F417274

General Info

Members Datasets Scaffolds Average Seq Length
347 237 694 185

Family's Representative Sequence

Representative Sequence 3300046664|Ga0495659_0056052|Ga0495659_0056052_621_1256
Length 211
Sequence MNSDEPAEEEQPMADIRRRSRFDSTPMVQSVADDSLLTSASTIDEVLGDHAADLRHDFTAYRNHVYRVVNLCIAIVGDRGDLEKVAVAAAFHDLGIWTNKTFDYIPPSLALAREYLTARGQADWIAEIERMIADHHKITPSTASPSSLVEPFRRADWIDVTRGLRTFGVPRPFIESVFAMWPSAGFHWRLVKLAIERLRTHPLTPLPMVKL

Samples

Sample ID Description Type Environment
1 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
168 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
169 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
170 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
235 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
236 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
237 2738543021 Pseudomonas sp. GV071 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.59
Nodule 0
Rhizoplane 1.73
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 26.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495659_0056052 3300046664 Bacteria 1446
2 Ga0065712_10001611 3300005290 Bacteria 8435
3 Ga0065712_10112734 3300005290 Unclassified 1795
4 Ga0065715_10126028 3300005293 Bacteria 2117
5 Ga0065715_10244162 3300005293 Unclassified 1189
6 Ga0070658_10230693 3300005327 Bacteria 1567
7 Ga0070676_10016900 3300005328 Bacteria 4034
8 Ga0070676_10122788 3300005328 Unclassified 1632
9 Ga0070683_100143240 3300005329 Bacteria 2264
10 Ga0070690_100287442 3300005330 Archaea 1175
11 Ga0070666_10029775 3300005335 Bacteria 3592
12 Ga0070666_10050188 3300005335 Bacteria 2806
13 Ga0070680_100113260 3300005336 Unclassified 2259
14 Ga0070682_100051613 3300005337 Bacteria 2570
15 Ga0068868_100037372 3300005338 Bacteria 3764
16 Ga0068868_100552338 3300005338 Bacteria 1015
17 Ga0070689_100486610 3300005340 Unclassified 1055
18 Ga0070689_100729592 3300005340 Archaea 867
19 Ga0070687_100365873 3300005343 Unclassified 935
20 Ga0070661_100475471 3300005344 Archaea 997
21 Ga0070668_100034793 3300005347 Bacteria 3840
22 Ga0070669_100033848 3300005353 Bacteria 3697
23 Ga0070675_100034131 3300005354 Bacteria 4127
24 Ga0070675_100386984 3300005354 Bacteria 1246
25 Ga0070671_100003356 3300005355 Bacteria 12494
26 Ga0070674_100006045 3300005356 Bacteria 7040
27 Ga0070674_100525934 3300005356 Unclassified 989
28 Ga0070673_100234149 3300005364 Bacteria 1594
29 Ga0070673_100326762 3300005364 Bacteria 1356
30 Ga0070688_100499728 3300005365 Unclassified 917
31 Ga0070688_100938165 3300005365 Unclassified 684
32 Ga0070667_100077859 3300005367 Bacteria 2832
33 Ga0070714_100082953 3300005435 Bacteria 2794
34 Ga0070714_101204517 3300005435 Bacteria 739
35 Ga0070694_100012611 3300005444 Bacteria 5260
36 Ga0070694_100687752 3300005444 Bacteria 831
37 Ga0070694_100789794 3300005444 Unclassified 778
38 Ga0070708_100021717 3300005445 Bacteria 5434
39 Ga0070662_100005287 3300005457 Bacteria 8240
40 Ga0068867_100049877 3300005459 Bacteria 3082
41 Ga0068867_100117953 3300005459 Bacteria 2047
42 Ga0070706_100068027 3300005467 Bacteria 3293
43 Ga0070707_100072950 3300005468 Bacteria 3309
44 Ga0070707_100131679 3300005468 Bacteria 2432
45 Ga0070698_100001805 3300005471 Bacteria 23801
46 Ga0070699_100142642 3300005518 Bacteria 2116
47 Ga0070699_100627371 3300005518 Bacteria 981
48 Ga0070684_100117203 3300005535 Bacteria 2393
49 Ga0070697_100439824 3300005536 Bacteria 1135
