F417173

General Info

Members Datasets Scaffolds Average Seq Length
347 185 694 329

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10024152|Ga0207687_100241522
Length 377
Sequence MGLGLQLGLDSRFVPYSWPLCGQRSLEYLIHRPASLAQTPNSAKISRMDVLSEVLKVVRLEGALFFNGEFSAPWCFDSSAEAMAPHLAPGPEHMITYHFLTEGRAYARLPDGERVELTAGDIVIFPHGNAHTLGNGLTDRPVDGRAMLAHLADGLKVARFGGGGEITRFVCGYMACEPRLCEIFLSGLPKILKVSVSDEPSGQWLQNSILFSVDHANGGSAGSSLVLAKLSEVLLVETLRRYISALPPNQTGWMAGARDPVIGQALALLHKEPAYPWTIAELAKRTGVSRTRLAERFRHYLEDSPMAYLAQWRLKLGAEILRSSEDSVAEVAAAVGYGSEAAFNRAFKREFDCPPAQFRRDHKVPSARRAQAKALHA

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.73
Rhizosphere 97.41
Stem 0
Stem Tuber 0
Unclassified 21.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10024152 3300025927 Bacteria 4059
2 rootL2_10000941 3300003322 Bacteria 16310
3 Ga0065707_10002433 3300005295 Bacteria 8402
4 Ga0070683_100067056 3300005329 Bacteria 3342
5 Ga0070683_100302737 3300005329 Bacteria 1521
6 Ga0070683_100385596 3300005329 Unclassified 1335
7 Ga0070670_100004103 3300005331 Bacteria 12168
8 Ga0068869_100058480 3300005334 Unclassified 2819
9 Ga0070666_10016625 3300005335 Unclassified 4708
10 Ga0070666_10042526 3300005335 Unclassified 3041
11 Ga0068868_100029506 3300005338 Bacteria 4200
12 Ga0070660_100015659 3300005339 Bacteria 5481
13 Ga0070660_100225998 3300005339 Bacteria 1522
14 Ga0070689_100128267 3300005340 Bacteria 2032
15 Ga0070661_100088743 3300005344 Unclassified 2289
16 Ga0070668_100049852 3300005347 Plasmid 3222
17 Ga0070669_100035164 3300005353 Unclassified 3629
18 Ga0070671_100093162 3300005355 Unclassified 2525
19 Ga0070674_100027690 3300005356 Bacteria 3716
20 Ga0070674_100042060 3300005356 Bacteria 3102
21 Ga0070673_100012117 3300005364 Bacteria 5910
22 Ga0070673_100122909 3300005364 Bacteria 2168
23 Ga0070659_100106266 3300005366 Unclassified 2263
24 Ga0070667_100003599 3300005367 Bacteria 13181
25 Ga0070667_100009188 3300005367 Bacteria 8184
26 Ga0070667_100104933 3300005367 Unclassified 2445
27 Ga0070667_100427418 3300005367 Bacteria 1208
28 Ga0070703_10000039 3300005406 Bacteria 65007
29 Ga0070709_10112155 3300005434 Bacteria 1834
30 Ga0070713_100116457 3300005436 Bacteria 2337
31 Ga0070713_100251007 3300005436 Bacteria 1613
32 Ga0070701_10109586 3300005438 Bacteria 1541
33 Ga0070711_100012960 3300005439 Bacteria 5226
34 Ga0070711_100177539 3300005439 Unclassified 1628
35 Ga0070705_100000474 3300005440 Bacteria 23117
36 Ga0070705_100067028 3300005440 Bacteria 2155
37 Ga0070694_100303618 3300005444 Bacteria 1224
38 Ga0070678_100095036 3300005456 Bacteria 2296
39 Ga0070662_100087458 3300005457 Bacteria 2333
40 Ga0070681_10000469 3300005458 Bacteria 32902
41 Ga0070681_10149869 3300005458 Unclassified 2259
42 Ga0068867_100015374 3300005459 Bacteria 5428
43 Ga0070706_100000174 3300005467 Bacteria 81375
44 Ga0070706_100005902 3300005467 Bacteria 11601
45 Ga0070707_100050909 3300005468 Bacteria 3970
46 Ga0070698_100013482 3300005471 Bacteria 8653
47 Ga0070699_100004411 3300005518 Bacteria 12435
48 Ga0070699_100004434 3300005518 Bacteria 12415
49 Ga0070679_100019690 3300005530 Bacteria 6568
50 Ga0070679_100034092 3300005530 Bacteria 5044
51 Ga0070679_100064740 3300005530 Bacteria 3644
52 Ga0070697_100020499 3300005536 Bacteria 5231
53 Ga0070697_100081553 3300005536 Bacteria 2666
54 Ga0068853_100002771 3300005539 Bacteria 13243
55 Ga0068853_100106659 3300005539 Unclassified 2483
