F417422

General Info

Members Datasets Scaffolds Average Seq Length
348 183 348 335

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100000001|Ga0070667_100000001727
Length 399
Sequence MTDEDHNQNQPQPVQDDQADQGDAFQVIDPQLLSDDTAPVAEQPEPAASTAQVEAQLQETQAAEEPVDMAFDVLSIGDIVTDAFIKLDEDQAVTYENEEGKWLAMKFGTKLPFDSAEVVQAVGNASNAAVAFARLGLKSEFSTNVGGDQEGRDMIAALQKEHVDSRLVHINPGKKSNYHYVLRYREERTILIKHEEYDYHWPQIRPIEMPRWVYFSSISEHAIPFHDQVADWLDANPGVKLAFQPGTFQMEAGAARLERIYKRSEVLILNREEAVTVGGGNHEDVHDLINKLHDLGPKIVVVTDGPSGAYASDGENRFKMPLYPDPAPPVDRTGAGDAFASTFVAALIKGNALEGALQWAPINSMSVVQKLGAQAGLLTETELERFLEQAPDWYKPERF

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
65 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
112 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
159 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
160 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
161 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
162 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
165 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
166 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
167 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
168 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
169 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
170 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
171 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
172 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
173 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
174 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
175 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
176 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
179 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
180 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
181 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
182 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
183 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.28
Nodule 0
Rhizoplane 0.29
Rhizosphere 74.43
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000781 3300001915 Bacteria 9552
2 JGI24740J21852_10006815 3300001979 Bacteria 4691
3 JGI24737J22298_10000095 3300001990 Bacteria 26030
4 JGI24735J21928_10000419 3300002067 Bacteria 14834
5 rootH2_10000244 3300003320 Bacteria 697651
6 rootH2_10260003 3300003320 Bacteria 2344
7 rootH2_10268326 3300003320 Bacteria 2943
8 rootL2_10058149 3300003322 Bacteria 3658
9 rootL2_10267385 3300003322 Bacteria 2180
10 rootH1_10015736 3300003323 Bacteria 4219
11 rootH1_10323815 3300003323 Bacteria 2654
12 Ga0070658_10000015 3300005327 Bacteria 230579
13 Ga0070658_10000698 3300005327 Bacteria 29119
14 Ga0070658_10005014 3300005327 Bacteria 10784
15 Ga0070658_10026830 3300005327 Bacteria 4624
16 Ga0070658_10030766 3300005327 Unclassified 4312
17 Ga0070676_10002243 3300005328 Bacteria 9866
18 Ga0070676_10004047 3300005328 Bacteria 7701
19 Ga0070683_100000140 3300005329 Bacteria 46747
20 Ga0070683_100000657 3300005329 Bacteria 25014
21 Ga0070683_100160180 3300005329 Bacteria 2135
22 Ga0070690_100000285 3300005330 Bacteria 25922
23 Ga0070670_100037967 3300005331 Bacteria 4142
24 Ga0070666_10121636 3300005335 Bacteria 1810
25 Ga0070680_100012829 3300005336 Bacteria 6518
26 Ga0070680_100032589 3300005336 Bacteria 4195
27 Ga0070680_100269573 3300005336 Bacteria 1441
28 Ga0070680_100346738 3300005336 Bacteria 1262
29 Ga0070682_100035372 3300005337 Bacteria 3049
30 Ga0070682_100044250 3300005337 Bacteria 2756
31 Ga0070682_100307691 3300005337 Bacteria 1165
32 Ga0070660_100000224 3300005339 Bacteria 37460
33 Ga0070660_100000454 3300005339 Bacteria 27343
34 Ga0070660_100011712 3300005339 Bacteria 6245
35 Ga0070660_100047507 3300005339 Unclassified 3295
36 Ga0070691_10005326 3300005341 Bacteria 5849
37 Ga0070671_100000001 3300005355 Bacteria 1228151
38 Ga0070671_100155225 3300005355 Bacteria 1934
39 Ga0070673_100000478 3300005364 Bacteria 21291
40 Ga0070659_100001084 3300005366 Bacteria 19882
41 Ga0070667_100000001 3300005367 Bacteria 1108638
42 Ga0070667_100002835 3300005367 Bacteria 14959
43 Ga0070667_100540341 3300005367 Unclassified 1070
44 Ga0070713_100143809 3300005436 Unclassified 2115
45 Ga0070700_100044330 3300005441 Bacteria 2739
46 Ga0070678_100000939 3300005456 Bacteria 14973
47 Ga0070681_10015966 3300005458 Bacteria 7488
48 Ga0070681_10046564 3300005458 Bacteria 4336
49 Ga0070681_10136230 3300005458 Unclassified 2386
50 Ga0070685_10032393 3300005466 Unclassified 2927
51 Ga0070679_100000652 3300005530 Bacteria 29531
52 Ga0070679_100000730 3300005530 Bacteria 28399
53 Ga0070679_100018926 3300005530 Bacteria 6687
54 Ga0070679_100030883 3300005530 Bacteria 5293
55 Ga0070684_100001211 3300005535 Bacteria 18536
56 Ga0070684_100004041 3300005535 Bacteria 11104
57 Ga0070684_100018888 3300005535 Bacteria 5691
58 Ga0068853_100036277 3300005539 Bacteria 4191
59 Ga0068853_100185670 3300005539 Bacteria 1887
60 Ga0070696_100272953 3300005546 Bacteria 1286
61 Ga0070665_100044596 3300005548 Bacteria 4453
62 Ga0070665_100128450 3300005548 Bacteria 2537
63 Ga0068855_100000003 3300005563 Bacteria 589862
64 Ga0068855_100000211 3300005563 Bacteria 74558
65 Ga0068855_100021272 3300005563 Bacteria 7778
66 Ga0068855_100095667 3300005563 Bacteria 3423