50 Ga0070697_100447074 3300005536 Unclassified 1125
51 Ga0070697_100573592 3300005536 Unclassified 990
52 Ga0070672_100031891 3300005543 Bacteria 3971
53 Ga0070672_100098856 3300005543 Bacteria 2364
54 Ga0070686_100317670 3300005544 Bacteria 1160
55 Ga0070695_100043379 3300005545 Bacteria 2860
56 Ga0070696_100090519 3300005546 Bacteria 2177
57 Ga0070665_100301356 3300005548 Bacteria 1605
58 Ga0070704_100066168 3300005549 Bacteria 2605
59 Ga0070704_100219291 3300005549 Bacteria 1546
60 Ga0068855_100006983 3300005563 Bacteria 13708
61 Ga0070664_100027749 3300005564 Bacteria 4707
62 Ga0070664_100040980 3300005564 Unclassified 3906
63 Ga0068857_100084086 3300005577 Bacteria 2844
64 Ga0068857_100229406 3300005577 Archaea 1698
65 Ga0068856_100005487 3300005614 Bacteria 12495
66 Ga0068859_100020569 3300005617 Bacteria 6622
67 Ga0068859_100026687 3300005617 Bacteria 5792
68 Ga0068859_100143133 3300005617 Unclassified 2464
69 Ga0068859_100723956 3300005617 Bacteria 1085
70 Ga0068864_100029562 3300005618 Bacteria 4642
71 Ga0068864_100803236 3300005618 Bacteria 925
72 Ga0068861_100415170 3300005719 Bacteria 1198
73 Ga0068870_10031236 3300005840 Bacteria 2697
74 Ga0068870_10388343 3300005840 Unclassified 905
75 Ga0068863_100000788 3300005841 Bacteria 31845
76 Ga0068863_100744875 3300005841 Bacteria 975
77 Ga0068858_100177582 3300005842 Unclassified 2010
78 Ga0068858_101075152 3300005842 Unclassified 789
79 Ga0068862_100114095 3300005844 Bacteria 2375
80 Ga0081538_10031133 3300005981 Bacteria 3606
81 Ga0070717_10240095 3300006028 Bacteria 1597
82 Ga0070717_10501775 3300006028 Bacteria 1097
83 Ga0075368_10106777 3300006042 Unclassified 1152
84 Ga0075363_100051242 3300006048 Bacteria 2201
85 Ga0075364_10232412 3300006051 Bacteria 1252
86 Ga0075432_10155554 3300006058 Bacteria 881
87 Ga0070716_100457643 3300006173 Bacteria 932
88 Ga0075367_10280291 3300006178 Bacteria 1048
89 Ga0097621_100128165 3300006237 Bacteria 2157
90 Ga0097621_101245001 3300006237 Unclassified 702
91 Ga0075370_10035041 3300006353 Bacteria 2816
92 Ga0075428_100001448 3300006844 Bacteria 25368
93 Ga0075428_100024483 3300006844 Bacteria 6680
94 Ga0075428_100161552 3300006844 Bacteria 2431
95 Ga0075430_100253564 3300006846 Bacteria 1458
96 Ga0075431_100272348 3300006847 Bacteria 1715
97 Ga0075431_100522441 3300006847 Bacteria 1176
98 Ga0075433_10032513 3300006852 Unclassified 4468
99 Ga0075433_10104993 3300006852 Bacteria 2503
100 Ga0075434_100019918 3300006871 Bacteria 6498
101 Ga0075434_100297018 3300006871 Bacteria 1635
102 Ga0075434_101294949 3300006871 Unclassified 740
103 Ga0075429_100372287 3300006880 Unclassified 1251
104 Ga0068865_100234269 3300006881 Unclassified 1442
105 Ga0097620_100020569 3300006931 Bacteria 6622
106 Ga0097620_100026687 3300006931 Bacteria 5792
107 Ga0097620_100143135 3300006931 Unclassified 2464
108 Ga0097620_100723882 3300006931 Bacteria 1085
109 Ga0075435_100004721 3300007076 Bacteria 9398
110 Ga0075435_100573702 3300007076 Unclassified 978
111 Ga0075435_100729401 3300007076 Bacteria 862
112 Ga0099794_10004965 3300007265 Bacteria 5292
113 Ga0099794_10131306 3300007265 Bacteria 1265
114 Ga0105240_10003184 3300009093 Bacteria 25778
115 Ga0105240_10136211 3300009093 Bacteria 2941
116 Ga0111539_10002306 3300009094 Bacteria 25374
117 Ga0111539_10025938 3300009094 Bacteria 7175
118 Ga0111539_10103050 3300009094 Bacteria 3349
119 Ga0111539_10570218 3300009094 Unclassified 1318