56 Ga0068853_100132058 3300005539 Bacteria 2236
57 Ga0070672_100005952 3300005543 Bacteria 8138
58 Ga0070696_100000111 3300005546 Bacteria 41669
59 Ga0070696_100008745 3300005546 Bacteria 6778
60 Ga0070693_100151740 3300005547 Unclassified 1468
61 Ga0070693_100220797 3300005547 Bacteria 1241
62 Ga0070665_100007845 3300005548 Bacteria 10827
63 Ga0068855_100100555 3300005563 Bacteria 3329
64 Ga0068855_100285282 3300005563 Bacteria 1832
65 Ga0068855_100342557 3300005563 Unclassified 1648
66 Ga0070664_100001849 3300005564 Bacteria 16955
67 Ga0070664_100003382 3300005564 Bacteria 12877
68 Ga0070664_100004032 3300005564 Bacteria 11796
69 Ga0070664_100053019 3300005564 Bacteria 3436
70 Ga0070664_100378359 3300005564 Bacteria 1292
71 Ga0068857_100042997 3300005577 Unclassified 4008
72 Ga0068857_100051685 3300005577 Bacteria 3647
73 Ga0068857_100357581 3300005577 Unclassified 1353
74 Ga0068856_100099250 3300005614 Bacteria 2902
75 Ga0068852_100015608 3300005616 Bacteria 5899
76 Ga0068859_100002570 3300005617 Bacteria 18443
77 Ga0068859_100067275 3300005617 Plasmid 3617
78 Ga0068859_100281348 3300005617 Bacteria 1756
79 Ga0068859_100421906 3300005617 Bacteria 1430
80 Ga0068864_100005346 3300005618 Bacteria 10521
81 Ga0068864_100008115 3300005618 Bacteria 8658
82 Ga0068864_100022905 3300005618 Bacteria 5241
83 Ga0068866_10044304 3300005718 Bacteria 2225
84 Ga0068851_10000736 3300005834 Bacteria 13995
85 Ga0068851_10073226 3300005834 Bacteria 1776
86 Ga0068863_100001279 3300005841 Bacteria 25101
87 Ga0068863_100018963 3300005841 Bacteria 6583
88 Ga0068863_100090019 3300005841 Bacteria 2910
89 Ga0068858_100066612 3300005842 Bacteria 3334
90 Ga0068858_100084568 3300005842 Bacteria 2951
91 Ga0068858_100093134 3300005842 Unclassified 2805
92 Ga0068860_100011774 3300005843 Bacteria 8620
93 Ga0068860_100034633 3300005843 Bacteria 4844
94 Ga0068862_100129492 3300005844 Unclassified 2231
95 Ga0070712_100122128 3300006175 Unclassified 1961
96 Ga0070712_100211661 3300006175 Unclassified 1529
97 Ga0097621_100012858 3300006237 Bacteria 6218
98 Ga0097621_100017099 3300006237 Bacteria 5501
99 Ga0097621_100075278 3300006237 Bacteria 2798
100 Ga0097621_100078729 3300006237 Bacteria 2739
101 Ga0097621_100109697 3300006237 Bacteria 2331
102 Ga0068871_100010415 3300006358 Bacteria 6785
103 Ga0068871_100017895 3300006358 Bacteria 5373
104 Ga0068871_100027768 3300006358 Bacteria 4429
105 Ga0068871_100205782 3300006358 Bacteria 1701
106 Ga0075428_100141434 3300006844 Bacteria 2616
107 Ga0075434_100453431 3300006871 Bacteria 1304
108 Ga0075436_100076541 3300006914 Bacteria 2317
109 Ga0075436_100119337 3300006914 Bacteria 1844
110 Ga0097620_100002570 3300006931 Bacteria 18443
111 Ga0097620_100067270 3300006931 Plasmid 3617
112 Ga0097620_100281352 3300006931 Bacteria 1756
113 Ga0097620_100421884 3300006931 Bacteria 1430
114 Ga0105240_10023241 3300009093 Bacteria 8207
115 Ga0105240_10130593 3300009093 Unclassified 3014
116 Ga0105240_10132072 3300009093 Unclassified 2994
117 Ga0111539_10593774 3300009094 Unclassified 1289
118 Ga0105245_10002077 3300009098 Bacteria 18178
119 Ga0105245_10003891 3300009098 Bacteria 13273
120 Ga0105245_10034005 3300009098 Bacteria 4518
121 Ga0105245_10127231 3300009098 Bacteria 2386
122 Ga0105245_10157080 3300009098 Unclassified 2155
123 Ga0105247_10044993 3300009101 Unclassified 2708
124 Ga0114129_10062366 3300009147 Bacteria 5208
