845
403 Ga0495661_0070809
404 Ga0495649_0297522
405 Ga0495649_0326392
406 Ga0495660_0015905
407 Ga0495660_0105207
408 Ga0495636_0065283
409 Ga0495626_0040898
410 Ga0496102_0021870
411 Ga0496102_0552718
412 Ga0496102_1111351
413 Ga0496103_0157521
414 Ga0496104_0343900
415 Ga0496104_1042033
416 Ga0496109_0031640
417 Ga0496111_0003693
418 Ga0496111_0138313
419 Ga0496112_0280535
420 Ga0496113_0417772
421 Ga0496113_1458315
422 Ga0496116_0068737
423 Ga0496116_0368749
424 Ga0496121_0133772
425 Ga0496122_0035375
426 Ga0501306_002186
427 Ga0501306_013462
428 Ga0501306_044404
429 Ga0501306_048175
430 Ga0501308_000570
431 Ga0501309_003606
432 Ga0501309_042055
433 Ga0501309_061523
434 Ga0501309_076519
435 Ga0501310_004123
436 Ga0501341_07340
437 Ga0501341_10978
438 Ga0501341_13456
439 Ga0501341_14692
440 Ga0501343_008862
441 Ga0501304_008521
442 Ga0501305_003237
443 Ga0501305_047795
444 Ga0501305_063981
445 Ga0501305_119041
446 Ga0501307_003760
447 Ga0501307_035222
448 Ga0501307_038731
449 Ga0501307_073283
450 Ga0501342_02269
451 Ga0501311_022743
452 Ga0501311_036286
453 Ga0501312_004059
454 Ga0501312_031901
455 Ga0501312_068347
456 Ga0501312_078057
457 Ga0501313_006736
458 Ga0501313_024110
459 Ga0501313_028993
460 Ga0501313_051342
461 Ga0501314_019257
462 Ga0501314_019775
463 Ga0501315_028360
464 Ga0501315_032234
465 Ga0501315_044205
466 Ga0501315_088014
467 Ga0501316_000467
468 Ga0501316_007584
469 Ga0501316_020338
470 Ga0501316_064142
471 Ga0501316_068492
472 Ga0501317_032067
473 Ga0501317_033296
474 Ga0501317_052024
475 Ga0501317_094278
476 Ga0501317_095026
477 Ga0501318_032239
478 Ga0501318_037498
479 Ga0501318_044930
480 Ga0501318_057754
481 Ga0501319_012872
482 Ga0501320_011311
483 Ga0501320_026723
484 Ga0501320_054352
485 Ga0501321_018389
486 Ga0501321_030906
487 Ga0501322_010061
488 Ga0501323_035618
489 Ga0501323_039409
490 Ga0501323_065853
491 Ga0501323_082864
492 Ga0501323_088256
493 Ga0501324_012302
494 Ga0501324_012960
495 Ga0501324_035309
496 Ga0501326_08336
497 Ga0501327_04135
498 Ga0501328_04266
499 Ga0501329_07768
500 Ga0501330_005889
501 Ga0501331_06176
502 Ga0501332_04693
503 Ga0501332_13100
504 Ga0501333_007982
505 Ga0501335_015549
506 Ga0501335_023367
507 Ga0501335_038669
508 Ga0501336_016143
509 Ga0501337_004952
510 Ga0501337_008440
511 Ga0501338_03853
512 Ga0501338_11136
513 Ga0501198_092528
514 Ga0501202_125039
515 Ga0501208_110095
516 Ga0587077_248360
517 Ga0587080_057947
518 Ga0587082_017379
519 Ga0587083_0021288
520 Ga0587083_0106879
521 Ga0587106_035976
522 Ga0587067_063312
523 Ga0587067_094575
524 Ga0587067_103954
525 Ga0587068_051953
526 Ga0587072_056390
527 Ga0587072_085249
528 Ga0587075_061887
529 Ga0587076_044607
530 Ga0587079_009797
531 Ga0587079_017627
532 2511700330
533 2512735020
534 2524186627
535 2540607474
536 2545557013
537 2550902448
538 2553393321
539 2555467721
540 2563926925
541 2571528677
542 2573038002
543 2578338067
544 2578931269
545 2580933769
546 2587737753
547 2595089496
548 2595316407
549 2601639170
550 2621276448
551 2631985381
552 2643737957
553 2644423161
554 2644708059
555 2644714788
556 2644740886
557 2651531791
558 2672337029
559 2673821672
560 2674418857
561 2685152281
562 2686997543
563 2687498851
564 2695628309
565 2698320880
566 2705996221
567 2717915989
568 2721507440
569 2723605038
570 2728534174
571 2730135682
572 2738813917
573 2739154518
574 2739208110
575 2739230103
576 2739270432
577 2753810917
578 2757567925
579 2777761066
580 2777839316
581 2793186077
582 2802437352
583 2808869494
584 2809055839
585 2812316738
586 2816862547
587 2817480829
588 2819569322
589 2819583176
590 2819670585
591 2819723798
592 2821114749
593 2823528720
594 2842684537
595 2849142560
596 2857459308
597 2857585688
598 2857590628
599 2857606319
600 2857610755
601 2860840168
602 2864735310
603 2865000003
604 2865003406
605 2877771215
606 2880172079
607 2881640993
608 2881644434
609 2885527895
610 2888580879
611 2889046908
612 2889050440
613 2889280951
614 2889296078
615 2897112292
616 2904118104
617 2904163121
618 2904493812
619 2904562169
620 2904598269
621 2904760033
622 2907205842
623 2908668078
624 2916973745
625 2919095845
626 2919162891
627 2919417148
628 2919427098
629 2919728434
630 2925330100
631 2929210652
632 2929237983
633 2931390355
634 2936341201
635 2936367417
636 2938650259
637 2938922172
638 2939679626
639 2939704704
640 2945997421
641 2946053632
642 2947431067
643 2954773760
644 2956902099
645 2962293446
646 2964378233
647 2965765560
648 2968564118
649 2969139454
650 2969143662
651 2969767423
652 2969773264
653 2971407312
654 2971417350
655 2971512671
656 2971895861
657 2979087971
658 2980125871
659 2980177618
660 2980184367
661 2980495209
662 2981287821
663 2981292467
664 2981983440
665 2981988523
666 2984530389
667 2988228903
668 2990277414
669 2996636047
670 3001268437
671 3001273910
672 3001897740
673 3006861188
674 3006881673
675 3006975977
676 3006981883
677 3006988924
678 648171106
679 8002323520
680 8022624212
681 8022631956
682 8022654335
683 8022796906
684 8023443129
685 8023445177
686 8046997534
687 8051955212
688 8052176138
689 8054281143
690 8054470273
691 8054804773
692 8055635197
693 8056540056
694 8057477140
695 8057586742
696 8057635484
697 8057737562
698 8057979174

