F417635

General Info

Members Datasets Scaffolds Average Seq Length
348 180 696 105

Family's Representative Sequence

Representative Sequence 3300041460|Ga0451802_2067835|Ga0451802_2067835_154_522
Length 122
Sequence LREEQKAADERLREEQRAPVIPGEILYGDGDITINDGAERLELSVVNTGDRPVQVGSHVHLPQSNAALDFDRVAAHGHRLDIPAGTAVRFEPGISQDVSLVPLAGTREVYGLSLNPPGKLDT

Samples

Sample ID Description Type Environment
1 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
106 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
107 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
110 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
111 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
163 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
164 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
165 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
166 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
167 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
168 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
172 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
173 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
174 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
175 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
176 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
177 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
178 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
179 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
180 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 0
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.69
Nodule 0
Rhizoplane 20.11
Rhizosphere 48.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451802_2067835 3300041460 Bacteria 946
2 Ga0055540_1003531 3300003792 Bacteria 7501
3 Ga0055540_1007888 3300003792 Bacteria 3929
4 Ga0055540_1009164 3300003792 Bacteria 3460
5 Ga0070670_100365745 3300005331 Bacteria 1269
6 Ga0070666_10235004 3300005335 Bacteria 1295
7 Ga0070682_100103645 3300005337 Bacteria 1883
8 Ga0070682_100307300 3300005337 Bacteria 1166
9 Ga0068868_101262048 3300005338 Bacteria 685
10 Ga0070660_100423412 3300005339 Bacteria 1103
11 Ga0070661_101013612 3300005344 Bacteria 689
12 Ga0070668_100369397 3300005347 Bacteria 1218
13 Ga0070668_100393744 3300005347 Bacteria 1181
14 Ga0070669_100023466 3300005353 Bacteria 4417
15 Ga0070675_100854352 3300005354 Bacteria 833
16 Ga0070671_100101511 3300005355 Bacteria 2414
17 Ga0070674_101909157 3300005356 Bacteria 540
18 Ga0070688_100800940 3300005365 Bacteria 737
19 Ga0070659_101750932 3300005366 Bacteria 556
20 Ga0070667_100000139 3300005367 Bacteria 92556
21 Ga0070667_100001407 3300005367 Bacteria 21508
22 Ga0070667_100326628 3300005367 Bacteria 1385
23 Ga0070667_100852995 3300005367 Bacteria 847
24 Ga0070714_100530998 3300005435 Bacteria 1125
25 Ga0070663_100004230 3300005455 Bacteria 8399
26 Ga0070678_100111280 3300005456 Bacteria 2143
27 Ga0070685_10131337 3300005466 Bacteria 1566
28 Ga0068853_100023790 3300005539 Bacteria 5132
29 Ga0068853_101512233 3300005539 Bacteria 650
30 Ga0070665_100009242 3300005548 Bacteria 9987
31 Ga0070665_100472778 3300005548 Bacteria 1264
32 Ga0070665_101444371 3300005548 Bacteria 697
33 Ga0070704_101699466 3300005549 Bacteria 583
34 Ga0068854_100204502 3300005578 Bacteria 1554
35 Ga0068854_101881720 3300005578 Bacteria 550
36 Ga0070702_100389360 3300005615 Bacteria 994
37 Ga0068852_100416770 3300005616 Bacteria 1324
38 Ga0068852_101359906 3300005616 Bacteria 732