125 Ga0114129_10065776 3300009147 Bacteria 5059
126 Ga0114129_10107747 3300009147 Bacteria 3847
127 Ga0105243_10068106 3300009148 Unclassified 2868
128 Ga0105241_10010601 3300009174 Bacteria 6759
129 Ga0105241_10237367 3300009174 Bacteria 1540
130 Ga0105242_10014658 3300009176 Bacteria 6070
131 Ga0105242_10091142 3300009176 Unclassified 2566
132 Ga0105242_10114982 3300009176 Unclassified 2300
133 Ga0105248_10007774 3300009177 Bacteria 11766
134 Ga0105248_10011879 3300009177 Bacteria 9607
135 Ga0105248_10028354 3300009177 Bacteria 6238
136 Ga0105237_10089900 3300009545 Bacteria 3060
137 Ga0105237_10125686 3300009545 Bacteria 2559
138 Ga0105237_10201135 3300009545 Bacteria 1992
139 Ga0105237_10410662 3300009545 Bacteria 1359
140 Ga0105237_10459983 3300009545 Unclassified 1278
141 Ga0105238_10008938 3300009551 Bacteria 10026
142 Ga0105238_10011342 3300009551 Bacteria 8967
143 Ga0105238_10021185 3300009551 Bacteria 6625
144 Ga0105238_10161281 3300009551 Unclassified 2218
145 Ga0105249_10040800 3300009553 Bacteria 4217
146 Ga0105239_10033718 3300010375 Bacteria 5621
147 Ga0105239_10083984 3300010375 Bacteria 3507
148 Ga0157373_10061342 3300013100 Bacteria 2663
149 Ga0157369_10033364 3300013105 Bacteria 5658
150 Ga0157369_10090060 3300013105 Unclassified 3275
151 Ga0157374_10029312 3300013296 Bacteria 4982
152 Ga0157374_10101882 3300013296 Bacteria 2753
153 Ga0157378_10086017 3300013297 Bacteria 2849
154 Ga0157378_10144624 3300013297 Unclassified 2211
155 Ga0157378_10147608 3300013297 Unclassified 2189
156 Ga0157378_10193374 3300013297 Bacteria 1920
157 Ga0157378_10277132 3300013297 Bacteria 1615
158 Ga0163162_10001094 3300013306 Bacteria 25125
159 Ga0163162_10019602 3300013306 Bacteria 6639
160 Ga0163162_10201374 3300013306 Bacteria 2120
161 Ga0163162_10436589 3300013306 Unclassified 1441
162 Ga0157372_10040366 3300013307 Bacteria 5155
163 Ga0157372_10131300 3300013307 Bacteria 2882
164 Ga0157372_10201446 3300013307 Unclassified 2306
165 Ga0157375_10004985 3300013308 Bacteria 11546
166 Ga0157375_10032872 3300013308 Plasmid 4924
167 Ga0157375_10542802 3300013308 Bacteria 1325
168 Ga0157375_10590944 3300013308 Unclassified 1270
169 Ga0163163_10003772 3300014325 Bacteria 12909
170 Ga0163163_10011523 3300014325 Bacteria 8028
171 Ga0163163_10013233 3300014325 Bacteria 7545
172 Ga0163163_10022817 3300014325 Bacteria 5932
173 Ga0163163_10074695 3300014325 Bacteria 3382
174 Ga0163163_10110787 3300014325 Unclassified 2773
175 Ga0163163_10156644 3300014325 Bacteria 2322
176 Ga0157380_10036048 3300014326 Bacteria 3825
177 Ga0157377_10110992 3300014745 Bacteria 1648
178 Ga0157379_10018352 3300014968 Bacteria 6167
179 Ga0157379_10196713 3300014968 Bacteria 1822
180 Ga0157376_10017858 3300014969 Bacteria 5423
181 Ga0157376_10196894 3300014969 Bacteria 1851
182 Ga0213876_10000033 3300021384 Bacteria 205318
183 Ga0207656_10012796 3300025321 Unclassified 3194
184 Ga0207653_10000038 3300025885 Bacteria 98555
185 Ga0207642_10007634 3300025899 Bacteria 3662
186 Ga0207680_10002974 3300025903 Bacteria 7949
187 Ga0207680_10081498 3300025903 Bacteria 2034
188 Ga0207680_10183452 3300025903 Bacteria 1417
189 Ga0207647_10004626 3300025904 Bacteria 10193
190 Ga0207684_10001025 3300025910 Bacteria 31367
191 Ga0207684_10011972 3300025910 Bacteria 7554
192 Ga0207654_10099927 3300025911 Unclassified 1786
193 Ga0207707_10033670 3300025912 Bacteria 4484
194 Ga0207707_10040800 3300025912 Unclassified 4053
