F417673

General Info

Members Datasets Scaffolds Average Seq Length
348 214 696 195

Family's Representative Sequence

Representative Sequence 3300046538|Ga0495609_0074439|Ga0495609_0074439_846_1445
Length 190
Sequence MIAFLRGRVLEKHPNRIVVDVNGVGYELYVPLSTYYEVGDTGAEISLRVHTHVREDALQLFGFLTSLEQLLFERLIGISGIGPKLAIAVLSGIDSRELVASIQRADVAKKTAERIVLELKDRLRDVAPADTSADAQPPSGDALRDDLVSALENLGYHRPVAEKAVDAARARNGAATFEDALKGALRELMR

Samples

Sample ID Description Type Environment
1 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.17
Rhizosphere 94.83
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495609_0074439 3300046538 Bacteria 1489
2 Ga0065712_10069647 3300005290 Bacteria 6927
3 Ga0065712_10152666 3300005290 Bacteria 1358
4 Ga0070676_10430446 3300005328 Bacteria 924
5 Ga0070683_100024989 3300005329 Bacteria 5358
6 Ga0070670_100611341 3300005331 Bacteria 976
7 Ga0070677_10114722 3300005333 Bacteria 1208
8 Ga0068869_100251044 3300005334 Bacteria 1413
9 Ga0070680_100088981 3300005336 Bacteria 2555
10 Ga0068868_100164382 3300005338 Bacteria 1835
11 Ga0070660_100013950 3300005339 Bacteria 5781
12 Ga0070660_100365905 3300005339 Unclassified 1189
13 Ga0070691_10005391 3300005341 Bacteria 5817
14 Ga0070691_10192473 3300005341 Bacteria 1068
15 Ga0070692_10166546 3300005345 Bacteria 1267
16 Ga0070668_100061615 3300005347 Bacteria 2906
17 Ga0070669_100126817 3300005353 Bacteria 1954
18 Ga0070669_100203880 3300005353 Bacteria 1557
19 Ga0070675_100293327 3300005354 Bacteria 1431
20 Ga0070671_100165521 3300005355 Bacteria 1870
21 Ga0070671_101066574 3300005355 Bacteria 709
22 Ga0070674_100346368 3300005356 Bacteria 1199
23 Ga0070673_100058579 3300005364 Bacteria 3046
24 Ga0070688_100507914 3300005365 Bacteria 910
25 Ga0070659_100185406 3300005366 Bacteria 1709
26 Ga0070659_100336452 3300005366 Bacteria 1264
27 Ga0070713_101057500 3300005436 Bacteria 784
28 Ga0070701_10044991 3300005438 Bacteria 2263
29 Ga0070701_10057268 3300005438 Bacteria 2042
30 Ga0070701_10190086 3300005438 Bacteria 1208
31 Ga0070705_100002798 3300005440 Bacteria 8692
32 Ga0070705_100092908 3300005440 Bacteria 1885
33 Ga0070700_100003978 3300005441 Bacteria 7679
34 Ga0070694_100097473 3300005444 Bacteria 2074
35 Ga0070662_100378989 3300005457 Bacteria 1164
36 Ga0070681_10000926 3300005458 Bacteria 24766
37 Ga0068867_100012153 3300005459 Bacteria 6083
38 Ga0070706_100247188 3300005467 Bacteria 1666
39 Ga0070707_100256712 3300005468 Bacteria 1701
40 Ga0070707_100424627 3300005468 Bacteria 1290
41 Ga0070699_100106339 3300005518 Bacteria 2461
42 Ga0070679_100004319 3300005530 Bacteria 13121
43 Ga0070679_100011918 3300005530 Bacteria 8298
44 Ga0070684_100010986 3300005535 Bacteria 7201
45 Ga0070697_100718451 3300005536 Bacteria 882
46 Ga0070672_100104885 3300005543 Bacteria 2297
47 Ga0070672_100306924 3300005543 Bacteria 1346
48 Ga0070686_100467502 3300005544 Bacteria 973
49 Ga0070686_100605270 3300005544 Bacteria 864
50 Ga0070695_100033314 3300005545 Bacteria 3223
51 Ga0070696_100033671 3300005546 Bacteria 3522
52 Ga0070696_100346608 3300005546 Bacteria 1149
53 Ga0070704_100012700 3300005549 Bacteria 5210
54 Ga0070704_100023092 3300005549 Bacteria 4055
55 Ga0068855_100012391 3300005563 Bacteria 10298
56 Ga0070664_100042225 3300005564 Bacteria 3849
57 Ga0068857_100031800 3300005577 Bacteria 4663
58 Ga0068854_100297250 3300005578 Bacteria 1305
59 Ga0068856_100251581 3300005614 Bacteria 1782
60 Ga0070702_100002550 3300005615 Bacteria 7914
61 Ga0070702_100022961 3300005615 Bacteria 3308
62 Ga0068852_100745988 3300005616 Bacteria 991
63 Ga0068859_100098774 3300005617 Bacteria 2974
64 Ga0068859_100159471 3300005617 Bacteria 2335