39 Ga0068852_102113596 3300005616 Bacteria 585
40 Ga0068859_100000938 3300005617 Bacteria 29840
41 Ga0068859_100952624 3300005617 Bacteria 941
42 Ga0068859_101681763 3300005617 Bacteria 701
43 Ga0068864_100308283 3300005618 Bacteria 1484
44 Ga0068861_100554684 3300005719 Bacteria 1048
45 Ga0068851_10226189 3300005834 Bacteria 1053
46 Ga0068870_10099073 3300005840 Bacteria 1643
47 Ga0068870_10881903 3300005840 Bacteria 631
48 Ga0068863_100000121 3300005841 Bacteria 81842
49 Ga0068863_100487480 3300005841 Bacteria 1213
50 Ga0068863_100764860 3300005841 Bacteria 962
51 Ga0068858_100292528 3300005842 Bacteria 1553
52 Ga0068858_100745718 3300005842 Bacteria 954
53 Ga0068860_100000025 3300005843 Bacteria 271553
54 Ga0068860_100523299 3300005843 Bacteria 1186
55 Ga0068860_101807053 3300005843 Bacteria 633
56 Ga0068862_100000045 3300005844 Bacteria 155641
57 Ga0075365_10064267 3300006038 Bacteria 2458
58 Ga0075365_10161806 3300006038 Bacteria 1560
59 Ga0075365_10926397 3300006038 Bacteria 614
60 Ga0075368_10017545 3300006042 Bacteria 2680
61 Ga0075363_100000739 3300006048 Bacteria 11131
62 Ga0075363_100008231 3300006048 Bacteria 4845
63 Ga0075363_100555482 3300006048 Bacteria 685
64 Ga0075364_10001676 3300006051 Bacteria 12164
65 Ga0075364_10031421 3300006051 Bacteria 3412
66 Ga0075364_10082831 3300006051 Bacteria 2122
67 Ga0075364_10122184 3300006051 Bacteria 1744
68 Ga0075364_10232862 3300006051 Bacteria 1251
69 Ga0075364_10509563 3300006051 Bacteria 822
70 Ga0075364_10973845 3300006051 Bacteria 577
71 Ga0075362_10022950 3300006177 Bacteria 2634
72 Ga0075367_10013027 3300006178 Bacteria 4456
73 Ga0075369_10004555 3300006186 Bacteria 5132
74 Ga0075369_10007361 3300006186 Bacteria 4189
75 Ga0075369_10034437 3300006186 Bacteria 2149
76 Ga0075369_10063923 3300006186 Bacteria 1611
77 Ga0075366_10085649 3300006195 Bacteria 1885
78 Ga0075370_10008956 3300006353 Bacteria 5174
79 Ga0075370_10033889 3300006353 Bacteria 2861
80 Ga0075370_10058904 3300006353 Bacteria 2185
81 Ga0075370_10821493 3300006353 Bacteria 567
82 Ga0097620_100000938 3300006931 Bacteria 29840
83 Ga0097620_100952601 3300006931 Bacteria 941
84 Ga0097620_101681778 3300006931 Bacteria 701
85 Ga0111539_10895756 3300009094 Bacteria 1032
86 Ga0111539_12264596 3300009094 Bacteria 630
87 Ga0105247_10000010 3300009101 Bacteria 302475
88 Ga0105247_10095386 3300009101 Bacteria 1894
89 Ga0105247_10277311 3300009101 Bacteria 1155
90 Ga0105247_10657198 3300009101 Bacteria 784
91 Ga0105247_10671870 3300009101 Bacteria 776
92 Ga0105241_11385194 3300009174 Bacteria 673
93 Ga0105248_10000100 3300009177 Bacteria 95523
94 Ga0105248_10255820 3300009177 Bacteria 1971
95 Ga0105248_13154435 3300009177 Bacteria 525
96 Ga0105237_10397813 3300009545 Bacteria 1382
97 Ga0105237_11247923 3300009545 Bacteria 750
98 Ga0105238_10202456 3300009551 Bacteria 1961
99 Ga0105238_11333777 3300009551 Bacteria 744
100 Ga0105238_12174740 3300009551 Bacteria 589
101 Ga0105249_10000010 3300009553 Bacteria 306939
102 Ga0099796_10006437 3300010159 Bacteria 3005
103 Ga0105239_10042894 3300010375 Bacteria 4957
104 Ga0105239_10879010 3300010375 Bacteria 1028
105 Ga0105239_10881662 3300010375 Bacteria 1027
106 Ga0157375_10237123 3300013308 Bacteria 1983
107 Ga0163163_10058379 3300014325 Bacteria 3815
108 Ga0163163_13044202 3300014325 Bacteria 523
109 Ga0157380_11982416 3300014326 Bacteria 644
110 Ga0157379_10109582 3300014968 Bacteria 2480
111 Ga0157379_11012646 3300014968 Bacteria 792