195 Ga0207707_10054673 3300025912 Bacteria 3475
196 Ga0207695_10041682 3300025913 Bacteria 4913
197 Ga0207695_10263203 3300025913 Unclassified 1622
198 Ga0207671_10237465 3300025914 Unclassified 1431
199 Ga0207671_10240453 3300025914 Bacteria 1422
200 Ga0207671_10302100 3300025914 Unclassified 1264
201 Ga0207671_10322594 3300025914 Bacteria 1222
202 Ga0207693_10112012 3300025915 Unclassified 2140
203 Ga0207693_10163196 3300025915 Bacteria 1753
204 Ga0207693_10382209 3300025915 Unclassified 1101
205 Ga0207663_10023153 3300025916 Bacteria 3560
206 Ga0207660_10075434 3300025917 Unclassified 2464
207 Ga0207657_10027403 3300025919 Bacteria 5219
208 Ga0207652_10044589 3300025921 Bacteria 3778
209 Ga0207652_10062882 3300025921 Unclassified 3208
210 Ga0207652_10067786 3300025921 Unclassified 3095
211 Ga0207652_10312144 3300025921 Bacteria 1419
212 Ga0207646_10288003 3300025922 Bacteria 1484
213 Ga0207681_10151197 3300025923 Unclassified 1740
214 Ga0207694_10002484 3300025924 Bacteria 14999
215 Ga0207694_10012217 3300025924 Bacteria 6474
216 Ga0207650_10002795 3300025925 Bacteria 12056
217 Ga0207659_10001663 3300025926 Bacteria 13197
218 Ga0207687_10001325 3300025927 Bacteria 16931
219 Ga0207687_10004930 3300025927 Bacteria 8863
220 Ga0207687_10043430 3300025927 Bacteria 3097
221 Ga0207687_10191008 3300025927 Bacteria 1594
222 Ga0207687_10314417 3300025927 Bacteria 1266
223 Ga0207687_10348642 3300025927 Bacteria 1206
224 Ga0207700_10006071 3300025928 Bacteria 7276
225 Ga0207700_10049977 3300025928 Unclassified 3113
226 Ga0207700_10077314 3300025928 Bacteria 2585
227 Ga0207700_10132055 3300025928 Unclassified 2040
228 Ga0207700_10141548 3300025928 Bacteria 1977
229 Ga0207664_10267996 3300025929 Bacteria 1495
230 Ga0207644_10037194 3300025931 Unclassified 3423
231 Ga0207644_10044764 3300025931 Bacteria 3146
232 Ga0207644_10189630 3300025931 Unclassified 1616
233 Ga0207706_10029899 3300025933 Bacteria 4862
234 Ga0207706_10098805 3300025933 Bacteria 2568
235 Ga0207686_10023767 3300025934 Unclassified 3542
236 Ga0207686_10084531 3300025934 Bacteria 2079
237 Ga0207686_10114502 3300025934 Unclassified 1825
238 Ga0207709_10088803 3300025935 Unclassified 2014
239 Ga0207665_10016167 3300025939 Bacteria 4899
240 Ga0207691_10006866 3300025940 Bacteria 10983
241 Ga0207711_10001325 3300025941 Bacteria 23414
242 Ga0207711_10039699 3300025941 Plasmid 4004
243 Ga0207711_10079603 3300025941 Bacteria 2860
244 Ga0207661_10013480 3300025944 Bacteria 5972
245 Ga0207661_10245013 3300025944 Bacteria 1591
246 Ga0207679_10052388 3300025945 Bacteria 2993
247 Ga0207667_10225783 3300025949 Unclassified 1918
248 Ga0207667_10226258 3300025949 Bacteria 1916
249 Ga0207667_10384792 3300025949 Bacteria 1429
250 Ga0207651_10005610 3300025960 Bacteria 6464
251 Ga0207640_10062128 3300025981 Bacteria 2477
252 Ga0207658_10052275 3300025986 Unclassified 3014
253 Ga0207658_10104724 3300025986 Bacteria 2224
254 Ga0207658_10200112 3300025986 Unclassified 1667
255 Ga0207677_10011359 3300026023 Bacteria 5074
256 Ga0207677_10030721 3300026023 Bacteria 3432
257 Ga0207703_10023874 3300026035 Bacteria 4809
258 Ga0207639_10058166 3300026041 Unclassified 2972
259 Ga0207639_10132812 3300026041 Unclassified 2063
260 Ga0207702_10250131 3300026078 Bacteria 1664
261 Ga0207641_10001306 3300026088 Bacteria 24684
262 Ga0207641_10021107 3300026088 Bacteria 5353
263 Ga0207641_10033504 3300026088 Unclassified 4267