120 Ga0111539_10740586 3300009094 Bacteria 1144
121 Ga0111539_11187369 3300009094 Unclassified 886
122 Ga0105245_10005714 3300009098 Bacteria 10924
123 Ga0105245_10701325 3300009098 Unclassified 1045
124 Ga0105247_10788849 3300009101 Unclassified 724
125 Ga0114129_10153508 3300009147 Bacteria 3150
126 Ga0114129_10224151 3300009147 Bacteria 2535
127 Ga0105243_10555526 3300009148 Bacteria 1098
128 Ga0105241_10000292 3300009174 Bacteria 37299
129 Ga0105242_10509965 3300009176 Bacteria 1145
130 Ga0105242_10904603 3300009176 Unclassified 883
131 Ga0105248_10003113 3300009177 Bacteria 18369
132 Ga0105248_10017844 3300009177 Bacteria 7832
133 Ga0105248_10408479 3300009177 Unclassified 1529
134 Ga0105237_10002416 3300009545 Bacteria 23189
135 Ga0105237_10977963 3300009545 Unclassified 853
136 Ga0105238_10002303 3300009551 Bacteria 19235
137 Ga0105249_10016847 3300009553 Bacteria 6485
138 Ga0105249_10679462 3300009553 Unclassified 1089
139 Ga0105239_10019698 3300010375 Bacteria 7446
140 Ga0105246_10431625 3300011119 Archaea 1102
141 Ga0157373_10014653 3300013100 Bacteria 5749
142 Ga0157371_10035967 3300013102 Bacteria 3547
143 Ga0157369_10076146 3300013105 Bacteria 3596
144 Ga0157374_10001082 3300013296 Bacteria 23582
145 Ga0157378_10037230 3300013297 Bacteria 4308
146 Ga0157378_10076068 3300013297 Unclassified 3024
147 Ga0163162_10005647 3300013306 Bacteria 12084
148 Ga0157372_10001876 3300013307 Bacteria 22791
149 Ga0157375_10073084 3300013308 Unclassified 3448
150 Ga0157375_10438808 3300013308 Bacteria 1471
151 Ga0157375_11798758 3300013308 Unclassified 726
152 Ga0163163_10000001 3300014325 Bacteria 622185
153 Ga0163163_11516688 3300014325 Unclassified 732
154 Ga0157380_10127895 3300014326 Bacteria 2162
155 Ga0157380_10412887 3300014326 Unclassified 1285
156 Ga0157380_11414172 3300014326 Unclassified 746
157 Ga0157377_10196875 3300014745 Bacteria 1277
158 Ga0157376_10254437 3300014969 Bacteria 1642
159 Ga0182006_1016855 3300015261 Bacteria 3113
160 Ga0163161_10245173 3300017792 Bacteria 1395
161 Ga0207682_10007945 3300025893 Bacteria 4211
162 Ga0207688_10531234 3300025901 Unclassified 738
163 Ga0207680_10134642 3300025903 Bacteria 1632
164 Ga0207645_10033919 3300025907 Bacteria 3280
165 Ga0207645_10253332 3300025907 Unclassified 1165
166 Ga0207643_10085121 3300025908 Bacteria 1836
167 Ga0207707_10292029 3300025912 Archaea 1410
168 Ga0207695_10001999 3300025913 Bacteria 31465
169 Ga0207671_10010777 3300025914 Bacteria 7505
170 Ga0207671_10463626 3300025914 Unclassified 1009
171 Ga0207693_10016976 3300025915 Bacteria 5815
172 Ga0207660_10134798 3300025917 Unclassified 1883
173 Ga0207657_10076095 3300025919 Bacteria 2832
174 Ga0207649_10653460 3300025920 Archaea 813
175 Ga0207652_10058940 3300025921 Bacteria 3309
176 Ga0207646_10010534 3300025922 Bacteria 9024
177 Ga0207646_10356657 3300025922 Bacteria 1321
178 Ga0207646_10411050 3300025922 Unclassified 1222
179 Ga0207681_10023714 3300025923 Bacteria 3928
180 Ga0207694_10009411 3300025924 Bacteria 7367
181 Ga0207650_10009212 3300025925 Bacteria 6747
182 Ga0207659_10600367 3300025926 Unclassified 938
183 Ga0207687_10000651 3300025927 Bacteria 23352
184 Ga0207644_10041475 3300025931 Bacteria 3256
185 Ga0207706_10001601 3300025933 Bacteria 22472
186 Ga0207706_10017916 3300025933 Bacteria 6374
187 Ga0207686_10002876 3300025934 Bacteria 9278
188 Ga0207670_10191779 3300025936 Unclassified 1547
189 Ga0207670_10571855 3300025936 Unclassified 925