67 Ga0068855_100240574 3300005563 Bacteria 2023
68 Ga0068855_100296558 3300005563 Bacteria 1791
69 Ga0068857_100000002 3300005577 Bacteria 241401
70 Ga0068857_100011110 3300005577 Bacteria 7832
71 Ga0068857_100226600 3300005577 Bacteria 1708
72 Ga0068856_100000866 3300005614 Bacteria 32413
73 Ga0068856_100029087 3300005614 Bacteria 5398
74 Ga0068856_100120512 3300005614 Bacteria 2624
75 Ga0068852_100161572 3300005616 Bacteria 2092
76 Ga0068859_100236849 3300005617 Bacteria 1914
77 Ga0068870_10137002 3300005840 Bacteria 1428
78 Ga0068863_100019043 3300005841 Bacteria 6571
79 Ga0068863_100217567 3300005841 Bacteria 1840
80 Ga0068860_100025027 3300005843 Bacteria 5762
81 Ga0068860_100329864 3300005843 Bacteria 1499
82 Ga0081455_10000003 3300005937 Bacteria 367763
83 Ga0075365_10002844 3300006038 Bacteria 8686
84 Ga0075368_10006658 3300006042 Bacteria 4051
85 Ga0075363_100000016 3300006048 Bacteria 38279
86 Ga0075364_10001546 3300006051 Bacteria 12566
87 Ga0075364_10001845 3300006051 Bacteria 11739
88 Ga0075364_10051634 3300006051 Bacteria 2686
89 Ga0075364_10083277 3300006051 Bacteria 2117
90 Ga0075364_10092868 3300006051 Bacteria 2003
91 Ga0075362_10058308 3300006177 Unclassified 1741
92 Ga0075367_10000034 3300006178 Bacteria 29945
93 Ga0075367_10003897 3300006178 Bacteria 7196
94 Ga0075369_10000005 3300006186 Bacteria 147699
95 Ga0075369_10000051 3300006186 Bacteria 29832
96 Ga0075366_10000001 3300006195 Bacteria 569172
97 Ga0075366_10000044 3300006195 Bacteria 45021
98 Ga0075366_10000083 3300006195 Bacteria 37001
99 Ga0075366_10000342 3300006195 Bacteria 21427
100 Ga0075366_10000684 3300006195 Bacteria 16042
101 Ga0097621_100003413 3300006237 Bacteria 10943
102 Ga0068871_100000156 3300006358 Bacteria 45103
103 Ga0068871_100309501 3300006358 Bacteria 1388
104 Ga0075428_100129315 3300006844 Bacteria 2748
105 Ga0068865_100190024 3300006881 Bacteria 1587
106 Ga0097620_100236845 3300006931 Bacteria 1914
107 Ga0105240_10000003 3300009093 Bacteria 1183681
108 Ga0105240_10045975 3300009093 Bacteria 5535
109 Ga0105240_10095244 3300009093 Bacteria 3630
110 Ga0111539_10013550 3300009094 Bacteria 10192
111 Ga0105245_10000001 3300009098 Bacteria 939270
112 Ga0105245_10000002 3300009098 Bacteria 634374
113 Ga0105245_10000122 3300009098 Bacteria 75415
114 Ga0105245_10118836 3300009098 Unclassified 2467
115 Ga0105243_10000001 3300009148 Bacteria 1156578
116 Ga0105241_10000003 3300009174 Bacteria 839043
117 Ga0105241_10036952 3300009174 Bacteria 3677
118 Ga0105241_10254243 3300009174 Bacteria 1491
119 Ga0105242_10000064 3300009176 Bacteria 74150
120 Ga0105242_10001814 3300009176 Bacteria 16772
121 Ga0105248_10167944 3300009177 Bacteria 2473
122 Ga0105237_10009676 3300009545 Bacteria 10316
123 Ga0105238_10055056 3300009551 Unclassified 3994
124 Ga0105238_10132129 3300009551 Bacteria 2474
125 Ga0105238_10183691 3300009551 Unclassified 2068
126 Ga0105249_10003576 3300009553 Bacteria 13450
127 Ga0105030_101344 3300009987 Unclassified 2185
128 Ga0105028_100403 3300009993 Unclassified 4649
129 Ga0105239_10027653 3300010375 Bacteria 6240
130 Ga0105239_10097083 3300010375 Bacteria 3256
131 Ga0157373_10000042 3300013100 Bacteria 113564
132 Ga0157371_10000937 3300013102 Bacteria 32624
133 Ga0157369_10000261 3300013105 Bacteria 71207
134 Ga0157369_10033680 3300013105 Bacteria 5628
135 Ga0157369_10092270 3300013105 Bacteria 3232
136 Ga0157369_10094462 3300013105 Unclassified 3192
137 Ga0157374_10000031 3300013296 Bacteria 204840
138 Ga0157374_10000934 3300013296 Bacteria 25443
139 Ga0157374_10001692 3300013296 Bacteria 18472
140 Ga0157374_10003500 3300013296 Bacteria 13203
141 Ga0157378_10003107 3300013297 Bacteria 14760
142 Ga0157378_10274246 3300013297 Unclassified 1623
143 Ga0157378_10426334 3300013297 Bacteria 1312
144 Ga0157372_10000194 3300013307 Bacteria 66925
145 Ga0157372_10138568 3300013307 Bacteria 2803
146 Ga0157372_10166011 3300013307 Bacteria 2553
147 Ga0157514_104464 3300013874 Unclassified 1212
148 Ga0163163_10003002 3300014325 Bacteria 14278
149 Ga0157377_10038737 3300014745 Bacteria 2633
150 Ga0157379_10060386 3300014968 Bacteria 3389
151 Ga0157376_10000001 3300014969 Bacteria 842910
152 Ga0207647_10000458 3300025904 Bacteria 33136
153 Ga0207645_10007453 3300025907 Bacteria 7727
154 Ga0207645_10010552 3300025907 Bacteria 6343
155 Ga0207705_10000011 3300025909 Bacteria 517768
156 Ga0207705_10000056 3300025909 Bacteria 157554
157 Ga0207705_10003555 3300025909 Bacteria 11865
158 Ga0207705_10017240 3300025909 Bacteria 5173
159 Ga0207705_10024521 3300025909 Unclassified 4304
160 Ga0207654_10000002 3300025911 Bacteria 1460142
161 Ga0207654_10009169 3300025911 Bacteria 5016
162 Ga0207707_10009504 3300025912 Bacteria 8436
163 Ga0207707_10155513 3300025912 Unclassified 2000
164 Ga0207695_10000005 3300025913 Bacteria 1196715
165 Ga0207695_10046653 3300025913 Bacteria 4591
166 Ga0207695_10084073 3300025913 Bacteria 3214
167 Ga0207671_10004219 3300025914 Bacteria 13846
168 Ga0207660_10001756 3300025917 Bacteria 14531
169 Ga0207660_10011757 3300025917 Bacteria 5708
170 Ga0207660_10013472 3300025917 Bacteria 5359
171 Ga0207657_10001246 3300025919 Bacteria 27202
172 Ga0207657_10004983 3300025919 Bacteria 13968
173 Ga0207657_10032453 3300025919 Bacteria 4717
174 Ga0207649_10049775 3300025920 Bacteria 2589