112 Ga0209673_1034520 3300025273 Bacteria 1526
113 Ga0209051_1001403 3300025303 Bacteria 20724
114 Ga0209051_1002857 3300025303 Bacteria 11890
115 Ga0207656_10440958 3300025321 Bacteria 657
116 Ga0207710_10000028 3300025900 Bacteria 304525
117 Ga0207710_10387832 3300025900 Bacteria 716
118 Ga0207688_10434923 3300025901 Bacteria 817
119 Ga0207680_10174409 3300025903 Bacteria 1450
120 Ga0207643_10336800 3300025908 Bacteria 945
121 Ga0207671_10993558 3300025914 Bacteria 661
122 Ga0207681_10016854 3300025923 Bacteria 4580
123 Ga0207694_10143230 3300025924 Bacteria 1923
124 Ga0207650_10249177 3300025925 Bacteria 1438
125 Ga0207659_10458624 3300025926 Bacteria 1074
126 Ga0207664_10457669 3300025929 Bacteria 1139
127 Ga0207644_10111962 3300025931 Bacteria 2065
128 Ga0207690_10271922 3300025932 Bacteria 1317
129 Ga0207706_11604181 3300025933 Bacteria 527
130 Ga0207669_10220695 3300025937 Bacteria 1391
131 Ga0207691_11679888 3300025940 Bacteria 514
132 Ga0207711_10000081 3300025941 Bacteria 102547
133 Ga0207711_11334426 3300025941 Bacteria 660
134 Ga0207661_12021068 3300025944 Bacteria 522
135 Ga0207712_10000016 3300025961 Bacteria 343014
136 Ga0207668_10155304 3300025972 Bacteria 1777
137 Ga0207668_11856648 3300025972 Bacteria 543
138 Ga0207640_10306337 3300025981 Bacteria 1259
139 Ga0207640_11819347 3300025981 Bacteria 551
140 Ga0207658_10000273 3300025986 Bacteria 54045
141 Ga0207658_10075169 3300025986 Bacteria 2570
142 Ga0207658_10788176 3300025986 Bacteria 862
143 Ga0207677_10034152 3300026023 Bacteria 3291
144 Ga0207677_11428773 3300026023 Bacteria 638
145 Ga0207703_10025535 3300026035 Bacteria 4646
146 Ga0207703_10872768 3300026035 Bacteria 861
147 Ga0207639_10008479 3300026041 Bacteria 7044
148 Ga0207639_10297243 3300026041 Bacteria 1426
149 Ga0207678_10010467 3300026067 Bacteria 8145
150 Ga0207678_11131754 3300026067 Bacteria 693
151 Ga0207708_10801170 3300026075 Bacteria 811
152 Ga0207641_10000284 3300026088 Bacteria 63546
153 Ga0207641_10162018 3300026088 Bacteria 2034
154 Ga0207641_10462713 3300026088 Bacteria 1227
155 Ga0207676_10343609 3300026095 Bacteria 1378
156 Ga0207675_100286983 3300026118 Bacteria 1600
157 Ga0207675_100505699 3300026118 Bacteria 1203
158 Ga0207683_10170074 3300026121 Bacteria 1973
159 Ga0209813_10025460 3300027866 Bacteria 1702
160 Ga0268266_10007642 3300028379 Bacteria 9721
161 Ga0268266_10614509 3300028379 Bacteria 1045
162 Ga0268266_12069961 3300028379 Bacteria 542
163 Ga0268266_12155766 3300028379 Bacteria 530
164 Ga0268265_10000056 3300028380 Bacteria 155720
165 Ga0268265_10106174 3300028380 Bacteria 2281
166 Ga0268264_10000053 3300028381 Bacteria 320368
167 Ga0268264_10277708 3300028381 Bacteria 1568
168 Ga0268264_11683749 3300028381 Bacteria 645
169 Ga0265327_10000019 3300031251 Bacteria 427653
170 Ga0265327_10000185 3300031251 Bacteria 131884
171 Ga0265327_10007964 3300031251 Bacteria 8015
172 Ga0307410_10274591 3300031852 Bacteria 1320
173 Ga0307407_10443790 3300031903 Bacteria 940
174 Ga0307409_101590782 3300031995 Bacteria 682
175 Ga0307416_100435758 3300032002 Bacteria 1359
176 Ga0307416_101015605 3300032002 Bacteria 933
177 Ga0307416_101044081 3300032002 Bacteria 921
178 Ga0307411_11353052 3300032005 Bacteria 650
179 Ga0307415_100061586 3300032126 Bacteria 2599
180 Ga0307415_100286836 3300032126 Bacteria 1357
181 Ga0307415_100708590 3300032126 Bacteria 909
182 Ga0373949_0238530 3300035090 Bacteria 558
183 Ga0439465_0086265 3300041413 Bacteria 1069
184 Ga0451793_1193203 3300041452 Bacteria 1529