190 Ga0207669_10011982 3300025937 Bacteria 4245
191 Ga0207669_10607782 3300025937 Bacteria 889
192 Ga0207704_10307267 3300025938 Unclassified 1217
193 Ga0207691_10005237 3300025940 Bacteria 12515
194 Ga0207691_10013586 3300025940 Bacteria 7785
195 Ga0207711_10000518 3300025941 Bacteria 39621
196 Ga0207711_10067335 3300025941 Unclassified 3099
197 Ga0207711_10779528 3300025941 Unclassified 891
198 Ga0207661_10298871 3300025944 Unclassified 1443
199 Ga0207679_10018498 3300025945 Bacteria 4669
200 Ga0207679_10023510 3300025945 Bacteria 4216
201 Ga0207667_10006592 3300025949 Bacteria 14035
202 Ga0207712_11110866 3300025961 Unclassified 704
203 Ga0207668_10015527 3300025972 Bacteria 4734
204 Ga0207658_10059183 3300025986 Bacteria 2854
205 Ga0207658_10069029 3300025986 Bacteria 2669
206 Ga0207677_10021323 3300026023 Bacteria 3956
207 Ga0207703_10253547 3300026035 Unclassified 1587
208 Ga0207703_10271149 3300026035 Unclassified 1537
209 Ga0207639_10533012 3300026041 Archaea 1076
210 Ga0207708_10087425 3300026075 Bacteria 2400
211 Ga0207702_10004959 3300026078 Bacteria 11690
212 Ga0207641_10002039 3300026088 Bacteria 19240
213 Ga0207641_10688143 3300026088 Bacteria 1006
214 Ga0207648_10060726 3300026089 Bacteria 3296
215 Ga0207648_11498587 3300026089 Unclassified 634
216 Ga0207676_10021922 3300026095 Bacteria 4692
217 Ga0207676_10411549 3300026095 Bacteria 1266
218 Ga0207674_10054722 3300026116 Bacteria 4062
219 Ga0207674_10218391 3300026116 Archaea 1854
220 Ga0207675_100057162 3300026118 Bacteria 3639
221 Ga0207675_100513044 3300026118 Bacteria 1194
222 Ga0209970_1010612 3300027614 Unclassified 1508
223 Ga0210002_1000594 3300027617 Bacteria 4908
224 Ga0209588_1012994 3300027671 Unclassified 2535
225 Ga0209971_1004991 3300027682 Bacteria 3153
226 Ga0209998_10001121 3300027717 Bacteria 6659
227 Ga0207428_10000254 3300027907 Bacteria 72967
228 Ga0207428_10010410 3300027907 Bacteria 8307
229 Ga0268265_10097525 3300028380 Bacteria 2365
230 Ga0268265_10275023 3300028380 Archaea 1504
231 Ga0307408_100256451 3300031548 Bacteria 1445
232 Ga0307410_10153603 3300031852 Bacteria 1716
233 Ga0307407_10500845 3300031903 Bacteria 890
234 Ga0307412_10621576 3300031911 Unclassified 918
235 Ga0307409_100016455 3300031995 Bacteria 4893
236 Ga0307416_100044482 3300032002 Bacteria 3487
237 Ga0307411_10202779 3300032005 Bacteria 1525
238 Ga0373926_0094212 3300035083 Bacteria 1116
239 Ga0373932_0204800 3300035112 Unclassified 703
240 Ga0373945_0082501 3300035116 Bacteria 1234
241 Ga0373943_0319630 3300035170 Bacteria 885
242 Ga0373946_0439303 3300035171 Unclassified 663
243 Ga0373931_0034738 3300035691 Bacteria 2618
244 Ga0373927_0072298 3300035695 Bacteria 2232
245 Ga0373947_0163434 3300035725 Unclassified 1441
246 Ga0373947_0347795 3300035725 Unclassified 994
247 Ga0373925_0008680 3300037068 Bacteria 7403
248 Ga0395898_1080976 3300037466 Unclassified 736
249 Ga0395905_1238651 3300037471 Unclassified 650
250 Ga0439453_0092197 3300041408 Unclassified 666
251 Ga0439445_0049851 3300042004 Bacteria 1128
252 Ga0450923_040881 3300042125 Unclassified 974
253 Ga0439444_0052401 3300042437 Unclassified 833
254 Ga0451576_0004212 3300045051 Bacteria 18913
255 Ga0495592_0002028 3300046454 Bacteria 14263
256 Ga0495603_0077759 3300046455 Bacteria 1946
257 Ga0495603_0082996 3300046455 Bacteria 1877
258 Ga0495641_0002980 3300046461 Bacteria 13000
259 Ga0495582_0115954 3300046473 Unclassified 1506