175 Ga0207652_10004857 3300025921 Bacteria 10886
176 Ga0207652_10005031 3300025921 Bacteria 10713
177 Ga0207652_10017113 3300025921 Bacteria 5930
178 Ga0207652_10019769 3300025921 Bacteria 5543
179 Ga0207652_10073011 3300025921 Bacteria 2984
180 Ga0207652_10139388 3300025921 Bacteria 2168
181 Ga0207650_10026438 3300025925 Bacteria 4140
182 Ga0207687_10000001 3300025927 Bacteria 1130810
183 Ga0207687_10000030 3300025927 Bacteria 155548
184 Ga0207687_10000111 3300025927 Bacteria 58083
185 Ga0207687_10256184 3300025927 Unclassified 1393
186 Ga0207664_10000269 3300025929 Bacteria 39220
187 Ga0207644_10000001 3300025931 Bacteria 1243214
188 Ga0207644_10021876 3300025931 Bacteria 4361
189 Ga0207644_10128892 3300025931 Bacteria 1934
190 Ga0207690_10012264 3300025932 Bacteria 5128
191 Ga0207686_10000001 3300025934 Bacteria 1169580
192 Ga0207709_10000002 3300025935 Bacteria 1171536
193 Ga0207704_10152170 3300025938 Bacteria 1634
194 Ga0207661_10000021 3300025944 Bacteria 205381
195 Ga0207661_10084045 3300025944 Bacteria 2635
196 Ga0207661_10133436 3300025944 Bacteria 2130
197 Ga0207667_10000008 3300025949 Bacteria 625138
198 Ga0207667_10000466 3300025949 Bacteria 54272
199 Ga0207667_10006467 3300025949 Bacteria 14176
200 Ga0207667_10072503 3300025949 Unclassified 3580
201 Ga0207667_10153924 3300025949 Bacteria 2366
202 Ga0207712_10002267 3300025961 Bacteria 12484
203 Ga0207658_10000003 3300025986 Bacteria 1151934
204 Ga0207658_10045335 3300025986 Unclassified 3205
205 Ga0207639_10009168 3300026041 Bacteria 6821
206 Ga0207708_10310160 3300026075 Bacteria 1285
207 Ga0207702_10001222 3300026078 Bacteria 25994
208 Ga0207702_10014665 3300026078 Bacteria 6503
209 Ga0207641_10014187 3300026088 Bacteria 6530
210 Ga0207674_10000001 3300026116 Bacteria 616581
211 Ga0207674_10011447 3300026116 Bacteria 9968
212 Ga0207683_10002890 3300026121 Bacteria 14973
213 Ga0209813_10000004 3300027866 Bacteria 139340
214 Ga0207428_10015820 3300027907 Bacteria 6511
215 Ga0268266_10001150 3300028379 Bacteria 32834
216 Ga0268266_10042895 3300028379 Bacteria 3865
217 Ga0268264_10177865 3300028381 Bacteria 1930
218 Ga0265337_1002283 3300028556 Bacteria 8915
219 Ga0265337_1023923 3300028556 Bacteria 1874
220 Ga0265326_10001725 3300028558 Bacteria 7565
221 Ga0265334_10000032 3300028573 Bacteria 107258
222 Ga0265334_10000049 3300028573 Bacteria 89091
223 Ga0265338_10000003 3300028800 Bacteria 733923
224 Ga0265338_10000052 3300028800 Bacteria 209239
225 Ga0265338_10000054 3300028800 Bacteria 207383
226 Ga0265338_10000192 3300028800 Bacteria 115195
227 Ga0265338_10000601 3300028800 Bacteria 63282
228 Ga0265338_10014462 3300028800 Bacteria 8784
229 Ga0265338_10057177 3300028800 Unclassified 3452
230 Ga0265320_10042158 3300031240 Bacteria 2266
231 Ga0265340_10000077 3300031247 Bacteria 47065
232 Ga0265327_10000017 3300031251 Bacteria 445264
233 Ga0265327_10000961 3300031251 Bacteria 41308
234 Ga0265327_10006126 3300031251 Bacteria 9731
235 Ga0265316_10066920 3300031344 Bacteria 2779
236 Ga0265313_10005537 3300031595 Bacteria 9258
237 Ga0395899_0001600 3300037312 Bacteria 18991
238 Ga0395899_0004607 3300037312 Bacteria 10743
239 Ga0395900_0000232 3300037418 Bacteria 87268
240 Ga0395900_0005799 3300037418 Bacteria 12900
241 Ga0395900_0012514 3300037418 Bacteria 8678
242 Ga0395900_0027630 3300037418 Bacteria 5812
243 Ga0395898_0011520 3300037466 Bacteria 9182
244 Ga0395898_0065651 3300037466 Unclassified 3518
245 Ga0395898_0460148 3300037466 Bacteria 1211
246 Ga0395905_0002005 3300037471 Bacteria 23268
247 Ga0395905_0027294 3300037471 Bacteria 5384
248 Ga0395905_0073068 3300037471 Unclassified 3215
249 Ga0395901_0000680 3300038443 Bacteria 39129
250 Ga0395901_0001919 3300038443 Bacteria 21405
251 Ga0395901_0010023 3300038443 Bacteria 9606
252 Ga0395901_0043909 3300038443 Bacteria 4636
253 Ga0395901_0075550 3300038443 Unclassified 3514
254 Ga0495622_0000082 3300046557 Bacteria 85266
255 Ga0495611_0154293 3300046648 Bacteria 1072
256 Ga0495588_0000116 3300046674 Bacteria 135919
257 Ga0495658_0010755 3300046683 Bacteria 4583
258 Ga0495649_0000284 3300046694 Bacteria 44736
259 Ga0496105_0091989 3300048908 Unclassified 2505
260 Ga0501031_0000163 3300049568 Bacteria 38332
261 Ga0501032_0002271 3300049569 Bacteria 15106
262 Ga0501033_0058695 3300049570 Bacteria 2842
263 Ga0501034_0010282 3300049571 Bacteria 9757
264 Ga0501034_0150807 3300049571 Bacteria 2300
265 Ga0501034_0176985 3300049571 Unclassified 2099
266 Ga0501036_0004824 3300049572 Bacteria 10897
267 Ga0501037_0000121 3300049573 Bacteria 72862
268 Ga0501037_0220248 3300049573 Bacteria 1336
269 Ga0501038_0005584 3300049574 Bacteria 11670
270 Ga0501039_0178375 3300049575 Unclassified 1671
271 Ga0501043_0002322 3300049579 Bacteria 16107
272 Ga0501046_0000138 3300049580 Bacteria 77052
273 Ga0501047_0000397 3300049581 Bacteria 48886
274 Ga0501047_0000681 3300049581 Bacteria 35407
275 Ga0501048_0000361 3300049582 Bacteria 31413
276 Ga0501070_0012332 3300049586 Bacteria 7211
277 Ga0501070_0017794 3300049586 Bacteria 5968
278 Ga0501070_0094586 3300049586 Bacteria 2473
279 Ga0501073_0022103 3300049589 Bacteria 4584
280 Ga0501073_0141616 3300049589 Bacteria 1666
281 Ga0501080_0000133 3300049742 Bacteria 52488
282 Ga0501083_0049427 3300049744 Bacteria 2834
283 Ga0501035_0000033 3300049822 Bacteria 175087