65 Ga0068859_101072835 3300005617 Bacteria 885
66 Ga0068864_100002331 3300005618 Bacteria 15700
67 Ga0068866_10447446 3300005718 Bacteria 844
68 Ga0068861_100004253 3300005719 Bacteria 9595
69 Ga0068861_100141427 3300005719 Bacteria 1964
70 Ga0068861_100523797 3300005719 Bacteria 1075
71 Ga0068851_10012457 3300005834 Bacteria 4009
72 Ga0068863_100622223 3300005841 Bacteria 1069
73 Ga0068858_100035521 3300005842 Bacteria 4623
74 Ga0068858_100218946 3300005842 Bacteria 1803
75 Ga0068858_100832518 3300005842 Unclassified 901
76 Ga0068860_100407138 3300005843 Bacteria 1346
77 Ga0068862_100530517 3300005844 Bacteria 1121
78 Ga0081539_10015206 3300005985 Bacteria 5614
79 Ga0097621_100122275 3300006237 Bacteria 2209
80 Ga0097621_100358495 3300006237 Bacteria 1298
81 Ga0097621_100362901 3300006237 Bacteria 1291
82 Ga0097621_100705920 3300006237 Bacteria 929
83 Ga0097621_101141020 3300006237 Unclassified 733
84 Ga0068871_100009037 3300006358 Bacteria 7197
85 Ga0068871_100061983 3300006358 Bacteria 3056
86 Ga0068871_100715802 3300006358 Bacteria 918
87 Ga0068871_100730270 3300006358 Bacteria 909
88 Ga0075428_100006386 3300006844 Bacteria 13120
89 Ga0075428_100186965 3300006844 Bacteria 2241
90 Ga0075430_100002239 3300006846 Bacteria 16031
91 Ga0075431_100001153 3300006847 Bacteria 23746
92 Ga0075434_100000919 3300006871 Bacteria 23605
93 Ga0075434_100006466 3300006871 Bacteria 10738
94 Ga0075429_100029634 3300006880 Bacteria 4753
95 Ga0075436_100018737 3300006914 Bacteria 4740
96 Ga0075436_100021161 3300006914 Bacteria 4463
97 Ga0075436_100042530 3300006914 Bacteria 3134
98 Ga0097620_100098770 3300006931 Bacteria 2974
99 Ga0097620_100159473 3300006931 Bacteria 2335
100 Ga0097620_101072832 3300006931 Bacteria 885
101 Ga0075435_100000353 3300007076 Bacteria 28240
102 Ga0075435_100006608 3300007076 Bacteria 8210
103 Ga0075435_100493334 3300007076 Bacteria 1058
104 Ga0105240_10089310 3300009093 Bacteria 3769
105 Ga0105240_11190463 3300009093 Bacteria 807
106 Ga0111539_10049518 3300009094 Bacteria 5009
107 Ga0111539_10171869 3300009094 Bacteria 2532
108 Ga0111539_10255130 3300009094 Bacteria 2042
109 Ga0111539_11281269 3300009094 Bacteria 851
110 Ga0105245_10146106 3300009098 Bacteria 2231
111 Ga0105245_10152435 3300009098 Bacteria 2186
112 Ga0105247_10068619 3300009101 Bacteria 2211
113 Ga0114129_10709468 3300009147 Bacteria 1292
114 Ga0114129_10749222 3300009147 Bacteria 1250
115 Ga0114129_10832293 3300009147 Bacteria 1175
116 Ga0105243_11142856 3300009148 Bacteria 789
117 Ga0105241_10722616 3300009174 Bacteria 911
118 Ga0105242_10072616 3300009176 Bacteria 2858
119 Ga0105242_10641809 3300009176 Bacteria 1031
120 Ga0105248_10312123 3300009177 Bacteria 1771
121 Ga0105248_10524820 3300009177 Bacteria 1335
122 Ga0105248_10844194 3300009177 Bacteria 1034
123 Ga0105238_10492483 3300009551 Bacteria 1226
124 Ga0105249_10533141 3300009553 Bacteria 1223
125 Ga0157374_10022217 3300013296 Bacteria 5658
126 Ga0157378_10318632 3300013297 Bacteria 1510
127 Ga0157378_11115373 3300013297 Bacteria 826
128 Ga0157375_10130402 3300013308 Bacteria 2633
129 Ga0157375_10609542 3300013308 Bacteria 1250
130 Ga0163163_10039033 3300014325 Bacteria 4632
131 Ga0163163_10066121 3300014325 Bacteria 3590
132 Ga0163163_10252618 3300014325 Bacteria 1814
133 Ga0163163_11240320 3300014325 Bacteria 808
134 Ga0157380_10127206 3300014326 Bacteria 2168
135 Ga0157380_11288291 3300014326 Bacteria 778
136 Ga0157379_10015268 3300014968 Bacteria 6736
137 Ga0157379_10032311 3300014968 Bacteria 4666
138 Ga0157376_10153466 3300014969 Bacteria 2079
139 Ga0157376_10251130 3300014969 Bacteria 1652
140 Ga0182007_10196312 3300015262 Bacteria 704