260 Ga0495582_0171750 3300046473 Unclassified 1234
261 Ga0495664_0113213 3300046477 Bacteria 1638
262 Ga0495620_0021228 3300046515 Bacteria 3157
263 Ga0495628_0028829 3300046516 Bacteria 4508
264 Ga0495630_0107860 3300046517 Bacteria 2109
265 Ga0495643_0000017 3300046522 Bacteria 313381
266 Ga0495644_0002389 3300046523 Bacteria 7491
267 Ga0495663_0196641 3300046525 Unclassified 703
268 Ga0495666_0232113 3300046526 Unclassified 843
269 Ga0495642_0124397 3300046528 Bacteria 1108
270 Ga0495654_0324278 3300046530 Unclassified 624
271 Ga0495587_0054749 3300046536 Unclassified 2351
272 Ga0495609_0155965 3300046538 Unclassified 970
273 Ga0495645_0018595 3300046543 Bacteria 4993
274 Ga0495622_0000025 3300046557 Bacteria 146973
275 Ga0495633_0111429 3300046558 Bacteria 1269
276 Ga0495633_0146106 3300046558 Bacteria 1093
277 Ga0495667_0015762 3300046559 Bacteria 5110
278 Ga0495656_0002246 3300046615 Bacteria 6384
279 Ga0495668_0193483 3300046616 Unclassified 1114
280 Ga0495625_0866576 3300046660 Unclassified 520
281 Ga0495659_0029012 3300046664 Bacteria 1918
282 Ga0495659_0079874 3300046664 Bacteria 1239
283 Ga0495658_0026148 3300046683 Unclassified 3125
284 Ga0495658_0280060 3300046683 Unclassified 1052
285 Ga0495613_0000258 3300046689 Bacteria 49962
286 Ga0495613_0568194 3300046689 Unclassified 757
287 Ga0495670_0540821 3300046691 Unclassified 634
288 Ga0495671_0000342 3300046692 Bacteria 38737
289 Ga0495671_0043296 3300046692 Bacteria 2260
290 Ga0495589_0022388 3300046794 Bacteria 3225
291 Ga0495600_0554681 3300046809 Unclassified 702
292 Ga0495581_0119703 3300047315 Unclassified 1532
293 Ga0495604_0004815 3300047317 Bacteria 10704
294 Ga0495636_0043633 3300047318 Bacteria 1866
295 Ga0495636_0176913 3300047318 Bacteria 967
296 Ga0495674_0024424 3300047319 Bacteria 5554
297 Ga0495680_0128487 3300047322 Bacteria 1864
298 Ga0495680_0438225 3300047322 Unclassified 896
299 Ga0495684_0001324 3300047471 Bacteria 19946
300 Ga0495686_0000011 3300047472 Bacteria 514750
301 Ga0495686_0020849 3300047472 Bacteria 4366
302 Ga0495686_0072580 3300047472 Bacteria 2116
303 Ga0495615_0023643 3300048090 Unclassified 1410
304 Ga0496104_0378954 3300048907 Archaea 1327
305 Ga0496109_0244380 3300048912 Bacteria 1690
306 Ga0496110_0365356 3300048913 Unclassified 1315
307 Ga0496112_0001511 3300048915 Bacteria 17914
308 Ga0496112_0036390 3300048915 Bacteria 4802
309 Ga0496113_0223566 3300048916 Bacteria 1501
310 Ga0501036_0487848 3300049572 Bacteria 1026
311 Ga0501041_0158880 3300049577 Bacteria 1413
312 Ga0501042_0472489 3300049578 Bacteria 910
313 Ga0501071_0368776 3300049587 Bacteria 1094
314 Ga0501079_0404549 3300049741 Bacteria 1071
315 Ga0501080_0687129 3300049742 Bacteria 903
316 Ga0501081_0422578 3300049743 Bacteria 988
317 nmdc:mga03n38_343850_c1 3300050490 Bacteria 810
318 nmdc:mga00v17_178513_c1 3300050491 Bacteria 1370
319 nmdc:mga05p37_24070_c1 3300050507 Bacteria 7396
320 nmdc:mga05p37_352326_c1 3300050507 Bacteria 1733
321 nmdc:mga05p37_8146_c1 3300050507 Bacteria 12388
322 nmdc:mga09592_247599_c1 3300050508 Unclassified 1545
323 nmdc:mga09592_56439_c1 3300050508 Bacteria 3318
324 nmdc:mga0qj67_236256_c1 3300050509 Bacteria 1483
325 nmdc:mga06r32_1097909_c1 3300050510 Unclassified 745
326 nmdc:mga06r32_375971_c1 3300050510 Unclassified 1404
327 nmdc:mga08y16_103917_c1 3300050511 Unclassified 2957
328 nmdc:mga08y16_16261_c1 3300050511 Bacteria 7824
329 nmdc:mga08y16_189238_c1 3300050511 Bacteria 2135