284 Ga0501035_0000765 3300049822 Bacteria 34530
285 Ga0501044_0008015 3300049823 Bacteria 11607
286 nmdc:mga03683_20_c3 3300050489 Bacteria 29488
287 nmdc:mga03683_48281_c1 3300050489 Unclassified 1769
288 nmdc:mga00v17_2773_c2 3300050491 Bacteria 6471
289 nmdc:mga00v17_3576_c1 3300050491 Bacteria 8031
290 nmdc:mga00v17_45248_c1 3300050491 Bacteria 2129
291 nmdc:mga00v17_894_c1 3300050491 Bacteria 16126
292 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
293 nmdc:mga0yw44_397_c1 3300050492 Bacteria 10503
294 nmdc:mga0yw44_8649_c1 3300050492 Bacteria 5087
295 nmdc:mga0k408_114_c1 3300050493 Bacteria 39328
296 nmdc:mga0k408_16612_c1 3300050493 Unclassified 4087
297 nmdc:mga0k408_17_c2 3300050493 Bacteria 97852
298 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
299 nmdc:mga0k408_337_c1 3300050493 Bacteria 25651
300 nmdc:mga0k408_6799_c1 3300050493 Bacteria 6098
301 nmdc:mga06z11_44_c2 3300050494 Bacteria 4230
302 nmdc:mga06z11_6_c1 3300050494 Bacteria 124054
303 nmdc:mga04h51_4_c1 3300050495 Bacteria 139342
304 nmdc:mga07m45_120596_c1 3300050496 Bacteria 1514
305 nmdc:mga07m45_3390_c1 3300050496 Bacteria 6453
306 nmdc:mga07m45_48730_c1 3300050496 Bacteria 2383
307 nmdc:mga08y16_23051_c1 3300050511 Bacteria 6573
308 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
309 nmdc:mga0sz30_23_c1 3300050516 Bacteria 65683
310 nmdc:mga0sz30_59125_c1 3300050516 Bacteria 1635
311 Ga0500610_0000001 3300053079 Bacteria 185468
312 Ga0500610_0019051 3300053079 Bacteria 3330
313 Ga0500643_000022 3300053087 Bacteria 277519
314 Ga0500643_000038 3300053087 Bacteria 178974
315 Ga0500643_000043 3300053087 Bacteria 157905
316 Ga0500643_002590 3300053087 Bacteria 9182
317 Ga0500644_0000006 3300053088 Bacteria 143304
318 Ga0500644_0000555 3300053088 Bacteria 14996
319 Ga0500646_0000290 3300053090 Bacteria 15407
320 Ga0500583_0000137 3300053092 Bacteria 31497
321 Ga0500583_0001527 3300053092 Bacteria 6675
322 Ga0500651_0000045 3300053093 Bacteria 85481
323 Ga0500651_0001186 3300053093 Bacteria 12921
324 Ga0500566_0000001 3300053094 Bacteria 1101031
325 Ga0500650_0000001 3300053098 Bacteria 818797
326 Ga0500555_000001 3300053103 Bacteria 1353713
327 Ga0500555_000002 3300053103 Bacteria 1314346
328 Ga0500556_0001227 3300053104 Bacteria 11950
329 Ga0500562_000002 3300053108 Bacteria 977234
330 Ga0500562_013650 3300053108 Bacteria 2077
331 Ga0500594_0000001 3300053118 Bacteria 1178472
332 Ga0500594_0000349 3300053118 Bacteria 10345
333 Ga0500614_000001 3300053123 Bacteria 1274484
334 Ga0500614_000180 3300053123 Bacteria 16268
335 Ga0500621_009476 3300053126 Bacteria 3318
336 Ga0500628_000012 3300053129 Bacteria 106556
337 Ga0500628_028745 3300053129 Bacteria 1189
338 Ga0500642_0005438 3300053130 Bacteria 4110
339 Ga0500652_000020 3300053131 Bacteria 119198
340 Ga0500655_000870 3300053133 Bacteria 5860
341 Ga0500561_0000001 3300053137 Bacteria 957685
342 Ga0500568_0012964 3300053139 Bacteria 3815
343 Ga0500577_0003193 3300053142 Bacteria 4241
344 Ga0500579_005181 3300053143 Bacteria 7989
345 Ga0500589_000016 3300053147 Bacteria 107090
346 Ga0500633_0013097 3300053160 Bacteria 2313
347 Ga0500649_000013 3300053722 Bacteria 73694
348 Ga0500570_000005 3300053724 Bacteria 132994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0058695 Ga0501033_0058695_1347_2309 320
2 3300049571 Ga0501034_0010282 Ga0501034_0010282_2183_3145 320
3 3300049581 Ga0501047_0000397 Ga0501047_0000397_40132_41094 320
4 3300049822 Ga0501035_0000033 Ga0501035_0000033_89246_90208 320
5 3300005617 Ga0068859_100236849 Ga0068859_1002368493 321
6 3300006931 Ga0097620_100236845 Ga0097620_1002368453 321
7 3300005355 Ga0070671_100155225 Ga0070671_1001552253 322
8 3300005841 Ga0068863_100217567 Ga0068863_1002175673 322
9 3300025931 Ga0207644_10128892 Ga0207644_101288923 322
10 3300048908 Ga0496105_0091989 Ga0496105_0091989_1257_2258 322
11 3300053103 Ga0500555_000001 Ga0500555_000001_685901_686899 322
12 3300053079 Ga0500610_0019051 Ga0500610_0019051_1782_2780 324
13 3300053092 Ga0500583_0000137 Ga0500583_0000137_12387_13385 324
14 3300053126 Ga0500621_009476 Ga0500621_009476_1948_2946 324
15 3300053130 Ga0500642_0005438 Ga0500642_0005438_1291_2289 324
16 3300053147 Ga0500589_000016 Ga0500589_000016_30424_31422 324
17 3300005616 Ga0068852_100161572 Ga0068852_1001615722 325
18 3300005563 Ga0068855_100000211 Ga0068855_10000021128 326
19 3300006042 Ga0075368_10006658 Ga0075368_100066584 326
20 3300006048 Ga0075363_100000016 Ga0075363_10000001634 326
21 3300006178 Ga0075367_10003897 Ga0075367_100038973 326
22 3300009551 Ga0105238_10183691 Ga0105238_101836913 326
23 3300025909 Ga0207705_10017240 Ga0207705_100172403 326
24 3300025919 Ga0207657_10001246 Ga0207657_1000124612 326
25 3300025932 Ga0207690_10012264 Ga0207690_100122643 326
26 3300025949 Ga0207667_10000466 Ga0207667_1000046647 326
27 3300026116 Ga0207674_10000001 Ga0207674_10000001479 326
28 3300027866 Ga0209813_10000004 Ga0209813_1000000497 326
29 3300003320 rootH2_10000244 rootH2_10000244428 327
30 3300005329 Ga0070683_100160180 Ga0070683_1001601802 331
31 3300009098 Ga0105245_10000001 Ga0105245_10000001404 331
32 3300009553 Ga0105249_10003576 Ga0105249_100035769 331
33 3300013105 Ga0157369_10033680 Ga0157369_100336804 331
34 3300025927 Ga0207687_10000030 Ga0207687_1000003035 331