185 Ga0451797_0834264 3300041453 Bacteria 1020
186 Ga0451798_0581176 3300041458 Bacteria 604
187 Ga0451798_1122127 3300041458 Bacteria 711
188 Ga0451807_0398111 3300041486 Bacteria 660
189 Ga0451835_0650563 3300041492 Bacteria 542
190 Ga0439445_0055036 3300042004 Bacteria 1080
191 Ga0439434_0349702 3300042435 Bacteria 516
192 Ga0466972_0189610 3300044658 Bacteria 964
193 Ga0466965_0087703 3300044683 Bacteria 1579
194 Ga0466965_0703123 3300044683 Bacteria 580
195 Ga0466961_0007159 3300044693 Bacteria 7098
196 Ga0466968_0057385 3300044735 Bacteria 1674
197 Ga0466960_0354271 3300044901 Bacteria 838
198 Ga0495638_0009428 3300046460 Bacteria 6856
199 Ga0495580_0066832 3300046472 Bacteria 2516
200 Ga0495637_0279227 3300046520 Bacteria 596
201 Ga0495665_0019898 3300046531 Bacteria 3609
202 Ga0495660_0468795 3300046810 Bacteria 542
203 Ga0496100_0000080 3300048903 Bacteria 54146
204 Ga0496100_0020959 3300048903 Bacteria 3928
205 Ga0496100_0040391 3300048903 Bacteria 2968
206 Ga0496100_0048358 3300048903 Bacteria 2745
207 Ga0496100_0483703 3300048903 Bacteria 952
208 Ga0496101_0000074 3300048904 Bacteria 113105
209 Ga0496101_0006981 3300048904 Bacteria 7290
210 Ga0496101_0008600 3300048904 Bacteria 6672
211 Ga0496101_0040318 3300048904 Bacteria 3326
212 Ga0496101_0196884 3300048904 Bacteria 1557
213 Ga0496101_1572807 3300048904 Bacteria 511
214 Ga0496102_0000070 3300048905 Bacteria 155087
215 Ga0496102_0042973 3300048905 Bacteria 4096
216 Ga0496102_0219922 3300048905 Bacteria 1790
217 Ga0496103_0000381 3300048906 Bacteria 39710
218 Ga0496103_0001685 3300048906 Bacteria 14455
219 Ga0496103_0055511 3300048906 Bacteria 2457
220 Ga0496103_0179886 3300048906 Bacteria 1359
221 Ga0496104_0024136 3300048907 Bacteria 5595
222 Ga0496104_0312591 3300048907 Bacteria 1484
223 Ga0496104_0432569 3300048907 Bacteria 1228
224 Ga0496104_0462547 3300048907 Bacteria 1180
225 Ga0496105_0055020 3300048908 Bacteria 3286
226 Ga0496105_0736172 3300048908 Bacteria 754
227 Ga0496106_0002629 3300048909 Bacteria 13350
228 Ga0496106_0043698 3300048909 Bacteria 3362
229 Ga0496106_0474993 3300048909 Bacteria 1004
230 Ga0496106_0653281 3300048909 Bacteria 840
231 Ga0496106_0795251 3300048909 Bacteria 750
232 Ga0496107_0000428 3300048910 Bacteria 22805
233 Ga0496107_0332643 3300048910 Bacteria 1130
234 Ga0496107_0662880 3300048910 Bacteria 769
235 Ga0496108_0000879 3300048911 Bacteria 23419
236 Ga0496108_0064635 3300048911 Bacteria 3083
237 Ga0496108_0193147 3300048911 Bacteria 1765
238 Ga0496108_0348295 3300048911 Bacteria 1293
239 Ga0496108_0873969 3300048911 Bacteria 773
240 Ga0496108_0986300 3300048911 Bacteria 720
241 Ga0496109_0000160 3300048912 Bacteria 66073
242 Ga0496109_0026965 3300048912 Bacteria 5125
243 Ga0496109_0033334 3300048912 Bacteria 4633
244 Ga0496109_0034511 3300048912 Bacteria 4557
245 Ga0496109_1223463 3300048912 Bacteria 687
246 Ga0496110_0000884 3300048913 Bacteria 21114
247 Ga0496110_0167768 3300048913 Bacteria 1991
248 Ga0496111_0070989 3300048914 Bacteria 2534
249 Ga0496111_0137510 3300048914 Bacteria 1810
250 Ga0496111_0838218 3300048914 Bacteria 664
251 Ga0496112_0001092 3300048915 Bacteria 20070
252 Ga0496112_0012593 3300048915 Bacteria 7773
253 Ga0496112_0107614 3300048915 Bacteria 2758
254 Ga0496113_0046852 3300048916 Bacteria 3211
255 Ga0496113_0194735 3300048916 Bacteria 1610
256 Ga0496113_0255178 3300048916 Bacteria 1400
257 Ga0496113_0345304 3300048916 Bacteria 1194
258 Ga0496113_0378742 3300048916 Bacteria 1136