330 nmdc:mga08y16_293638_c1 3300050511 Unclassified 1676
331 nmdc:mga08y16_505_c1 3300050511 Bacteria 36001
332 nmdc:mga08y16_903443_c1 3300050511 Bacteria 869
333 nmdc:mga0n895_194_c1 3300050512 Bacteria 37839
334 nmdc:mga0n895_82342_c1 3300050512 Bacteria 3208
335 nmdc:mga0rr50_325950_c1 3300050513 Bacteria 1288
336 nmdc:mga0rr50_4703_c1 3300050513 Bacteria 8049
337 nmdc:mga0a205_31663_c1 3300050515 Bacteria 5069
338 nmdc:mga0a205_3730_c1 3300050515 Bacteria 2266
339 nmdc:mga0a205_576759_c1 3300050515 Unclassified 979
340 nmdc:mga0a205_59336_c1 3300050515 Bacteria 3696
341 Ga0495601_0002245 3300053077 Bacteria 10887
342 Ga0495595_0423560 3300053084 Bacteria 675
343 Ga0495619_0005378 3300053085 Bacteria 8110
344 Ga0500651_0546472 3300053093 Unclassified 634
345 Ga0500628_006316 3300053129 Bacteria 2002
346 2739285372 2738543020 Bacteria 5718238
347 2739290686 2738543021 Bacteria 5718241
348 Ga0495659_0056052
349 Ga0065712_10001611
350 Ga0065712_10112734
351 Ga0065715_10126028
352 Ga0065715_10244162
353 Ga0070658_10230693
354 Ga0070676_10016900
355 Ga0070676_10122788
356 Ga0070683_100143240
357 Ga0070690_100287442
358 Ga0070666_10029775
359 Ga0070666_10050188
360 Ga0070680_100113260
361 Ga0070682_100051613
362 Ga0068868_100037372
363 Ga0068868_100552338
364 Ga0070689_100486610
365 Ga0070689_100729592
366 Ga0070687_100365873
367 Ga0070661_100475471
368 Ga0070668_100034793
369 Ga0070669_100033848
370 Ga0070675_100034131
371 Ga0070675_100386984
372 Ga0070671_100003356
373 Ga0070674_100006045
374 Ga0070674_100525934
375 Ga0070673_100234149
376 Ga0070673_100326762
377 Ga0070688_100499728
378 Ga0070688_100938165
379 Ga0070667_100077859
380 Ga0070714_100082953
381 Ga0070714_101204517
382 Ga0070694_100012611
383 Ga0070694_100687752
384 Ga0070694_100789794
385 Ga0070708_100021717
386 Ga0070662_100005287
387 Ga0068867_100049877
388 Ga0068867_100117953
389 Ga0070706_100068027
390 Ga0070707_100072950
391 Ga0070707_100131679
392 Ga0070698_100001805
393 Ga0070699_100142642
394 Ga0070699_100627371
395 Ga0070684_100117203
396 Ga0070697_100439824
397 Ga0070697_100447074
398 Ga0070697_100573592
399 Ga0070672_100031891
400 Ga0070672_100098856
401 Ga0070686_100317670
402 Ga0070695_100043379
403 Ga0070696_100090519
404 Ga0070665_100301356
405 Ga0070704_100066168
406 Ga0070704_100219291
407 Ga0068855_100006983
408 Ga0070664_100027749
409 Ga0070664_100040980
410 Ga0068857_100084086
411 Ga0068857_100229406
412 Ga0068856_100005487
413 Ga0068859_100020569
414 Ga0068859_100026687
415 Ga0068859_100143133
416 Ga0068859_100723956
417 Ga0068864_100029562
418 Ga0068864_100803236
419 Ga0068861_100415170
420 Ga0068870_10031236
421 Ga0068870_10388343
422 Ga0068863_100000788
423 Ga0068863_100744875
424 Ga0068858_100177582
425 Ga0068858_101075152
426 Ga0068862_100114095
427 Ga0081538_10031133
428 Ga0070717_10240095
429 Ga0070717_10501775
430 Ga0075368_10106777
431 Ga0075363_100051242
432 Ga0075364_10232412
433 Ga0075432_10155554
434 Ga0070716_100457643
435 Ga0075367_10280291
436 Ga0097621_100128165
437 Ga0097621_101245001
438 Ga0075370_10035041
439 Ga0075428_100001448
440 Ga0075428_100024483
441 Ga0075428_100161552
442 Ga0075430_100253564
443 Ga0075431_100272348
444 Ga0075431_100522441
445 Ga0075433_10032513
446 Ga0075433_10104993
447 Ga0075434_100019918
448 Ga0075434_100297018
449 Ga0075434_101294949
450 Ga0075429_100372287
451 Ga0068865_100234269
452 Ga0097620_100020569
453 Ga0097620_100026687