141 Ga0207697_10108022 3300025315 Bacteria 1190
142 Ga0207682_10069583 3300025893 Bacteria 1489
143 Ga0207642_10151448 3300025899 Bacteria 1235
144 Ga0207710_10004508 3300025900 Bacteria 6063
145 Ga0207710_10094828 3300025900 Bacteria 1401
146 Ga0207688_10070223 3300025901 Bacteria 1986
147 Ga0207688_10141525 3300025901 Bacteria 1416
148 Ga0207645_10000374 3300025907 Bacteria 37092
149 Ga0207645_10312862 3300025907 Bacteria 1047
150 Ga0207643_10038016 3300025908 Bacteria 2702
151 Ga0207705_10024227 3300025909 Bacteria 4332
152 Ga0207684_10118177 3300025910 Bacteria 2272
153 Ga0207707_10008909 3300025912 Bacteria 8713
154 Ga0207707_10549668 3300025912 Bacteria 981
155 Ga0207660_10171274 3300025917 Bacteria 1681
156 Ga0207660_10623181 3300025917 Bacteria 879
157 Ga0207657_10000448 3300025919 Bacteria 43812
158 Ga0207657_10122037 3300025919 Bacteria 2143
159 Ga0207649_10136686 3300025920 Bacteria 1672
160 Ga0207652_10015551 3300025921 Bacteria 6190
161 Ga0207646_10088728 3300025922 Bacteria 2767
162 Ga0207681_10035629 3300025923 Bacteria 3280
163 Ga0207681_10055414 3300025923 Bacteria 2700
164 Ga0207650_10352763 3300025925 Bacteria 1210
165 Ga0207687_10067321 3300025927 Bacteria 2547
166 Ga0207644_10122734 3300025931 Bacteria 1980
167 Ga0207690_10010646 3300025932 Bacteria 5480
168 Ga0207686_10243605 3300025934 Bacteria 1310
169 Ga0207709_10567111 3300025935 Bacteria 895
170 Ga0207670_10383314 3300025936 Bacteria 1120
171 Ga0207704_10038266 3300025938 Bacteria 2780
172 Ga0207704_10362023 3300025938 Bacteria 1133
173 Ga0207665_10135181 3300025939 Bacteria 1754
174 Ga0207691_10043122 3300025940 Bacteria 4158
175 Ga0207691_10357100 3300025940 Bacteria 1250
176 Ga0207711_10041791 3300025941 Bacteria 3905
177 Ga0207711_10129262 3300025941 Bacteria 2263
178 Ga0207711_10353941 3300025941 Bacteria 1360
179 Ga0207679_10117199 3300025945 Bacteria 2113
180 Ga0207667_10068027 3300025949 Bacteria 3710
181 Ga0207667_10528164 3300025949 Bacteria 1195
182 Ga0207651_10207855 3300025960 Bacteria 1573
183 Ga0207651_10213930 3300025960 Bacteria 1554
184 Ga0207651_10515814 3300025960 Bacteria 1035
185 Ga0207640_10053034 3300025981 Bacteria 2645
186 Ga0207658_10239001 3300025986 Bacteria 1538
187 Ga0207703_10222156 3300026035 Bacteria 1690
188 Ga0207703_10282466 3300026035 Bacteria 1508
189 Ga0207703_10466745 3300026035 Bacteria 1181
190 Ga0207703_11122359 3300026035 Unclassified 755
191 Ga0207708_10056287 3300026075 Bacteria 3000
192 Ga0207708_10078793 3300026075 Bacteria 2530
193 Ga0207708_10109996 3300026075 Bacteria 2138
194 Ga0207702_10585392 3300026078 Bacteria 1094
195 Ga0207641_10307647 3300026088 Bacteria 1499
196 Ga0207641_10686557 3300026088 Bacteria 1007
197 Ga0207648_10361369 3300026089 Bacteria 1310
198 Ga0207648_10493390 3300026089 Bacteria 1120
199 Ga0207676_10035454 3300026095 Bacteria 3786
200 Ga0207676_10119314 3300026095 Bacteria 2221
201 Ga0207674_10035104 3300026116 Bacteria 5235
202 Ga0207675_100001961 3300026118 Bacteria 20530
203 Ga0207675_100206786 3300026118 Bacteria 1886
204 Ga0207675_100388510 3300026118 Bacteria 1373
205 Ga0207683_10237443 3300026121 Bacteria 1662
206 Ga0207698_10072751 3300026142 Bacteria 2734
207 Ga0207428_10025243 3300027907 Bacteria 4975
208 Ga0268266_10189191 3300028379 Bacteria 1878
209 Ga0268265_10463347 3300028380 Bacteria 1186
210 Ga0268264_10123523 3300028381 Bacteria 2285
211 Ga0307408_100123068 3300031548 Bacteria 2012
212 Ga0307405_10367459 3300031731 Bacteria 1115
213 Ga0307406_10050379 3300031901 Bacteria 2640
214 Ga0307416_100024508 3300032002 Bacteria 4406
215 Ga0307416_100235950 3300032002 Bacteria 1768