259 Ga0496113_0480341 3300048916 Bacteria 998
260 Ga0496114_0000117 3300048917 Bacteria 57611
261 Ga0496114_0007855 3300048917 Bacteria 8440
262 Ga0496114_0197393 3300048917 Bacteria 1762
263 Ga0496115_0071381 3300048918 Bacteria 2816
264 Ga0496115_0103512 3300048918 Bacteria 2335
265 Ga0496115_0452824 3300048918 Bacteria 1036
266 Ga0496115_0993653 3300048918 Bacteria 642
267 Ga0496116_0013206 3300048919 Bacteria 6678
268 Ga0496116_0029270 3300048919 Bacteria 3974
269 Ga0496117_0000319 3300048920 Bacteria 84245
270 Ga0496117_0100444 3300048920 Bacteria 1832
271 Ga0496117_0115252 3300048920 Bacteria 1664
272 Ga0496118_0006615 3300048921 Bacteria 12657
273 Ga0496118_0033365 3300048921 Bacteria 4224
274 Ga0496118_0218389 3300048921 Bacteria 1112
275 Ga0496119_0000022 3300048922 Bacteria 269878
276 Ga0496119_0001215 3300048922 Bacteria 32180
277 Ga0496119_0003952 3300048922 Bacteria 15018
278 Ga0496119_0245871 3300048922 Bacteria 904
279 Ga0496120_0001626 3300048923 Bacteria 26036
280 Ga0496120_0041395 3300048923 Bacteria 2699
281 Ga0496120_0067812 3300048923 Bacteria 1970
282 Ga0496120_0074906 3300048923 Bacteria 1848
283 Ga0496121_0000014 3300048924 Bacteria 609379
284 Ga0496121_0007316 3300048924 Bacteria 13349
285 Ga0496122_0000097 3300048925 Bacteria 199223
286 Ga0496122_0006893 3300048925 Bacteria 12848
287 Ga0496123_0005804 3300048926 Bacteria 12256
288 Ga0496123_0017461 3300048926 Bacteria 5770
289 Ga0496124_0000019 3300048927 Bacteria 436995
290 Ga0496124_0108330 3300048927 Bacteria 2240
291 Ga0496124_0333917 3300048927 Bacteria 1080
292 Ga0496125_0000014 3300048928 Bacteria 610124
293 Ga0496125_0160687 3300048928 Bacteria 1526
294 Ga0496126_0000017 3300048929 Bacteria 610676
295 Ga0496126_0008145 3300048929 Bacteria 11347
296 Ga0496126_0147692 3300048929 Bacteria 2017
297 Ga0501032_0005401 3300049569 Bacteria 9505
298 Ga0501047_0555059 3300049581 Bacteria 973
299 Ga0501083_0715055 3300049744 Bacteria 651
300 nmdc:mga03683_42839_c1 3300050489 Bacteria 1864
301 nmdc:mga03683_9709_c1 3300050489 Bacteria 3432
302 nmdc:mga03n38_2031_c1 3300050490 Bacteria 6100
303 nmdc:mga03n38_21853_c1 3300050490 Bacteria 2581
304 nmdc:mga03n38_389655_c1 3300050490 Bacteria 765
305 nmdc:mga03n38_486231_c1 3300050490 Bacteria 691
306 nmdc:mga03n38_606420_c1 3300050490 Bacteria 624
307 nmdc:mga03n38_847415_c1 3300050490 Bacteria 534
308 nmdc:mga03n38_96876_c1 3300050490 Bacteria 1416
309 nmdc:mga00v17_1197_c1 3300050491 Bacteria 13593
310 nmdc:mga00v17_20145_c1 3300050491 Bacteria 3818
311 nmdc:mga00v17_245988_c1 3300050491 Bacteria 1160
312 nmdc:mga00v17_284063_c1 3300050491 Bacteria 1074
313 nmdc:mga00v17_579531_c1 3300050491 Bacteria 724
314 nmdc:mga00v17_64609_c1 3300050491 Bacteria 2255
315 nmdc:mga0yw44_1070244_c1 3300050492 Bacteria 545
316 nmdc:mga0yw44_1166824_c1 3300050492 Bacteria 520
317 nmdc:mga0yw44_120299_c1 3300050492 Bacteria 1691
318 nmdc:mga0yw44_314967_c1 3300050492 Bacteria 1050
319 nmdc:mga0yw44_781424_c1 3300050492 Bacteria 648
320 nmdc:mga0k408_138423_c1 3300050493 Bacteria 1447
321 nmdc:mga06z11_4468_c1 3300050494 Bacteria 5504
322 nmdc:mga04h51_44885_c1 3300050495 Bacteria 1459
323 nmdc:mga07m45_121925_c1 3300050496 Bacteria 1506
324 nmdc:mga07m45_326852_c1 3300050496 Bacteria 891
325 nmdc:mga07m45_4141_c1 3300050496 Bacteria 7080
326 nmdc:mga08y16_936023_c1 3300050511 Bacteria 850
327 nmdc:mga0sz30_4361_c1 3300050516 Bacteria 5109
328 Ga0500610_0012294 3300053079 Bacteria 3938