454 Ga0097620_100143135
455 Ga0097620_100723882
456 Ga0075435_100004721
457 Ga0075435_100573702
458 Ga0075435_100729401
459 Ga0099794_10004965
460 Ga0099794_10131306
461 Ga0105240_10003184
462 Ga0105240_10136211
463 Ga0111539_10002306
464 Ga0111539_10025938
465 Ga0111539_10103050
466 Ga0111539_10570218
467 Ga0111539_10740586
468 Ga0111539_11187369
469 Ga0105245_10005714
470 Ga0105245_10701325
471 Ga0105247_10788849
472 Ga0114129_10153508
473 Ga0114129_10224151
474 Ga0105243_10555526
475 Ga0105241_10000292
476 Ga0105242_10509965
477 Ga0105242_10904603
478 Ga0105248_10003113
479 Ga0105248_10017844
480 Ga0105248_10408479
481 Ga0105237_10002416
482 Ga0105237_10977963
483 Ga0105238_10002303
484 Ga0105249_10016847
485 Ga0105249_10679462
486 Ga0105239_10019698
487 Ga0105246_10431625
488 Ga0157373_10014653
489 Ga0157371_10035967
490 Ga0157369_10076146
491 Ga0157374_10001082
492 Ga0157378_10037230
493 Ga0157378_10076068
494 Ga0163162_10005647
495 Ga0157372_10001876
496 Ga0157375_10073084
497 Ga0157375_10438808
498 Ga0157375_11798758
499 Ga0163163_10000001
500 Ga0163163_11516688
501 Ga0157380_10127895
502 Ga0157380_10412887
503 Ga0157380_11414172
504 Ga0157377_10196875
505 Ga0157376_10254437
506 Ga0182006_1016855
507 Ga0163161_10245173
508 Ga0207682_10007945
509 Ga0207688_10531234
510 Ga0207680_10134642
511 Ga0207645_10033919
512 Ga0207645_10253332
513 Ga0207643_10085121
514 Ga0207707_10292029
515 Ga0207695_10001999
516 Ga0207671_10010777
517 Ga0207671_10463626
518 Ga0207693_10016976
519 Ga0207660_10134798
520 Ga0207657_10076095
521 Ga0207649_10653460
522 Ga0207652_10058940
523 Ga0207646_10010534
524 Ga0207646_10356657
525 Ga0207646_10411050
526 Ga0207681_10023714
527 Ga0207694_10009411
528 Ga0207650_10009212
529 Ga0207659_10600367
530 Ga0207687_10000651
531 Ga0207644_10041475
532 Ga0207706_10001601
533 Ga0207706_10017916
534 Ga0207686_10002876
535 Ga0207670_10191779
536 Ga0207670_10571855
537 Ga0207669_10011982
538 Ga0207669_10607782
539 Ga0207704_10307267
540 Ga0207691_10005237
541 Ga0207691_10013586
542 Ga0207711_10000518
543 Ga0207711_10067335
544 Ga0207711_10779528
545 Ga0207661_10298871
546 Ga0207679_10018498
547 Ga0207679_10023510
548 Ga0207667_10006592
549 Ga0207712_11110866
550 Ga0207668_10015527
551 Ga0207658_10059183
552 Ga0207658_10069029
553 Ga0207677_10021323
554 Ga0207703_10253547
555 Ga0207703_10271149
556 Ga0207639_10533012
557 Ga0207708_10087425
558 Ga0207702_10004959
559 Ga0207641_10002039
560 Ga0207641_10688143
561 Ga0207648_10060726
562 Ga0207648_11498587
563 Ga0207676_10021922
564 Ga0207676_10411549
565 Ga0207674_10054722
566 Ga0207674_10218391
567 Ga0207675_100057162
568 Ga0207675_100513044
569 Ga0209970_1010612
570 Ga0210002_1000594
571 Ga0209588_1012994
572 Ga0209971_1004991
573 Ga0209998_10001121
574 Ga0207428_10000254
575 Ga0207428_10010410
576 Ga0268265_10097525
577 Ga0268265_10275023
578 Ga0307408_100256451
579 Ga0307410_10153603
580 Ga0307407_10500845
581 Ga0307412_10621576
582 Ga0307409_100016455
583 Ga0307416_100044482
584 Ga0307411_10202779
585 Ga0373926_0094212
586 Ga0373932_0204800
587 Ga0373945_0082501
588 Ga0373943_0319630
589 Ga0373946_0439303
590 Ga0373931_0034738
591 Ga0373927_0072298
592 Ga0373947_0163434
593 Ga0373947_0347795
594 Ga0373925_0008680
595 Ga0395898_1080976
596 Ga0395905_1238651
597 Ga0439453_0092197
598 Ga0439445_0049851
599 Ga0450923_040881
600 Ga0439444_0052401
601 Ga0451576_0004212
602 Ga0495592_0002028
603 Ga0495603_0077759