216 Ga0373934_0116208 3300035086 Bacteria 1087
217 Ga0373936_0084696 3300035113 Bacteria 1323
218 Ga0373954_0170759 3300035118 Bacteria 1065
219 Ga0373956_0149339 3300035119 Bacteria 1099
220 Ga0373943_0033744 3300035170 Bacteria 2440
221 Ga0373946_0192129 3300035171 Bacteria 974
222 Ga0373955_0012509 3300035172 Bacteria 4079
223 Ga0373924_0055095 3300035410 Bacteria 1655
224 Ga0373931_0076988 3300035691 Bacteria 1833
225 Ga0373947_0018355 3300035725 Bacteria 4026
226 Ga0373937_0053969 3300036401 Bacteria 3687
227 Ga0373937_0075873 3300036401 Bacteria 3104
228 Ga0373937_0109868 3300036401 Bacteria 2564
229 Ga0373937_0262154 3300036401 Bacteria 1630
230 Ga0373925_0086531 3300037068 Bacteria 2391
231 Ga0373925_0354545 3300037068 Bacteria 1191
232 Ga0466963_0049761 3300044694 Bacteria 2772
233 Ga0451576_0007133 3300045051 Bacteria 13485
234 Ga0451576_0013194 3300045051 Bacteria 9246
235 Ga0451576_0017863 3300045051 Bacteria 7792
236 Ga0451576_1239644 3300045051 Bacteria 778
237 Ga0466967_0107408 3300045976 Bacteria 2560
238 Ga0466967_0758932 3300045976 Bacteria 962
239 Ga0495592_0227457 3300046454 Bacteria 1244
240 Ga0495592_0335893 3300046454 Bacteria 973
241 Ga0495603_0406545 3300046455 Bacteria 780
242 Ga0495580_0267936 3300046472 Bacteria 1167
243 Ga0495582_0267030 3300046473 Bacteria 982
244 Ga0495628_0076533 3300046516 Bacteria 2604
245 Ga0495628_0216118 3300046516 Bacteria 1441
246 Ga0495628_0234109 3300046516 Bacteria 1376
247 Ga0495663_0005606 3300046525 Bacteria 3477
248 Ga0495642_0034480 3300046528 Bacteria 2039
249 Ga0495665_0211585 3300046531 Bacteria 1004
250 Ga0495586_0227914 3300046535 Bacteria 1060
251 Ga0495587_0031898 3300046536 Bacteria 3188
252 Ga0495621_0027659 3300046539 Bacteria 1922
253 Ga0495645_0004379 3300046543 Bacteria 9645
254 Ga0495667_0308418 3300046559 Bacteria 1002
255 Ga0495635_0081835 3300046663 Bacteria 2209
256 Ga0495635_0156503 3300046663 Bacteria 1551
257 Ga0495659_0007090 3300046664 Bacteria 3546
258 Ga0495658_0150517 3300046683 Bacteria 1429
259 Ga0495658_0404673 3300046683 Bacteria 870
260 Ga0495669_0025398 3300046684 Bacteria 2584
261 Ga0495669_0123942 3300046684 Bacteria 1213
262 Ga0495613_0187213 3300046689 Bacteria 1464
263 Ga0495674_0206570 3300047319 Bacteria 1628
264 Ga0495674_0270615 3300047319 Bacteria 1394
265 Ga0495674_0362005 3300047319 Bacteria 1176
266 Ga0495674_0442758 3300047319 Bacteria 1045
267 Ga0496101_0568151 3300048904 Bacteria 897
268 Ga0496104_0010445 3300048907 Bacteria 8292
269 Ga0496104_0115609 3300048907 Bacteria 2574
270 Ga0496104_0640446 3300048907 Bacteria 972
271 Ga0496106_0053746 3300048909 Bacteria 3043
272 Ga0496106_0479061 3300048909 Bacteria 1000
273 Ga0496108_0009031 3300048911 Bacteria 8077
274 Ga0496109_0108907 3300048912 Bacteria 2575
275 Ga0496109_0173813 3300048912 Bacteria 2022
276 Ga0496110_0013141 3300048913 Bacteria 6836
277 Ga0496112_0024556 3300048915 Bacteria 5774
278 Ga0496112_0042253 3300048915 Bacteria 4459
279 Ga0496112_0366013 3300048915 Bacteria 1383
280 Ga0496112_0369486 3300048915 Bacteria 1376
281 Ga0496113_0011834 3300048916 Bacteria 5845
282 Ga0496113_0091689 3300048916 Bacteria 2343
283 Ga0496114_0157004 3300048917 Bacteria 1976
284 Ga0496114_0203026 3300048917 Bacteria 1736
285 Ga0501034_0015307 3300049571 Bacteria 7884
286 Ga0501034_0174155 3300049571 Bacteria 2118
287 Ga0501036_0119668 3300049572 Bacteria 2224
288 Ga0501038_0122109 3300049574 Unclassified 2147
289 Ga0501038_0454966 3300049574 Bacteria 984
290 Ga0501039_0072509 3300049575 Bacteria 2676
291 Ga0501040_0069640 3300049576 Bacteria 2427
292 Ga0501040_0832539 3300049576 Bacteria 668
293 Ga0501041_0006877 3300049577 Bacteria 6666