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

4

148

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yzm-assembly1.cif.gz_A structure of rabenosyn (458-503), rab4 binding domain 0.994 53 90
2vxx-assembly1.cif.gz_B x-ray structure of dpsa from thermosynechococcus elongatus 0.9416 50 91
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.8853 1 149
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.8798 1 149
3v1b-assembly1.cif.gz_B crystal structure of de novo designed mid1-apo2 0.8625 53 91
ID Description Score Start End Superfamily
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9812 93 149 1.10.10.410
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9646 93 149 1.10.10.410
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.959 3 92 1.10.1510.10
1ng6A01 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9581 1 92 1.10.1510.10
1ng6A01 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.948 1 92 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A1I2KSE1-F1-model_v4 GatB/YqeY domain-containing protein 0.9776 1 149 GO:0016884
AF-A0A7C1D0W7-F1-model_v4 GatB/YqeY domain-containing protein 0.9746 1 149 GO:0016884
AF-A0A0S8J303-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9731 1 146 GO:0016884
AF-A0A1I2KSE1-F1-model_v4 GatB/YqeY domain-containing protein 0.9712 1 149 GO:0016884
AF-A0A7X9BYF8-F1-model_v4 GatB/YqeY domain-containing protein 0.9703 49 148 GO:0016884

Map