604 Ga0495603_0082996
605 Ga0495641_0002980
606 Ga0495582_0115954
607 Ga0495582_0171750
608 Ga0495664_0113213
609 Ga0495620_0021228
610 Ga0495628_0028829
611 Ga0495630_0107860
612 Ga0495643_0000017
613 Ga0495644_0002389
614 Ga0495663_0196641
615 Ga0495666_0232113
616 Ga0495642_0124397
617 Ga0495654_0324278
618 Ga0495587_0054749
619 Ga0495609_0155965
620 Ga0495645_0018595
621 Ga0495622_0000025
622 Ga0495633_0111429
623 Ga0495633_0146106
624 Ga0495667_0015762
625 Ga0495656_0002246
626 Ga0495668_0193483
627 Ga0495625_0866576
628 Ga0495659_0029012
629 Ga0495659_0079874
630 Ga0495658_0026148
631 Ga0495658_0280060
632 Ga0495613_0000258
633 Ga0495613_0568194
634 Ga0495670_0540821
635 Ga0495671_0000342
636 Ga0495671_0043296
637 Ga0495589_0022388
638 Ga0495600_0554681
639 Ga0495581_0119703
640 Ga0495604_0004815
641 Ga0495636_0043633
642 Ga0495636_0176913
643 Ga0495674_0024424
644 Ga0495680_0128487
645 Ga0495680_0438225
646 Ga0495684_0001324
647 Ga0495686_0000011
648 Ga0495686_0020849
649 Ga0495686_0072580
650 Ga0495615_0023643
651 Ga0496104_0378954
652 Ga0496109_0244380
653 Ga0496110_0365356
654 Ga0496112_0001511
655 Ga0496112_0036390
656 Ga0496113_0223566
657 Ga0501036_0487848
658 Ga0501041_0158880
659 Ga0501042_0472489
660 Ga0501071_0368776
661 Ga0501079_0404549
662 Ga0501080_0687129
663 Ga0501081_0422578
664 nmdc:mga03n38_343850_c1
665 nmdc:mga00v17_178513_c1
666 nmdc:mga05p37_24070_c1
667 nmdc:mga05p37_352326_c1
668 nmdc:mga05p37_8146_c1
669 nmdc:mga09592_247599_c1
670 nmdc:mga09592_56439_c1
671 nmdc:mga0qj67_236256_c1
672 nmdc:mga06r32_1097909_c1
673 nmdc:mga06r32_375971_c1
674 nmdc:mga08y16_103917_c1
675 nmdc:mga08y16_16261_c1
676 nmdc:mga08y16_189238_c1
677 nmdc:mga08y16_293638_c1
678 nmdc:mga08y16_505_c1
679 nmdc:mga08y16_903443_c1
680 nmdc:mga0n895_194_c1
681 nmdc:mga0n895_82342_c1
682 nmdc:mga0rr50_325950_c1
683 nmdc:mga0rr50_4703_c1
684 nmdc:mga0a205_31663_c1
685 nmdc:mga0a205_3730_c1
686 nmdc:mga0a205_576759_c1
687 nmdc:mga0a205_59336_c1
688 Ga0495601_0002245
689 Ga0495595_0423560
690 Ga0495619_0005378
691 Ga0500651_0546472
692 Ga0500628_006316
693 2739285372
694 2739290686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

61

161

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.7759 3 172
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.7303 3 172
6b7o-assembly1.cif.gz_A crystal structure of legionella effector sded (lpg2509) h67a in complex with adp-ribosylated ubiquitin 0.5643 34 170
3wfp-assembly9.cif.gz_B trna processing enzyme (apo form 2) 0.4939 16 175
4xy2-assembly1.cif.gz_A crystal structure of pde10a in complex with asp9436 0.4858 35 180
ID Description Score Start End Superfamily
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7587 10 163 1.10.3210.10
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7225 10 163 1.10.3210.10
af_Q54X27_73_241_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.5044 11 173 1.10.472.10
af_Q8IKK5_1_308_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4144 9 162 1.10.472.10
af_Q54X27_73_241_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4058 11 173 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A3N5WNW9-F1-model_v4 deleted 0.9727 5 181
AF-A0A7W4T480-F1-model_v4 deleted 0.9702 3 181
AF-A0A4V6BHE9-F1-model_v4 Phosphohydrolase 0.969 19 177 GO:0016787
AF-A0A1E7RM55-F1-model_v4 HD domain-containing protein 0.9666 8 181
AF-A0A507WCS7-F1-model_v4 Phosphohydrolase 0.9646 5 178 GO:0016787

Map