35 3300025944 Ga0207661_10133436 Ga0207661_101334362 331
36 3300025961 Ga0207712_10002267 Ga0207712_100022676 331
37 3300053724 Ga0500570_000005 Ga0500570_000005_87632_88630 331
38 3300003320 rootH2_10260003 rootH2_102600032 332
39 3300003320 rootH2_10268326 rootH2_102683263 332
40 3300003322 rootL2_10058149 rootL2_100581494 332
41 3300003322 rootL2_10267385 rootL2_102673853 332
42 3300003323 rootH1_10015736 rootH1_100157363 332
43 3300005327 Ga0070658_10000015 Ga0070658_1000001593 332
44 3300005327 Ga0070658_10000698 Ga0070658_100006983 332
45 3300005327 Ga0070658_10005014 Ga0070658_100050148 332
46 3300005327 Ga0070658_10026830 Ga0070658_100268302 332
47 3300005329 Ga0070683_100000657 Ga0070683_10000065723 332
48 3300005331 Ga0070670_100037967 Ga0070670_1000379674 332
49 3300005335 Ga0070666_10121636 Ga0070666_101216362 332
50 3300005336 Ga0070680_100012829 Ga0070680_1000128293 332
51 3300005336 Ga0070680_100032589 Ga0070680_1000325895 332
52 3300005336 Ga0070680_100269573 Ga0070680_1002695732 332
53 3300005336 Ga0070680_100346738 Ga0070680_1003467381 332
54 3300005337 Ga0070682_100035372 Ga0070682_1000353722 332
55 3300005337 Ga0070682_100044250 Ga0070682_1000442502 332
56 3300005339 Ga0070660_100000224 Ga0070660_10000022440 332
57 3300005339 Ga0070660_100000454 Ga0070660_10000045411 332
58 3300005339 Ga0070660_100011712 Ga0070660_1000117125 332
59 3300005341 Ga0070691_10005326 Ga0070691_100053263 332
60 3300005355 Ga0070671_100000001 Ga0070671_100000001536 332
61 3300005366 Ga0070659_100001084 Ga0070659_1000010843 332
62 3300005367 Ga0070667_100000001 Ga0070667_100000001727 332
63 3300005367 Ga0070667_100540341 Ga0070667_1005403411 332
64 3300005436 Ga0070713_100143809 Ga0070713_1001438092 332
65 3300005441 Ga0070700_100044330 Ga0070700_1000443303 332
66 3300005458 Ga0070681_10046564 Ga0070681_100465642 332
67 3300005458 Ga0070681_10136230 Ga0070681_101362302 332
68 3300005530 Ga0070679_100000652 Ga0070679_10000065211 332
69 3300005530 Ga0070679_100000730 Ga0070679_10000073021 332
70 3300005530 Ga0070679_100018926 Ga0070679_1000189262 332
71 3300005535 Ga0070684_100004041 Ga0070684_1000040414 332
72 3300005539 Ga0068853_100036277 Ga0068853_1000362773 332
73 3300005546 Ga0070696_100272953 Ga0070696_1002729532 332
74 3300005563 Ga0068855_100021272 Ga0068855_1000212727 332
75 3300005563 Ga0068855_100095667 Ga0068855_1000956673 332
76 3300005563 Ga0068855_100240574 Ga0068855_1002405741 332
77 3300005563 Ga0068855_100296558 Ga0068855_1002965581 332
78 3300005577 Ga0068857_100000002 Ga0068857_10000000256 332
79 3300005577 Ga0068857_100226600 Ga0068857_1002266002 332
80 3300005614 Ga0068856_100000866 Ga0068856_10000086620 332
81 3300005614 Ga0068856_100120512 Ga0068856_1001205122 332
82 3300005840 Ga0068870_10137002 Ga0068870_101370022 332
83 3300005841 Ga0068863_100019043 Ga0068863_1000190435 332
84 3300005843 Ga0068860_100025027 Ga0068860_1000250276 332
85 3300005937 Ga0081455_10000003 Ga0081455_10000003356 332
86 3300006051 Ga0075364_10001546 Ga0075364_1000154611 332
87 3300006051 Ga0075364_10001845 Ga0075364_100018456 332
88 3300006051 Ga0075364_10083277 Ga0075364_100832773 332
89 3300006177 Ga0075362_10058308 Ga0075362_100583082 332
90 3300006178 Ga0075367_10000034 Ga0075367_1000003425 332
91 3300006186 Ga0075369_10000005 Ga0075369_1000000543 332
92 3300006186 Ga0075369_10000051 Ga0075369_1000005124 332
93 3300006195 Ga0075366_10000001 Ga0075366_10000001459 332
94 3300006195 Ga0075366_10000083 Ga0075366_100000836 332
95 3300006195 Ga0075366_10000342 Ga0075366_1000034221 332
96 3300006844 Ga0075428_100129315 Ga0075428_1001293153 332
97 3300009093 Ga0105240_10045975 Ga0105240_100459753 332
98 3300009094 Ga0111539_10013550 Ga0111539_100135509 332
99 3300009098 Ga0105245_10118836 Ga0105245_101188362 332
100 3300009174 Ga0105241_10254243 Ga0105241_102542432 332
101 3300009176 Ga0105242_10001814 Ga0105242_1000181412 332
102 3300009551 Ga0105238_10132129 Ga0105238_101321293 332
103 3300010375 Ga0105239_10027653 Ga0105239_100276538 332
104 3300013100 Ga0157373_10000042 Ga0157373_1000004220 332
105 3300013102 Ga0157371_10000937 Ga0157371_1000093718 332
106 3300013105 Ga0157369_10092270 Ga0157369_100922703 332
107 3300013297 Ga0157378_10274246 Ga0157378_102742462 332
108 3300013297 Ga0157378_10426334 Ga0157378_104263342 332
109 3300013307 Ga0157372_10166011 Ga0157372_101660112 332
110 3300014325 Ga0163163_10003002 Ga0163163_100030022 332
111 3300014968 Ga0157379_10060386 Ga0157379_100603863 332
112 3300025909 Ga0207705_10000011 Ga0207705_10000011252 332
113 3300025909 Ga0207705_10003555 Ga0207705_100035557 332
114 3300025912 Ga0207707_10155513 Ga0207707_101555132 332
115 3300025913 Ga0207695_10046653 Ga0207695_100466534 332
116 3300025917 Ga0207660_10011757 Ga0207660_100117572 332
117 3300025917 Ga0207660_10013472 Ga0207660_100134723 332
118 3300025919 Ga0207657_10004983 Ga0207657_100049834 332
119 3300025921 Ga0207652_10005031 Ga0207652_100050318 332
120 3300025921 Ga0207652_10019769 Ga0207652_100197696 332
121 3300025925 Ga0207650_10026438 Ga0207650_100264382 332
122 3300025927 Ga0207687_10256184 Ga0207687_102561842 332
123 3300025929 Ga0207664_10000269 Ga0207664_1000026933 332
124 3300025931 Ga0207644_10000001 Ga0207644_10000001900 332