264 Ga0207641_10066676 3300026088 Bacteria 3081
265 Ga0207641_10095129 3300026088 Plasmid 2614
266 Ga0207648_10036943 3300026089 Plasmid 4303
267 Ga0207676_10008842 3300026095 Bacteria 7165
268 Ga0207676_10017363 3300026095 Bacteria 5214
269 Ga0207676_10074949 3300026095 Bacteria 2728
270 Ga0207676_10319097 3300026095 Bacteria 1425
271 Ga0207674_10000113 3300026116 Bacteria 93918
272 Ga0207674_10010568 3300026116 Bacteria 10446
273 Ga0207674_10010571 3300026116 Bacteria 10443
274 Ga0207674_10373215 3300026116 Unclassified 1379
275 Ga0207683_10172970 3300026121 Bacteria 1957
276 Ga0207698_10030995 3300026142 Bacteria 3855
277 Ga0268266_10034186 3300028379 Unclassified 4322
278 Ga0268265_10097209 3300028380 Unclassified 2369
279 Ga0268264_10200713 3300028381 Bacteria 1824
280 Ga0265320_10031688 3300031240 Bacteria 2713
281 Ga0265340_10026762 3300031247 Bacteria 2913
282 Ga0265331_10011758 3300031250 Bacteria 4781
283 Ga0265314_10000033 3300031711 Bacteria 254594
284 Ga0265314_10002269 3300031711 Bacteria 19910
285 Ga0265342_10043621 3300031712 Bacteria 2705
286 Ga0373926_0000139 3300035083 Bacteria 15347
287 Ga0373926_0067687 3300035083 Bacteria 1308
288 Ga0373923_0022204 3300035111 Bacteria 2485
289 Ga0373936_0005697 3300035113 Unclassified 4700
290 Ga0373945_0004185 3300035116 Bacteria 4579
291 Ga0373956_0035622 3300035119 Unclassified 2195
292 Ga0373957_0085694 3300035120 Bacteria 1247
293 Ga0373943_0000850 3300035170 Bacteria 13486
294 Ga0373946_0013816 3300035171 Unclassified 3039
295 Ga0373924_0000295 3300035410 Bacteria 15392
296 Ga0373935_0002807 3300035692 Bacteria 10024
297 Ga0373935_0005114 3300035692 Bacteria 7723
298 Ga0373935_0064532 3300035692 Bacteria 2348
299 Ga0373927_0001364 3300035695 Bacteria 18398
300 Ga0373927_0021105 3300035695 Bacteria 4269
301 Ga0373927_0027632 3300035695 Bacteria 3704
302 Ga0373933_0105200 3300035724 Bacteria 1755
303 Ga0373947_0009519 3300035725 Bacteria 5579
304 Ga0373947_0024844 3300035725 Bacteria 3494
305 Ga0373947_0043848 3300035725 Bacteria 2672
306 Ga0373937_0001106 3300036401 Bacteria 22707
307 Ga0373937_0007314 3300036401 Bacteria 9556
308 Ga0373937_0033863 3300036401 Bacteria 4644
309 Ga0373937_0100045 3300036401 Bacteria 2690
310 Ga0373937_0159013 3300036401 Bacteria 2118
311 Ga0373925_0021777 3300037068 Bacteria 4672
312 Ga0373925_0028276 3300037068 Bacteria 4107
313 Ga0373925_0086358 3300037068 Bacteria 2393
314 Ga0395900_0329540 3300037418 Bacteria 1505
315 Ga0395905_0241162 3300037471 Bacteria 1689
316 Ga0436365_0198252 3300039437 Bacteria 179679
317 Ga0466966_0132901 3300044684 Bacteria 1523
318 Ga0495592_0033515 3300046454 Bacteria 3873
319 Ga0495582_0055235 3300046473 Bacteria 2189
320 Ga0495639_0104785 3300046475 Bacteria 1338
321 Ga0495608_0151681 3300046511 Bacteria 1477
322 Ga0495628_0035062 3300046516 Bacteria 4035
323 Ga0495630_0246127 3300046517 Bacteria 1366
324 Ga0495665_0013111 3300046531 Bacteria 4487
325 Ga0495586_0023354 3300046535 Bacteria 3303
326 Ga0495667_0001815 3300046559 Bacteria 14175
327 Ga0495657_0003881 3300046675 Bacteria 12044
328 Ga0495623_0008539 3300046679 Bacteria 6653
329 Ga0495658_0030962 3300046683 Bacteria 2910
330 Ga0495674_0149505 3300047319 Bacteria 1959
331 Ga0495675_0256892 3300047444 Bacteria 1048
332 Ga0496102_0353091 3300048905 Unclassified 1384
333 Ga0496104_0215168 3300048907 Bacteria 1833
334 Ga0496105_0013407 3300048908 Bacteria 6505