329 Ga0495655_0295308 3300053083 Bacteria 555
330 Ga0500641_0269412 3300053096 Bacteria 709
331 Ga0500641_0299753 3300053096 Bacteria 660
332 Ga0500556_0182725 3300053104 Bacteria 828
333 Ga0500572_160527 3300053111 Bacteria 736
334 Ga0500642_0125730 3300053130 Bacteria 1201
335 Ga0500658_0145932 3300053134 Bacteria 1064
336 Ga0500568_0224707 3300053139 Bacteria 686
337 Ga0500616_0107930 3300053153 Bacteria 1349
338 Ga0500619_254829 3300053154 Bacteria 577
339 Ga0500620_088806 3300053155 Bacteria 1076
340 Ga0500645_000006 3300053730 Bacteria 276677
341 Ga0500645_021438 3300053730 Bacteria 1994
342 2644485429 2643221687 Bacteria 6500351
343 2644634640 2643221715 Bacteria 6671032
344 2738704292 2738541274 Bacteria 6909446
345 2739331225 2738543028 Bacteria 6917070
346 2902798170 2902792274 Bacteria 7270173
347 2902811270 2902810491 Bacteria 6794147
348 2939585441 2939582691 Bacteria 7088898
349 Ga0451802_2067835
350 Ga0055540_1003531
351 Ga0055540_1007888
352 Ga0055540_1009164
353 Ga0070670_100365745
354 Ga0070666_10235004
355 Ga0070682_100103645
356 Ga0070682_100307300
357 Ga0068868_101262048
358 Ga0070660_100423412
359 Ga0070661_101013612
360 Ga0070668_100369397
361 Ga0070668_100393744
362 Ga0070669_100023466
363 Ga0070675_100854352
364 Ga0070671_100101511
365 Ga0070674_101909157
366 Ga0070688_100800940
367 Ga0070659_101750932
368 Ga0070667_100000139
369 Ga0070667_100001407
370 Ga0070667_100326628
371 Ga0070667_100852995
372 Ga0070714_100530998
373 Ga0070663_100004230
374 Ga0070678_100111280
375 Ga0070685_10131337
376 Ga0068853_100023790
377 Ga0068853_101512233
378 Ga0070665_100009242
379 Ga0070665_100472778
380 Ga0070665_101444371
381 Ga0070704_101699466
382 Ga0068854_100204502
383 Ga0068854_101881720
384 Ga0070702_100389360
385 Ga0068852_100416770
386 Ga0068852_101359906
387 Ga0068852_102113596
388 Ga0068859_100000938
389 Ga0068859_100952624
390 Ga0068859_101681763
391 Ga0068864_100308283
392 Ga0068861_100554684
393 Ga0068851_10226189
394 Ga0068870_10099073
395 Ga0068870_10881903
396 Ga0068863_100000121
397 Ga0068863_100487480
398 Ga0068863_100764860
399 Ga0068858_100292528
400 Ga0068858_100745718
401 Ga0068860_100000025
402 Ga0068860_100523299
403 Ga0068860_101807053
404 Ga0068862_100000045
405 Ga0075365_10064267
406 Ga0075365_10161806
407 Ga0075365_10926397
408 Ga0075368_10017545
409 Ga0075363_100000739
410 Ga0075363_100008231
411 Ga0075363_100555482
412 Ga0075364_10001676
413 Ga0075364_10031421
414 Ga0075364_10082831
415 Ga0075364_10122184
416 Ga0075364_10232862
417 Ga0075364_10509563
418 Ga0075364_10973845
419 Ga0075362_10022950
420 Ga0075367_10013027
421 Ga0075369_10004555
422 Ga0075369_10007361
423 Ga0075369_10034437
424 Ga0075369_10063923
425 Ga0075366_10085649
426 Ga0075370_10008956
427 Ga0075370_10033889
428 Ga0075370_10058904
429 Ga0075370_10821493
430 Ga0097620_100000938
431 Ga0097620_100952601
432 Ga0097620_101681778
433 Ga0111539_10895756
434 Ga0111539_12264596
435 Ga0105247_10000010
436 Ga0105247_10095386
437 Ga0105247_10277311
438 Ga0105247_10657198
439 Ga0105247_10671870
440 Ga0105241_11385194
441 Ga0105248_10000100
442 Ga0105248_10255820
443 Ga0105248_13154435
444 Ga0105237_10397813
445 Ga0105237_11247923
446 Ga0105238_10202456
447 Ga0105238_11333777
448 Ga0105238_12174740
449 Ga0105249_10000010
450 Ga0099796_10006437
451 Ga0105239_10042894
452 Ga0105239_10879010
453 Ga0105239_10881662
454 Ga0157375_10237123
455 Ga0163163_10058379
456 Ga0163163_13044202
457 Ga0157380_11982416
458 Ga0157379_10109582