125 3300025931 Ga0207644_10021876 Ga0207644_100218764 332
126 3300025944 Ga0207661_10084045 Ga0207661_100840453 332
127 3300025949 Ga0207667_10153924 Ga0207667_101539242 332
128 3300025986 Ga0207658_10000003 Ga0207658_10000003653 332
129 3300025986 Ga0207658_10045335 Ga0207658_100453353 332
130 3300026075 Ga0207708_10310160 Ga0207708_103101602 332
131 3300026078 Ga0207702_10001222 Ga0207702_1000122213 332
132 3300026088 Ga0207641_10014187 Ga0207641_100141875 332
133 3300027907 Ga0207428_10015820 Ga0207428_100158205 332
134 3300028381 Ga0268264_10177865 Ga0268264_101778652 332
135 3300028556 Ga0265337_1002283 Ga0265337_10022835 332
136 3300028558 Ga0265326_10001725 Ga0265326_100017254 332
137 3300028573 Ga0265334_10000049 Ga0265334_1000004976 332
138 3300028800 Ga0265338_10000003 Ga0265338_10000003442 332
139 3300028800 Ga0265338_10000052 Ga0265338_10000052139 332
140 3300028800 Ga0265338_10000054 Ga0265338_10000054217 332
141 3300028800 Ga0265338_10014462 Ga0265338_1001446210 332
142 3300028800 Ga0265338_10057177 Ga0265338_100571772 332
143 3300031251 Ga0265327_10000017 Ga0265327_10000017115 332
144 3300031251 Ga0265327_10000961 Ga0265327_1000096126 332
145 3300031251 Ga0265327_10006126 Ga0265327_1000612610 332
146 3300031344 Ga0265316_10066920 Ga0265316_100669203 332
147 3300031595 Ga0265313_10005537 Ga0265313_100055374 332
148 3300037312 Ga0395899_0001600 Ga0395899_0001600_16518_17522 332
149 3300037312 Ga0395899_0004607 Ga0395899_0004607_5031_6032 332
150 3300037418 Ga0395900_0000232 Ga0395900_0000232_46077_47081 332
151 3300037418 Ga0395900_0005799 Ga0395900_0005799_2097_3098 332
152 3300037418 Ga0395900_0012514 Ga0395900_0012514_3785_4792 332
153 3300037418 Ga0395900_0027630 Ga0395900_0027630_4531_5532 332
154 3300037466 Ga0395898_0011520 Ga0395898_0011520_6568_7569 332
155 3300037466 Ga0395898_0065651 Ga0395898_0065651_492_1499 332
156 3300037466 Ga0395898_0460148 Ga0395898_0460148_184_1188 332
157 3300037471 Ga0395905_0027294 Ga0395905_0027294_3966_4967 332
158 3300037471 Ga0395905_0073068 Ga0395905_0073068_1128_2132 332
159 3300038443 Ga0395901_0000680 Ga0395901_0000680_22089_23093 332
160 3300038443 Ga0395901_0075550 Ga0395901_0075550_1329_2330 332
161 3300046557 Ga0495622_0000082 Ga0495622_0000082_41858_42856 332
162 3300046648 Ga0495611_0154293 Ga0495611_0154293_56_1054 332
163 3300046674 Ga0495588_0000116 Ga0495588_0000116_109677_110675 332
164 3300046683 Ga0495658_0010755 Ga0495658_0010755_704_1702 332
165 3300049568 Ga0501031_0000163 Ga0501031_0000163_11765_12769 332
166 3300049569 Ga0501032_0002271 Ga0501032_0002271_535_1539 332
167 3300049571 Ga0501034_0150807 Ga0501034_0150807_1128_2132 332
168 3300049571 Ga0501034_0176985 Ga0501034_0176985_868_1887 332
169 3300049572 Ga0501036_0004824 Ga0501036_0004824_6508_7512 332
170 3300049573 Ga0501037_0000121 Ga0501037_0000121_38376_39380 332
171 3300049573 Ga0501037_0220248 Ga0501037_0220248_132_1157 332
172 3300049574 Ga0501038_0005584 Ga0501038_0005584_4436_5440 332
173 3300049575 Ga0501039_0178375 Ga0501039_0178375_628_1632 332
174 3300049579 Ga0501043_0002322 Ga0501043_0002322_6539_7543 332
175 3300049580 Ga0501046_0000138 Ga0501046_0000138_59977_60981 332
176 3300049581 Ga0501047_0000681 Ga0501047_0000681_13190_14194 332
177 3300049582 Ga0501048_0000361 Ga0501048_0000361_16938_17942 332
178 3300049586 Ga0501070_0012332 Ga0501070_0012332_2170_3174 332
179 3300049586 Ga0501070_0017794 Ga0501070_0017794_635_1660 332
180 3300049586 Ga0501070_0094586 Ga0501070_0094586_28_1047 332
181 3300049589 Ga0501073_0022103 Ga0501073_0022103_1215_2219 332
182 3300049589 Ga0501073_0141616 Ga0501073_0141616_281_1288 332
183 3300049742 Ga0501080_0000133 Ga0501080_0000133_28364_29371 332
184 3300049744 Ga0501083_0049427 Ga0501083_0049427_286_1290 332
185 3300049822 Ga0501035_0000765 Ga0501035_0000765_1374_2378 332
186 3300049823 Ga0501044_0008015 Ga0501044_0008015_10043_11047 332
187 3300050489 nmdc:mga03683_20_c3 nmdc:mga03683_20_c3_8887_9885 332
188 3300050489 nmdc:mga03683_48281_c1 nmdc:mga03683_48281_c1_178_1176 332
189 3300050491 nmdc:mga00v17_2773_c2 nmdc:mga00v17_2773_c2_2002_3000 332
190 3300050491 nmdc:mga00v17_45248_c1 nmdc:mga00v17_45248_c1_831_1835 332
191 3300050491 nmdc:mga00v17_894_c1 nmdc:mga00v17_894_c1_6237_7235 332
192 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_211771_212769 332
193 3300050493 nmdc:mga0k408_17_c2 nmdc:mga0k408_17_c2_19288_20286 332
194 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_652616_653617 332
195 3300050493 nmdc:mga0k408_337_c1 nmdc:mga0k408_337_c1_14952_15950 332
196 3300050493 nmdc:mga0k408_6799_c1 nmdc:mga0k408_6799_c1_2756_3754 332
197 3300050494 nmdc:mga06z11_44_c2 nmdc:mga06z11_44_c2_409_1407 332
198 3300050494 nmdc:mga06z11_6_c1 nmdc:mga06z11_6_c1_21514_22527 332
199 3300050495 nmdc:mga04h51_4_c1 nmdc:mga04h51_4_c1_50756_51769 332
200 3300050496 nmdc:mga07m45_120596_c1 nmdc:mga07m45_120596_c1_10_1008 332
201 3300050496 nmdc:mga07m45_3390_c1 nmdc:mga07m45_3390_c1_2974_3987 332
202 3300050511 nmdc:mga08y16_23051_c1 nmdc:mga08y16_23051_c1_4024_5022 332
203 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_187897_188895 332
204 3300050516 nmdc:mga0sz30_23_c1 nmdc:mga0sz30_23_c1_39713_40714 332
205 3300053087 Ga0500643_000022 Ga0500643_000022_12263_13261 332