294 Ga0501041_0297977 3300049577 Unclassified 1016
295 Ga0501042_0014760 3300049578 Bacteria 5334
296 Ga0501043_0571186 3300049579 Bacteria 838
297 Ga0501046_0066040 3300049580 Unclassified 2821
298 Ga0501047_0006564 3300049581 Bacteria 10952
299 Ga0501047_0147499 3300049581 Bacteria 2229
300 Ga0501048_0085307 3300049582 Unclassified 2227
301 Ga0501068_0235556 3300049584 Bacteria 1165
302 Ga0501071_0160700 3300049587 Bacteria 1679
303 Ga0501072_0018264 3300049588 Bacteria 5396
304 Ga0501073_0340553 3300049589 Bacteria 1035
305 Ga0501074_0378773 3300049590 Unclassified 1004
306 Ga0501076_0033001 3300049592 Bacteria 4042
307 Ga0501079_0063576 3300049741 Bacteria 2847
308 Ga0501081_0098744 3300049743 Bacteria 2062
309 Ga0501035_0152554 3300049822 Bacteria 2004
310 Ga0501044_0063277 3300049823 Bacteria 3780
311 Ga0501045_0137307 3300049824 Bacteria 1818
312 Ga0501045_0175452 3300049824 Bacteria 1597
313 nmdc:mga05p37_171643_c1 3300050507 Bacteria 2644
314 nmdc:mga05p37_517811_c1 3300050507 Bacteria 1365
315 nmdc:mga05p37_655010_c1 3300050507 Bacteria 1175
316 nmdc:mga05p37_704412_c1 3300050507 Bacteria 1121
317 nmdc:mga09592_20949_c1 3300050508 Bacteria 5383
318 nmdc:mga0qj67_12794_c1 3300050509 Bacteria 6329
319 nmdc:mga08y16_168837_c1 3300050511 Bacteria 2273
320 nmdc:mga08y16_191966_c1 3300050511 Bacteria 2118
321 nmdc:mga08y16_804713_c1 3300050511 Bacteria 932
322 nmdc:mga0n895_1110_c1 3300050512 Bacteria 19640
323 nmdc:mga0n895_112167_c1 3300050512 Bacteria 2744
324 nmdc:mga0n895_16030_c1 3300050512 Bacteria 6864
325 nmdc:mga0n895_75460_c1 3300050512 Bacteria 3352
326 nmdc:mga0rr50_217437_c1 3300050513 Bacteria 1577
327 nmdc:mga0rr50_272119_c1 3300050513 Bacteria 1412
328 nmdc:mga0rr50_28_c1 3300050513 Bacteria 108950
329 nmdc:mga0rr50_38805_c1 3300050513 Bacteria 3450
330 nmdc:mga0rr50_91214_c1 3300050513 Bacteria 2373
331 nmdc:mga08x19_121_c1 3300050514 Bacteria 69968
332 nmdc:mga08x19_13456_c1 3300050514 Bacteria 4948
333 nmdc:mga08x19_601032_c1 3300050514 Bacteria 780
334 nmdc:mga08x19_96791_c1 3300050514 Bacteria 1954
335 nmdc:mga08x19_97778_c1 3300050514 Bacteria 1944
336 nmdc:mga0a205_118219_c1 3300050515 Bacteria 2549
337 nmdc:mga0a205_56762_c1 3300050515 Bacteria 3780
338 Ga0495601_0016947 3300053077 Bacteria 4420
339 Ga0495601_0054641 3300053077 Bacteria 2527
340 Ga0495601_0206240 3300053077 Bacteria 1284
341 Ga0495595_0047249 3300053084 Bacteria 1985
342 Ga0495619_0010436 3300053085 Bacteria 5846
343 Ga0495619_0222602 3300053085 Bacteria 1307
344 Ga0501084_0048971 3300054114 Bacteria 3537
345 Ga0501082_0198994 3300060353 Bacteria 1743
346 Ga0501082_0391137 3300060353 Bacteria 1213
347 Ga0501082_0504719 3300060353 Bacteria 1057
348 Ga0530510_0021311 3300061734 Bacteria 4611
349 Ga0495609_0074439
350 Ga0065712_10069647
351 Ga0065712_10152666
352 Ga0070676_10430446
353 Ga0070683_100024989
354 Ga0070670_100611341
355 Ga0070677_10114722
356 Ga0068869_100251044
357 Ga0070680_100088981
358 Ga0068868_100164382
359 Ga0070660_100013950
360 Ga0070660_100365905
361 Ga0070691_10005391
362 Ga0070691_10192473
363 Ga0070692_10166546
364 Ga0070668_100061615
365 Ga0070669_100126817
366 Ga0070669_100203880
367 Ga0070675_100293327
368 Ga0070671_100165521
369 Ga0070671_101066574
370 Ga0070674_100346368
371 Ga0070673_100058579
372 Ga0070688_100507914
373 Ga0070659_100185406
374 Ga0070659_100336452
375 Ga0070713_101057500
376 Ga0070701_10044991
377 Ga0070701_10057268
378 Ga0070701_10190086
379 Ga0070705_100002798
380 Ga0070705_100092908
381 Ga0070700_100003978
382 Ga0070694_100097473
383 Ga0070662_100378989
384 Ga0070681_10000926
385 Ga0068867_100012153