459 Ga0157379_11012646
460 Ga0209673_1034520
461 Ga0209051_1001403
462 Ga0209051_1002857
463 Ga0207656_10440958
464 Ga0207710_10000028
465 Ga0207710_10387832
466 Ga0207688_10434923
467 Ga0207680_10174409
468 Ga0207643_10336800
469 Ga0207671_10993558
470 Ga0207681_10016854
471 Ga0207694_10143230
472 Ga0207650_10249177
473 Ga0207659_10458624
474 Ga0207664_10457669
475 Ga0207644_10111962
476 Ga0207690_10271922
477 Ga0207706_11604181
478 Ga0207669_10220695
479 Ga0207691_11679888
480 Ga0207711_10000081
481 Ga0207711_11334426
482 Ga0207661_12021068
483 Ga0207712_10000016
484 Ga0207668_10155304
485 Ga0207668_11856648
486 Ga0207640_10306337
487 Ga0207640_11819347
488 Ga0207658_10000273
489 Ga0207658_10075169
490 Ga0207658_10788176
491 Ga0207677_10034152
492 Ga0207677_11428773
493 Ga0207703_10025535
494 Ga0207703_10872768
495 Ga0207639_10008479
496 Ga0207639_10297243
497 Ga0207678_10010467
498 Ga0207678_11131754
499 Ga0207708_10801170
500 Ga0207641_10000284
501 Ga0207641_10162018
502 Ga0207641_10462713
503 Ga0207676_10343609
504 Ga0207675_100286983
505 Ga0207675_100505699
506 Ga0207683_10170074
507 Ga0209813_10025460
508 Ga0268266_10007642
509 Ga0268266_10614509
510 Ga0268266_12069961
511 Ga0268266_12155766
512 Ga0268265_10000056
513 Ga0268265_10106174
514 Ga0268264_10000053
515 Ga0268264_10277708
516 Ga0268264_11683749
517 Ga0265327_10000019
518 Ga0265327_10000185
519 Ga0265327_10007964
520 Ga0307410_10274591
521 Ga0307407_10443790
522 Ga0307409_101590782
523 Ga0307416_100435758
524 Ga0307416_101015605
525 Ga0307416_101044081
526 Ga0307411_11353052
527 Ga0307415_100061586
528 Ga0307415_100286836
529 Ga0307415_100708590
530 Ga0373949_0238530
531 Ga0439465_0086265
532 Ga0451793_1193203
533 Ga0451797_0834264
534 Ga0451798_0581176
535 Ga0451798_1122127
536 Ga0451807_0398111
537 Ga0451835_0650563
538 Ga0439445_0055036
539 Ga0439434_0349702
540 Ga0466972_0189610
541 Ga0466965_0087703
542 Ga0466965_0703123
543 Ga0466961_0007159
544 Ga0466968_0057385
545 Ga0466960_0354271
546 Ga0495638_0009428
547 Ga0495580_0066832
548 Ga0495637_0279227
549 Ga0495665_0019898
550 Ga0495660_0468795
551 Ga0496100_0000080
552 Ga0496100_0020959
553 Ga0496100_0040391
554 Ga0496100_0048358
555 Ga0496100_0483703
556 Ga0496101_0000074
557 Ga0496101_0006981
558 Ga0496101_0008600
559 Ga0496101_0040318
560 Ga0496101_0196884
561 Ga0496101_1572807
562 Ga0496102_0000070
563 Ga0496102_0042973
564 Ga0496102_0219922
565 Ga0496103_0000381
566 Ga0496103_0001685
567 Ga0496103_0055511
568 Ga0496103_0179886
569 Ga0496104_0024136
570 Ga0496104_0312591
571 Ga0496104_0432569
572 Ga0496104_0462547
573 Ga0496105_0055020
574 Ga0496105_0736172
575 Ga0496106_0002629
576 Ga0496106_0043698
577 Ga0496106_0474993
578 Ga0496106_0653281
579 Ga0496106_0795251
580 Ga0496107_0000428
581 Ga0496107_0332643
582 Ga0496107_0662880
583 Ga0496108_0000879
584 Ga0496108_0064635
585 Ga0496108_0193147
586 Ga0496108_0348295
587 Ga0496108_0873969
588 Ga0496108_0986300
589 Ga0496109_0000160
590 Ga0496109_0026965
591 Ga0496109_0033334
592 Ga0496109_0034511
593 Ga0496109_1223463
594 Ga0496110_0000884
595 Ga0496110_0167768
596 Ga0496111_0070989
597 Ga0496111_0137510
598 Ga0496111_0838218
599 Ga0496112_0001092
600 Ga0496112_0012593
601 Ga0496112_0107614
602 Ga0496113_0046852
603 Ga0496113_0194735
604 Ga0496113_0255178
605 Ga0496113_0345304
606 Ga0496113_0378742
607 Ga0496113_0480341
608 Ga0496114_0000117
609 Ga0496114_0007855
610 Ga0496114_0197393
611 Ga0496115_0071381
612 Ga0496115_0103512