335 Ga0496106_0486905 3300048909 Unclassified 991
336 Ga0496113_0000908 3300048916 Bacteria 15640
337 Ga0496113_0404956 3300048916 Unclassified 1095
338 Ga0501033_0144356 3300049570 Unclassified 1720
339 Ga0501034_0050034 3300049571 Bacteria 4216
340 Ga0501038_0125497 3300049574 Bacteria 2113
341 Ga0501035_0030395 3300049822 Bacteria 4924
342 nmdc:mga05p37_341912_c1 3300050507 Bacteria 1764
343 nmdc:mga08y16_25272_c1 3300050511 Bacteria 6262
344 nmdc:mga08x19_240072_c1 3300050514 Bacteria 1249
345 nmdc:mga08x19_276057_c1 3300050514 Unclassified 1164
346 nmdc:mga08x19_72813_c1 3300050514 Bacteria 2242
347 nmdc:mga0a205_260514_c1 3300050515 Bacteria 1612
348 Ga0207687_10024152
349 rootL2_10000941
350 Ga0065707_10002433
351 Ga0070683_100067056
352 Ga0070683_100302737
353 Ga0070683_100385596
354 Ga0070670_100004103
355 Ga0068869_100058480
356 Ga0070666_10016625
357 Ga0070666_10042526
358 Ga0068868_100029506
359 Ga0070660_100015659
360 Ga0070660_100225998
361 Ga0070689_100128267
362 Ga0070661_100088743
363 Ga0070668_100049852
364 Ga0070669_100035164
365 Ga0070671_100093162
366 Ga0070674_100027690
367 Ga0070674_100042060
368 Ga0070673_100012117
369 Ga0070673_100122909
370 Ga0070659_100106266
371 Ga0070667_100003599
372 Ga0070667_100009188
373 Ga0070667_100104933
374 Ga0070667_100427418
375 Ga0070703_10000039
376 Ga0070709_10112155
377 Ga0070713_100116457
378 Ga0070713_100251007
379 Ga0070701_10109586
380 Ga0070711_100012960
381 Ga0070711_100177539
382 Ga0070705_100000474
383 Ga0070705_100067028
384 Ga0070694_100303618
385 Ga0070678_100095036
386 Ga0070662_100087458
387 Ga0070681_10000469
388 Ga0070681_10149869
389 Ga0068867_100015374
390 Ga0070706_100000174
391 Ga0070706_100005902
392 Ga0070707_100050909
393 Ga0070698_100013482
394 Ga0070699_100004411
395 Ga0070699_100004434
396 Ga0070679_100019690
397 Ga0070679_100034092
398 Ga0070679_100064740
399 Ga0070697_100020499
400 Ga0070697_100081553
401 Ga0068853_100002771
402 Ga0068853_100106659
403 Ga0068853_100132058
404 Ga0070672_100005952
405 Ga0070696_100000111
406 Ga0070696_100008745
407 Ga0070693_100151740
408 Ga0070693_100220797
409 Ga0070665_100007845
410 Ga0068855_100100555
411 Ga0068855_100285282
412 Ga0068855_100342557
413 Ga0070664_100001849
414 Ga0070664_100003382
415 Ga0070664_100004032
416 Ga0070664_100053019
417 Ga0070664_100378359
418 Ga0068857_100042997
419 Ga0068857_100051685
420 Ga0068857_100357581
421 Ga0068856_100099250
422 Ga0068852_100015608
423 Ga0068859_100002570
424 Ga0068859_100067275
425 Ga0068859_100281348
426 Ga0068859_100421906
427 Ga0068864_100005346
428 Ga0068864_100008115
429 Ga0068864_100022905
430 Ga0068866_10044304
431 Ga0068851_10000736
432 Ga0068851_10073226
433 Ga0068863_100001279
434 Ga0068863_100018963
435 Ga0068863_100090019
436 Ga0068858_100066612
437 Ga0068858_100084568
438 Ga0068858_100093134
439 Ga0068860_100011774
440 Ga0068860_100034633
441 Ga0068862_100129492
442 Ga0070712_100122128
443 Ga0070712_100211661
444 Ga0097621_100012858
445 Ga0097621_100017099
446 Ga0097621_100075278
447 Ga0097621_100078729
448 Ga0097621_100109697
449 Ga0068871_100010415
450 Ga0068871_100017895
451 Ga0068871_100027768
452 Ga0068871_100205782
453 Ga0075428_100141434
454 Ga0075434_100453431
455 Ga0075436_100076541
456 Ga0075436_100119337
457 Ga0097620_100002570
458 Ga0097620_100067270
459 Ga0097620_100281352
460 Ga0097620_100421884
461 Ga0105240_10023241