386 Ga0070706_100247188
387 Ga0070707_100256712
388 Ga0070707_100424627
389 Ga0070699_100106339
390 Ga0070679_100004319
391 Ga0070679_100011918
392 Ga0070684_100010986
393 Ga0070697_100718451
394 Ga0070672_100104885
395 Ga0070672_100306924
396 Ga0070686_100467502
397 Ga0070686_100605270
398 Ga0070695_100033314
399 Ga0070696_100033671
400 Ga0070696_100346608
401 Ga0070704_100012700
402 Ga0070704_100023092
403 Ga0068855_100012391
404 Ga0070664_100042225
405 Ga0068857_100031800
406 Ga0068854_100297250
407 Ga0068856_100251581
408 Ga0070702_100002550
409 Ga0070702_100022961
410 Ga0068852_100745988
411 Ga0068859_100098774
412 Ga0068859_100159471
413 Ga0068859_101072835
414 Ga0068864_100002331
415 Ga0068866_10447446
416 Ga0068861_100004253
417 Ga0068861_100141427
418 Ga0068861_100523797
419 Ga0068851_10012457
420 Ga0068863_100622223
421 Ga0068858_100035521
422 Ga0068858_100218946
423 Ga0068858_100832518
424 Ga0068860_100407138
425 Ga0068862_100530517
426 Ga0081539_10015206
427 Ga0097621_100122275
428 Ga0097621_100358495
429 Ga0097621_100362901
430 Ga0097621_100705920
431 Ga0097621_101141020
432 Ga0068871_100009037
433 Ga0068871_100061983
434 Ga0068871_100715802
435 Ga0068871_100730270
436 Ga0075428_100006386
437 Ga0075428_100186965
438 Ga0075430_100002239
439 Ga0075431_100001153
440 Ga0075434_100000919
441 Ga0075434_100006466
442 Ga0075429_100029634
443 Ga0075436_100018737
444 Ga0075436_100021161
445 Ga0075436_100042530
446 Ga0097620_100098770
447 Ga0097620_100159473
448 Ga0097620_101072832
449 Ga0075435_100000353
450 Ga0075435_100006608
451 Ga0075435_100493334
452 Ga0105240_10089310
453 Ga0105240_11190463
454 Ga0111539_10049518
455 Ga0111539_10171869
456 Ga0111539_10255130
457 Ga0111539_11281269
458 Ga0105245_10146106
459 Ga0105245_10152435
460 Ga0105247_10068619
461 Ga0114129_10709468
462 Ga0114129_10749222
463 Ga0114129_10832293
464 Ga0105243_11142856
465 Ga0105241_10722616
466 Ga0105242_10072616
467 Ga0105242_10641809
468 Ga0105248_10312123
469 Ga0105248_10524820
470 Ga0105248_10844194
471 Ga0105238_10492483
472 Ga0105249_10533141
473 Ga0157374_10022217
474 Ga0157378_10318632
475 Ga0157378_11115373
476 Ga0157375_10130402
477 Ga0157375_10609542
478 Ga0163163_10039033
479 Ga0163163_10066121
480 Ga0163163_10252618
481 Ga0163163_11240320
482 Ga0157380_10127206
483 Ga0157380_11288291
484 Ga0157379_10015268
485 Ga0157379_10032311
486 Ga0157376_10153466
487 Ga0157376_10251130
488 Ga0182007_10196312
489 Ga0207697_10108022
490 Ga0207682_10069583
491 Ga0207642_10151448
492 Ga0207710_10004508
493 Ga0207710_10094828
494 Ga0207688_10070223
495 Ga0207688_10141525
496 Ga0207645_10000374
497 Ga0207645_10312862
498 Ga0207643_10038016
499 Ga0207705_10024227
500 Ga0207684_10118177
501 Ga0207707_10008909
502 Ga0207707_10549668
503 Ga0207660_10171274
504 Ga0207660_10623181
505 Ga0207657_10000448
506 Ga0207657_10122037
507 Ga0207649_10136686
508 Ga0207652_10015551
509 Ga0207646_10088728
510 Ga0207681_10035629
511 Ga0207681_10055414
512 Ga0207650_10352763
513 Ga0207687_10067321
514 Ga0207644_10122734
515 Ga0207690_10010646
516 Ga0207686_10243605
517 Ga0207709_10567111
518 Ga0207670_10383314
519 Ga0207704_10038266
520 Ga0207704_10362023
521 Ga0207665_10135181
522 Ga0207691_10043122
523 Ga0207691_10357100
524 Ga0207711_10041791
525 Ga0207711_10129262
526 Ga0207711_10353941
527 Ga0207679_10117199
528 Ga0207667_10068027
529 Ga0207667_10528164
530 Ga0207651_10207855
531 Ga0207651_10213930
532 Ga0207651_10515814
533 Ga0207640_10053034
534 Ga0207658_10239001
535 Ga0207703_10222156
536 Ga0207703_10282466
537 Ga0207703_10466745
538 Ga0207703_11122359
539 Ga0207708_10056287
540 Ga0207708_10078793
541 Ga0207708_10109996