613 Ga0496115_0452824
614 Ga0496115_0993653
615 Ga0496116_0013206
616 Ga0496116_0029270
617 Ga0496117_0000319
618 Ga0496117_0100444
619 Ga0496117_0115252
620 Ga0496118_0006615
621 Ga0496118_0033365
622 Ga0496118_0218389
623 Ga0496119_0000022
624 Ga0496119_0001215
625 Ga0496119_0003952
626 Ga0496119_0245871
627 Ga0496120_0001626
628 Ga0496120_0041395
629 Ga0496120_0067812
630 Ga0496120_0074906
631 Ga0496121_0000014
632 Ga0496121_0007316
633 Ga0496122_0000097
634 Ga0496122_0006893
635 Ga0496123_0005804
636 Ga0496123_0017461
637 Ga0496124_0000019
638 Ga0496124_0108330
639 Ga0496124_0333917
640 Ga0496125_0000014
641 Ga0496125_0160687
642 Ga0496126_0000017
643 Ga0496126_0008145
644 Ga0496126_0147692
645 Ga0501032_0005401
646 Ga0501047_0555059
647 Ga0501083_0715055
648 nmdc:mga03683_42839_c1
649 nmdc:mga03683_9709_c1
650 nmdc:mga03n38_2031_c1
651 nmdc:mga03n38_21853_c1
652 nmdc:mga03n38_389655_c1
653 nmdc:mga03n38_486231_c1
654 nmdc:mga03n38_606420_c1
655 nmdc:mga03n38_847415_c1
656 nmdc:mga03n38_96876_c1
657 nmdc:mga00v17_1197_c1
658 nmdc:mga00v17_20145_c1
659 nmdc:mga00v17_245988_c1
660 nmdc:mga00v17_284063_c1
661 nmdc:mga00v17_579531_c1
662 nmdc:mga00v17_64609_c1
663 nmdc:mga0yw44_1070244_c1
664 nmdc:mga0yw44_1166824_c1
665 nmdc:mga0yw44_120299_c1
666 nmdc:mga0yw44_314967_c1
667 nmdc:mga0yw44_781424_c1
668 nmdc:mga0k408_138423_c1
669 nmdc:mga06z11_4468_c1
670 nmdc:mga04h51_44885_c1
671 nmdc:mga07m45_121925_c1
672 nmdc:mga07m45_326852_c1
673 nmdc:mga07m45_4141_c1
674 nmdc:mga08y16_936023_c1
675 nmdc:mga0sz30_4361_c1
676 Ga0500610_0012294
677 Ga0495655_0295308
678 Ga0500641_0269412
679 Ga0500641_0299753
680 Ga0500556_0182725
681 Ga0500572_160527
682 Ga0500642_0125730
683 Ga0500658_0145932
684 Ga0500568_0224707
685 Ga0500616_0107930
686 Ga0500619_254829
687 Ga0500620_088806
688 Ga0500645_000006
689 Ga0500645_021438
690 2644485429
691 2644634640
692 2738704292
693 2739331225
694 2902798170
695 2902811270
696 2939585441

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00699

Urease_beta

Urease beta subunit

22

119

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4goa-assembly1.cif.gz_A crystal structure of jack bean urease inhibited with fluoride 0.9587 15 87
4g7e-assembly1.cif.gz_B-3 crystal structure of pigeon pea urease 0.9537 15 87
7kns-assembly1.cif.gz_F cryo-em structure of jack bean urease 0.9121 19 87
3qga-assembly1.cif.gz_A 3.0 a model of iron containing urease urea2b2 from helicobacter mustelae 0.8832 4 93
4g7e-assembly1.cif.gz_A crystal structure of pigeon pea urease 0.8783 2 87
ID Description Score Start End Superfamily
3la4A03 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.8858 20 87 2.10.150.10
3qgaA02 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.8832 4 93 2.10.150.10
1a5kB00 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.8514 1 92 2.10.150.10
1s3tB00 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.8478 1 94 2.10.150.10
4z42K00 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.8241 3 95 2.10.150.10
ID Description Score Start End GO Terms
AF-A0A3C0N2Z2-F1-model_v4 Urease subunit beta 0.9865 28 77 GO:0009039
GO:0035550
GO:0043419
AF-A0A811SJ99-F1-model_v4 Urease alpha-subunit N-terminal domain-containing protein 0.9831 21 86 GO:0016810
GO:0035550
GO:0043419
GO:0046872
AF-A0A066VEX0-F1-model_v4 deleted 0.981 15 86
AF-A0A0C4F1Y7-F1-model_v4 urease (EC 3.5.1.5) 0.981 13 86 GO:0009039
GO:0016151
GO:0035550
GO:0043419
AF-A0A561PFN0-F1-model_v4 deleted 0.9793 16 86

Map