206 3300053087 Ga0500643_000038 Ga0500643_000038_58650_59648 332
207 3300053088 Ga0500644_0000555 Ga0500644_0000555_4570_5586 332
208 3300053092 Ga0500583_0001527 Ga0500583_0001527_4682_5680 332
209 3300053094 Ga0500566_0000001 Ga0500566_0000001_603627_604625 332
210 3300053104 Ga0500556_0001227 Ga0500556_0001227_3697_4701 332
211 3300053123 Ga0500614_000001 Ga0500614_000001_308281_309279 332
212 3300053722 Ga0500649_000013 Ga0500649_000013_56287_57285 332
213 3300001915 JGI24741J21665_1000781 JGI24741J21665_10007815 333
214 3300001979 JGI24740J21852_10006815 JGI24740J21852_100068154 333
215 3300001990 JGI24737J22298_10000095 JGI24737J22298_1000009519 333
216 3300002067 JGI24735J21928_10000419 JGI24735J21928_100004192 333
217 3300003323 rootH1_10323815 rootH1_103238153 333
218 3300005327 Ga0070658_10030766 Ga0070658_100307663 333
219 3300005328 Ga0070676_10002243 Ga0070676_1000224312 333
220 3300005328 Ga0070676_10004047 Ga0070676_100040474 333
221 3300005329 Ga0070683_100000140 Ga0070683_10000014010 333
222 3300005330 Ga0070690_100000285 Ga0070690_10000028512 333
223 3300005337 Ga0070682_100307691 Ga0070682_1003076911 333
224 3300005339 Ga0070660_100047507 Ga0070660_1000475073 333
225 3300005364 Ga0070673_100000478 Ga0070673_10000047815 333
226 3300005367 Ga0070667_100002835 Ga0070667_1000028355 333
227 3300005456 Ga0070678_100000939 Ga0070678_10000093913 333
228 3300005458 Ga0070681_10015966 Ga0070681_100159665 333
229 3300005466 Ga0070685_10032393 Ga0070685_100323934 333
230 3300005530 Ga0070679_100030883 Ga0070679_1000308832 333
231 3300005535 Ga0070684_100001211 Ga0070684_10000121116 333
232 3300005535 Ga0070684_100018888 Ga0070684_1000188885 333
233 3300005539 Ga0068853_100185670 Ga0068853_1001856702 333
234 3300005548 Ga0070665_100044596 Ga0070665_1000445963 333
235 3300005548 Ga0070665_100128450 Ga0070665_1001284503 333
236 3300005563 Ga0068855_100000003 Ga0068855_10000000369 333
237 3300005577 Ga0068857_100011110 Ga0068857_1000111104 333
238 3300005614 Ga0068856_100029087 Ga0068856_1000290873 333
239 3300005843 Ga0068860_100329864 Ga0068860_1003298642 333
240 3300006038 Ga0075365_10002844 Ga0075365_100028443 333
241 3300006051 Ga0075364_10051634 Ga0075364_100516341 333
242 3300006051 Ga0075364_10092868 Ga0075364_100928682 333
243 3300006195 Ga0075366_10000044 Ga0075366_1000004433 333
244 3300006195 Ga0075366_10000684 Ga0075366_1000068413 333
245 3300006237 Ga0097621_100003413 Ga0097621_1000034135 333
246 3300006358 Ga0068871_100000156 Ga0068871_1000001569 333
247 3300006358 Ga0068871_100309501 Ga0068871_1003095011 333
248 3300006881 Ga0068865_100190024 Ga0068865_1001900242 333
249 3300009093 Ga0105240_10000003 Ga0105240_10000003776 333
250 3300009093 Ga0105240_10095244 Ga0105240_100952442 333
251 3300009098 Ga0105245_10000002 Ga0105245_10000002185 333
252 3300009098 Ga0105245_10000122 Ga0105245_1000012275 333
253 3300009148 Ga0105243_10000001 Ga0105243_10000001516 333
254 3300009174 Ga0105241_10000003 Ga0105241_10000003233 333
255 3300009174 Ga0105241_10036952 Ga0105241_100369523 333
256 3300009176 Ga0105242_10000064 Ga0105242_1000006468 333
257 3300009177 Ga0105248_10167944 Ga0105248_101679443 333
258 3300009545 Ga0105237_10009676 Ga0105237_100096769 333
259 3300009551 Ga0105238_10055056 Ga0105238_100550562 333
260 3300009987 Ga0105030_101344 Ga0105030_1013442 333
261 3300009993 Ga0105028_100403 Ga0105028_1004031 333
262 3300010375 Ga0105239_10097083 Ga0105239_100970833 333
263 3300013105 Ga0157369_10000261 Ga0157369_1000026168 333
264 3300013105 Ga0157369_10094462 Ga0157369_100944621 333
265 3300013296 Ga0157374_10000031 Ga0157374_10000031188 333
266 3300013296 Ga0157374_10000934 Ga0157374_1000093416 333
267 3300013296 Ga0157374_10001692 Ga0157374_100016922 333
268 3300013296 Ga0157374_10003500 Ga0157374_100035003 333
269 3300013297 Ga0157378_10003107 Ga0157378_100031074 333
270 3300013307 Ga0157372_10000194 Ga0157372_1000019475 333
271 3300013307 Ga0157372_10138568 Ga0157372_101385682 333
272 3300013874 Ga0157514_104464 Ga0157514_1044641 333
273 3300014745 Ga0157377_10038737 Ga0157377_100387371 333
274 3300014969 Ga0157376_10000001 Ga0157376_10000001170 333
275 3300025904 Ga0207647_10000458 Ga0207647_1000045831 333
276 3300025907 Ga0207645_10007453 Ga0207645_100074535 333
277 3300025907 Ga0207645_10010552 Ga0207645_100105526 333
278 3300025909 Ga0207705_10000056 Ga0207705_10000056104 333
279 3300025909 Ga0207705_10024521 Ga0207705_100245212 333
280 3300025911 Ga0207654_10000002 Ga0207654_10000002976 333
281 3300025911 Ga0207654_10009169 Ga0207654_100091692 333
282 3300025912 Ga0207707_10009504 Ga0207707_100095042 333
283 3300025913 Ga0207695_10000005 Ga0207695_10000005785 333
284 3300025913 Ga0207695_10084073 Ga0207695_100840732 333
285 3300025914 Ga0207671_10004219 Ga0207671_100042195 333
286 3300025917 Ga0207660_10001756 Ga0207660_1000175610 333
287 3300025919 Ga0207657_10032453 Ga0207657_100324535 333
288 3300025920 Ga0207649_10049775 Ga0207649_100497752 333
289 3300025921 Ga0207652_10004857 Ga0207652_100048573 333
290 3300025921 Ga0207652_10017113 Ga0207652_100171135 333
291 3300025921 Ga0207652_10073011 Ga0207652_100730112 333
292 3300025921 Ga0207652_10139388 Ga0207652_101393882 333
293 3300025927 Ga0207687_10000001 Ga0207687_100000011026 333
294 3300025927 Ga0207687_10000111 Ga0207687_1000011116 333