542 Ga0207702_10585392
543 Ga0207641_10307647
544 Ga0207641_10686557
545 Ga0207648_10361369
546 Ga0207648_10493390
547 Ga0207676_10035454
548 Ga0207676_10119314
549 Ga0207674_10035104
550 Ga0207675_100001961
551 Ga0207675_100206786
552 Ga0207675_100388510
553 Ga0207683_10237443
554 Ga0207698_10072751
555 Ga0207428_10025243
556 Ga0268266_10189191
557 Ga0268265_10463347
558 Ga0268264_10123523
559 Ga0307408_100123068
560 Ga0307405_10367459
561 Ga0307406_10050379
562 Ga0307416_100024508
563 Ga0307416_100235950
564 Ga0373934_0116208
565 Ga0373936_0084696
566 Ga0373954_0170759
567 Ga0373956_0149339
568 Ga0373943_0033744
569 Ga0373946_0192129
570 Ga0373955_0012509
571 Ga0373924_0055095
572 Ga0373931_0076988
573 Ga0373947_0018355
574 Ga0373937_0053969
575 Ga0373937_0075873
576 Ga0373937_0109868
577 Ga0373937_0262154
578 Ga0373925_0086531
579 Ga0373925_0354545
580 Ga0466963_0049761
581 Ga0451576_0007133
582 Ga0451576_0013194
583 Ga0451576_0017863
584 Ga0451576_1239644
585 Ga0466967_0107408
586 Ga0466967_0758932
587 Ga0495592_0227457
588 Ga0495592_0335893
589 Ga0495603_0406545
590 Ga0495580_0267936
591 Ga0495582_0267030
592 Ga0495628_0076533
593 Ga0495628_0216118
594 Ga0495628_0234109
595 Ga0495663_0005606
596 Ga0495642_0034480
597 Ga0495665_0211585
598 Ga0495586_0227914
599 Ga0495587_0031898
600 Ga0495621_0027659
601 Ga0495645_0004379
602 Ga0495667_0308418
603 Ga0495635_0081835
604 Ga0495635_0156503
605 Ga0495659_0007090
606 Ga0495658_0150517
607 Ga0495658_0404673
608 Ga0495669_0025398
609 Ga0495669_0123942
610 Ga0495613_0187213
611 Ga0495674_0206570
612 Ga0495674_0270615
613 Ga0495674_0362005
614 Ga0495674_0442758
615 Ga0496101_0568151
616 Ga0496104_0010445
617 Ga0496104_0115609
618 Ga0496104_0640446
619 Ga0496106_0053746
620 Ga0496106_0479061
621 Ga0496108_0009031
622 Ga0496109_0108907
623 Ga0496109_0173813
624 Ga0496110_0013141
625 Ga0496112_0024556
626 Ga0496112_0042253
627 Ga0496112_0366013
628 Ga0496112_0369486
629 Ga0496113_0011834
630 Ga0496113_0091689
631 Ga0496114_0157004
632 Ga0496114_0203026
633 Ga0501034_0015307
634 Ga0501034_0174155
635 Ga0501036_0119668
636 Ga0501038_0122109
637 Ga0501038_0454966
638 Ga0501039_0072509
639 Ga0501040_0069640
640 Ga0501040_0832539
641 Ga0501041_0006877
642 Ga0501041_0297977
643 Ga0501042_0014760
644 Ga0501043_0571186
645 Ga0501046_0066040
646 Ga0501047_0006564
647 Ga0501047_0147499
648 Ga0501048_0085307
649 Ga0501068_0235556
650 Ga0501071_0160700
651 Ga0501072_0018264
652 Ga0501073_0340553
653 Ga0501074_0378773
654 Ga0501076_0033001
655 Ga0501079_0063576
656 Ga0501081_0098744
657 Ga0501035_0152554
658 Ga0501044_0063277
659 Ga0501045_0137307
660 Ga0501045_0175452
661 nmdc:mga05p37_171643_c1
662 nmdc:mga05p37_517811_c1
663 nmdc:mga05p37_655010_c1
664 nmdc:mga05p37_704412_c1
665 nmdc:mga09592_20949_c1
666 nmdc:mga0qj67_12794_c1
667 nmdc:mga08y16_168837_c1
668 nmdc:mga08y16_191966_c1
669 nmdc:mga08y16_804713_c1
670 nmdc:mga0n895_1110_c1
671 nmdc:mga0n895_112167_c1
672 nmdc:mga0n895_16030_c1
673 nmdc:mga0n895_75460_c1
674 nmdc:mga0rr50_217437_c1
675 nmdc:mga0rr50_272119_c1
676 nmdc:mga0rr50_28_c1
677 nmdc:mga0rr50_38805_c1
678 nmdc:mga0rr50_91214_c1
679 nmdc:mga08x19_121_c1
680 nmdc:mga08x19_13456_c1
681 nmdc:mga08x19_601032_c1
682 nmdc:mga08x19_96791_c1
683 nmdc:mga08x19_97778_c1
684 nmdc:mga0a205_118219_c1
685 nmdc:mga0a205_56762_c1
686 Ga0495601_0016947
687 Ga0495601_0054641
688 Ga0495601_0206240
689 Ga0495595_0047249
690 Ga0495619_0010436
691 Ga0495619_0222602
692 Ga0501084_0048971
693 Ga0501082_0198994
694 Ga0501082_0391137
695 Ga0501082_0504719
696 Ga0530510_0021311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01330