462 Ga0105240_10130593
463 Ga0105240_10132072
464 Ga0111539_10593774
465 Ga0105245_10002077
466 Ga0105245_10003891
467 Ga0105245_10034005
468 Ga0105245_10127231
469 Ga0105245_10157080
470 Ga0105247_10044993
471 Ga0114129_10062366
472 Ga0114129_10065776
473 Ga0114129_10107747
474 Ga0105243_10068106
475 Ga0105241_10010601
476 Ga0105241_10237367
477 Ga0105242_10014658
478 Ga0105242_10091142
479 Ga0105242_10114982
480 Ga0105248_10007774
481 Ga0105248_10011879
482 Ga0105248_10028354
483 Ga0105237_10089900
484 Ga0105237_10125686
485 Ga0105237_10201135
486 Ga0105237_10410662
487 Ga0105237_10459983
488 Ga0105238_10008938
489 Ga0105238_10011342
490 Ga0105238_10021185
491 Ga0105238_10161281
492 Ga0105249_10040800
493 Ga0105239_10033718
494 Ga0105239_10083984
495 Ga0157373_10061342
496 Ga0157369_10033364
497 Ga0157369_10090060
498 Ga0157374_10029312
499 Ga0157374_10101882
500 Ga0157378_10086017
501 Ga0157378_10144624
502 Ga0157378_10147608
503 Ga0157378_10193374
504 Ga0157378_10277132
505 Ga0163162_10001094
506 Ga0163162_10019602
507 Ga0163162_10201374
508 Ga0163162_10436589
509 Ga0157372_10040366
510 Ga0157372_10131300
511 Ga0157372_10201446
512 Ga0157375_10004985
513 Ga0157375_10032872
514 Ga0157375_10542802
515 Ga0157375_10590944
516 Ga0163163_10003772
517 Ga0163163_10011523
518 Ga0163163_10013233
519 Ga0163163_10022817
520 Ga0163163_10074695
521 Ga0163163_10110787
522 Ga0163163_10156644
523 Ga0157380_10036048
524 Ga0157377_10110992
525 Ga0157379_10018352
526 Ga0157379_10196713
527 Ga0157376_10017858
528 Ga0157376_10196894
529 Ga0213876_10000033
530 Ga0207656_10012796
531 Ga0207653_10000038
532 Ga0207642_10007634
533 Ga0207680_10002974
534 Ga0207680_10081498
535 Ga0207680_10183452
536 Ga0207647_10004626
537 Ga0207684_10001025
538 Ga0207684_10011972
539 Ga0207654_10099927
540 Ga0207707_10033670
541 Ga0207707_10040800
542 Ga0207707_10054673
543 Ga0207695_10041682
544 Ga0207695_10263203
545 Ga0207671_10237465
546 Ga0207671_10240453
547 Ga0207671_10302100
548 Ga0207671_10322594
549 Ga0207693_10112012
550 Ga0207693_10163196
551 Ga0207693_10382209
552 Ga0207663_10023153
553 Ga0207660_10075434
554 Ga0207657_10027403
555 Ga0207652_10044589
556 Ga0207652_10062882
557 Ga0207652_10067786
558 Ga0207652_10312144
559 Ga0207646_10288003
560 Ga0207681_10151197
561 Ga0207694_10002484
562 Ga0207694_10012217
563 Ga0207650_10002795
564 Ga0207659_10001663
565 Ga0207687_10001325
566 Ga0207687_10004930
567 Ga0207687_10043430
568 Ga0207687_10191008
569 Ga0207687_10314417
570 Ga0207687_10348642
571 Ga0207700_10006071
572 Ga0207700_10049977
573 Ga0207700_10077314
574 Ga0207700_10132055
575 Ga0207700_10141548
576 Ga0207664_10267996
577 Ga0207644_10037194
578 Ga0207644_10044764
579 Ga0207644_10189630
580 Ga0207706_10029899
581 Ga0207706_10098805
582 Ga0207686_10023767
583 Ga0207686_10084531
584 Ga0207686_10114502
585 Ga0207709_10088803
586 Ga0207665_10016167
587 Ga0207691_10006866
588 Ga0207711_10001325
589 Ga0207711_10039699
590 Ga0207711_10079603
591 Ga0207661_10013480
592 Ga0207661_10245013
593 Ga0207679_10052388
594 Ga0207667_10225783
595 Ga0207667_10226258
596 Ga0207667_10384792
597 Ga0207651_10005610
598 Ga0207640_10062128
599 Ga0207658_10052275
600 Ga0207658_10104724
601 Ga0207658_10200112
602 Ga0207677_10011359
603 Ga0207677_10030721
604 Ga0207703_10023874
605 Ga0207639_10058166
606 Ga0207639_10132812
607 Ga0207702_10250131
608 Ga0207641_10001306
609 Ga0207641_10021107