295 3300025934 Ga0207686_10000001 Ga0207686_10000001626 333
296 3300025935 Ga0207709_10000002 Ga0207709_10000002744 333
297 3300025938 Ga0207704_10152170 Ga0207704_101521702 333
298 3300025944 Ga0207661_10000021 Ga0207661_1000002181 333
299 3300025949 Ga0207667_10000008 Ga0207667_1000000868 333
300 3300025949 Ga0207667_10006467 Ga0207667_1000646710 333
301 3300025949 Ga0207667_10072503 Ga0207667_100725032 333
302 3300026041 Ga0207639_10009168 Ga0207639_100091686 333
303 3300026078 Ga0207702_10014665 Ga0207702_100146655 333
304 3300026116 Ga0207674_10011447 Ga0207674_100114475 333
305 3300026121 Ga0207683_10002890 Ga0207683_100028906 333
306 3300028379 Ga0268266_10001150 Ga0268266_100011506 333
307 3300028379 Ga0268266_10042895 Ga0268266_100428954 333
308 3300028556 Ga0265337_1023923 Ga0265337_10239232 333
309 3300028573 Ga0265334_10000032 Ga0265334_10000032103 333
310 3300028800 Ga0265338_10000192 Ga0265338_1000019271 333
311 3300028800 Ga0265338_10000601 Ga0265338_1000060124 333
312 3300031240 Ga0265320_10042158 Ga0265320_100421581 333
313 3300031247 Ga0265340_10000077 Ga0265340_1000007729 333
314 3300037471 Ga0395905_0002005 Ga0395905_0002005_13358_14362 333
315 3300038443 Ga0395901_0001919 Ga0395901_0001919_3117_4118 333
316 3300038443 Ga0395901_0010023 Ga0395901_0010023_6033_7034 333
317 3300038443 Ga0395901_0043909 Ga0395901_0043909_532_1536 333
318 3300046694 Ga0495649_0000284 Ga0495649_0000284_25319_26332 333
319 3300050491 nmdc:mga00v17_3576_c1 nmdc:mga00v17_3576_c1_6425_7438 333
320 3300050492 nmdc:mga0yw44_397_c1 nmdc:mga0yw44_397_c1_2476_3495 333
321 3300050492 nmdc:mga0yw44_8649_c1 nmdc:mga0yw44_8649_c1_2382_3386 333
322 3300050493 nmdc:mga0k408_114_c1 nmdc:mga0k408_114_c1_19304_20305 333
323 3300050493 nmdc:mga0k408_16612_c1 nmdc:mga0k408_16612_c1_2891_3895 333
324 3300050496 nmdc:mga07m45_48730_c1 nmdc:mga07m45_48730_c1_991_1992 333
325 3300050516 nmdc:mga0sz30_59125_c1 nmdc:mga0sz30_59125_c1_47_1048 333
326 3300053079 Ga0500610_0000001 Ga0500610_0000001_135819_136820 333
327 3300053087 Ga0500643_000043 Ga0500643_000043_156237_157238 333
328 3300053087 Ga0500643_002590 Ga0500643_002590_5706_6707 333
329 3300053088 Ga0500644_0000006 Ga0500644_0000006_103814_104815 333
330 3300053090 Ga0500646_0000290 Ga0500646_0000290_2291_3292 333
331 3300053093 Ga0500651_0000045 Ga0500651_0000045_37579_38580 333
332 3300053093 Ga0500651_0001186 Ga0500651_0001186_9128_10129 333
333 3300053098 Ga0500650_0000001 Ga0500650_0000001_411154_412155 333
334 3300053103 Ga0500555_000002 Ga0500555_000002_551892_552893 333
335 3300053108 Ga0500562_000002 Ga0500562_000002_832075_833079 333
336 3300053108 Ga0500562_013650 Ga0500562_013650_100_1101 333
337 3300053118 Ga0500594_0000001 Ga0500594_0000001_1072232_1073233 333
338 3300053118 Ga0500594_0000349 Ga0500594_0000349_3940_4944 333
339 3300053123 Ga0500614_000180 Ga0500614_000180_11549_12550 333
340 3300053129 Ga0500628_000012 Ga0500628_000012_26336_27340 333
341 3300053129 Ga0500628_028745 Ga0500628_028745_111_1112 333
342 3300053131 Ga0500652_000020 Ga0500652_000020_39941_40942 333
343 3300053133 Ga0500655_000870 Ga0500655_000870_565_1566 333
344 3300053137 Ga0500561_0000001 Ga0500561_0000001_612650_613651 333
345 3300053139 Ga0500568_0012964 Ga0500568_0012964_743_1744 333
346 3300053142 Ga0500577_0003193 Ga0500577_0003193_1537_2538 333
347 3300053143 Ga0500579_005181 Ga0500579_005181_6264_7265 333
348 3300053160 Ga0500633_0013097 Ga0500633_0013097_98_1099 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

114

380

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3in1-assembly1.cif.gz_A crystal structure of a putative ribokinase in complex with adp from e.coli 0.8326 4 323
7agh-assembly1.cif.gz_C crystal structure of sf kinase yihv from e. coli in complex with amppnp-mg 0.8207 4 322
3in1-assembly1.cif.gz_A crystal structure of a putative ribokinase in complex with adp from e.coli 0.8201 4 323
3b1q-assembly2.cif.gz_D structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with inosine 0.8189 6 331
2c4e-assembly1.cif.gz_A crystal structure of methanocaldococcus jannaschii nucleoside kinase - an archaeal member of the ribokinase family 0.8174 1 323
ID Description Score Start End Superfamily
af_Q9SX54_1_210_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8337 145 323 3.40.1190.20
3iq0B00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.83 4 323 3.40.1190.20
af_P32143_2_297_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8234 4 322 3.40.1190.20
3iq0B00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8222 4 323 3.40.1190.20
2c4eA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8174 1 323 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A7T9K7G6-F1-model_v4 deleted 0.9884 3 131
AF-A0A2U1F2G9-F1-model_v4 Sugar/nucleoside kinase (Ribokinase family) 0.9747 3 333 GO:0006796
GO:0016301
AF-A0A258BQV9-F1-model_v4 Carbohydrate kinase PfkB domain-containing protein 0.9713 1 333 GO:0006796
GO:0016301
AF-A0A0G1T753-F1-model_v4 Sugar kinase, ribokinase family 0.9665 3 333 GO:0006796
GO:0016301
AF-A0A1F5QCY2-F1-model_v4 Carbohydrate kinase PfkB domain-containing protein 0.9617 1 333 GO:0016301

Feature Viewer

pLDDT pTM Quality
93.53 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map