RuvA_N

RuvA N terminal domain

1

62

0.99

PF07499

RuvA_C

RuvA, C-terminal domain

142

189

0.96

PF14520

HHH_5

Helix-hairpin-helix domain

72

121

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x7q-assembly1.cif.gz_G cryoem structure of ruva-ruvb-holliday junction complex 0.9688 1 131
7pbu-assembly1.cif.gz_F ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] 0.9502 1 133
1d8l-assembly1.cif.gz_A e. coli holliday junction binding protein ruva nh2 region lacking domain iii 0.9452 1 138
2zte-assembly1.cif.gz_A mtruva form iv 0.9452 1 131
7pbu-assembly1.cif.gz_F ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] 0.9433 1 133
ID Description Score Start End Superfamily
1d8lB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9578 1 65 2.40.50.140
1bvsA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9544 68 132 1.10.150.20
1bvsB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9541 68 133 1.10.150.20
1d8lB01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9519 68 131 1.10.150.20
2h5xB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9496 67 134 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A7C2L542-F1-model_v4 Holliday junction branch migration protein RuvA 0.9846 1 132 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A7W1I2A7-F1-model_v4 Holliday junction branch migration protein RuvA (EC 3.6.4.12) 0.9826 1 120 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-A0A660YIC9-F1-model_v4 Holliday junction branch migration protein RuvA 0.9823 1 101 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A7V9S6M6-F1-model_v4 Holliday junction branch migration protein RuvA (EC 3.6.4.12) 0.9802 1 132 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-A0A523QLT6-F1-model_v4 Holliday junction branch migration protein RuvA (EC 3.6.4.12) 0.9795 1 132 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518

Map