610 Ga0207641_10033504
611 Ga0207641_10066676
612 Ga0207641_10095129
613 Ga0207648_10036943
614 Ga0207676_10008842
615 Ga0207676_10017363
616 Ga0207676_10074949
617 Ga0207676_10319097
618 Ga0207674_10000113
619 Ga0207674_10010568
620 Ga0207674_10010571
621 Ga0207674_10373215
622 Ga0207683_10172970
623 Ga0207698_10030995
624 Ga0268266_10034186
625 Ga0268265_10097209
626 Ga0268264_10200713
627 Ga0265320_10031688
628 Ga0265340_10026762
629 Ga0265331_10011758
630 Ga0265314_10000033
631 Ga0265314_10002269
632 Ga0265342_10043621
633 Ga0373926_0000139
634 Ga0373926_0067687
635 Ga0373923_0022204
636 Ga0373936_0005697
637 Ga0373945_0004185
638 Ga0373956_0035622
639 Ga0373957_0085694
640 Ga0373943_0000850
641 Ga0373946_0013816
642 Ga0373924_0000295
643 Ga0373935_0002807
644 Ga0373935_0005114
645 Ga0373935_0064532
646 Ga0373927_0001364
647 Ga0373927_0021105
648 Ga0373927_0027632
649 Ga0373933_0105200
650 Ga0373947_0009519
651 Ga0373947_0024844
652 Ga0373947_0043848
653 Ga0373937_0001106
654 Ga0373937_0007314
655 Ga0373937_0033863
656 Ga0373937_0100045
657 Ga0373937_0159013
658 Ga0373925_0021777
659 Ga0373925_0028276
660 Ga0373925_0086358
661 Ga0395900_0329540
662 Ga0395905_0241162
663 Ga0436365_0198252
664 Ga0466966_0132901
665 Ga0495592_0033515
666 Ga0495582_0055235
667 Ga0495639_0104785
668 Ga0495608_0151681
669 Ga0495628_0035062
670 Ga0495630_0246127
671 Ga0495665_0013111
672 Ga0495586_0023354
673 Ga0495667_0001815
674 Ga0495657_0003881
675 Ga0495623_0008539
676 Ga0495658_0030962
677 Ga0495674_0149505
678 Ga0495675_0256892
679 Ga0496102_0353091
680 Ga0496104_0215168
681 Ga0496105_0013407
682 Ga0496106_0486905
683 Ga0496113_0000908
684 Ga0496113_0404956
685 Ga0501033_0144356
686 Ga0501034_0050034
687 Ga0501038_0125497
688 Ga0501035_0030395
689 nmdc:mga05p37_341912_c1
690 nmdc:mga08y16_25272_c1
691 nmdc:mga08x19_240072_c1
692 nmdc:mga08x19_276057_c1
693 nmdc:mga08x19_72813_c1
694 nmdc:mga0a205_260514_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

282

361

0.98

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

321

360

0.95

PF12852

Cupin_6

Cupin

49

244

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9525 214 320
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9194 214 308
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9186 214 314
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9078 215 315
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.9073 210 314
ID Description Score Start End Superfamily
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9909 268 315 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9877 272 314 1.10.10.60
1bl0A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.96 272 314 1.10.10.60
3w6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9525 214 320 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9523 272 314 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A172TL64-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9848 214 316 GO:0003700
GO:0006281
GO:0008168
GO:0008270
GO:0032259
GO:0043565
AF-A0A2W4NK05-F1-model_v4 deleted 0.9833 214 314
AF-X6H9K4-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9699 214 314 GO:0003700
GO:0043565
AF-A0A7R7EJ50-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9683 216 322 GO:0003700
GO:0043565
AF-A0A2J5NU19-F1-model_v4 Arabinose operon transcriptional regulator AraC 0.9665 214 322 GO:0003700
GO:0043565

Map