F416817

General Info

Members Datasets Scaffolds Average Seq Length
346 142 692 167

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10125756|Ga0307412_101257562
Length 183
Sequence MAGPMSGATNGTPAVRGPLIVTAMLADTEQAWFDRLRKAHYPPERNHVPAHLTLFHAVPHMLEDELRRRLAALAAELPPPRAEVVGLMNLGGGVAYRIASNDLNSIRAELADAFRGVLTQQDSHGWRPHITIQNKVTAVEARALGEMLERSFTPRPLRLTGLAYDHYAGGSWLPGRRYPFRGG

Samples

Sample ID Description Type Environment
1 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
113 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
116 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
117 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.2
Rhizosphere 94.51
Stem 0
Stem Tuber 0
Unclassified 9.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307412_10125756 3300031911 Bacteria 1854
2 JGI24740J21852_10030684 3300001979 Bacteria 1744
3 JGI24739J22299_10005805 3300001989 Bacteria 4675
4 JGI24737J22298_10010004 3300001990 Bacteria 3140
5 JGI24737J22298_10174685 3300001990 Unclassified 634
6 JGI24735J21928_10015998 3300002067 Bacteria 2334
7 JGI24738J21930_10049681 3300002075 Bacteria 854
8 rootH2_10142943 3300003320 Bacteria 1057
9 Ga0070658_10045424 3300005327 Bacteria 3552
10 Ga0070658_10278413 3300005327 Bacteria 1424
11 Ga0070676_10261179 3300005328 Bacteria 1160
12 Ga0070683_100385011 3300005329 Bacteria 1336
13 Ga0070690_101103804 3300005330 Bacteria 629
14 Ga0070670_100080167 3300005331 Bacteria 2806
15 Ga0070670_100174427 3300005331 Bacteria 1866
16 Ga0070677_10002720 3300005333 Bacteria 5654
17 Ga0070666_10033267 3300005335 Bacteria 3410
18 Ga0070666_10091692 3300005335 Bacteria 2088
19 Ga0070680_100002079 3300005336 Bacteria 14778
20 Ga0070680_100721851 3300005336 Bacteria 858
21 Ga0070680_100758551 3300005336 Bacteria 835
22 Ga0070682_100026840 3300005337 Bacteria 3450
23 Ga0070682_100195381 3300005337 Bacteria 1424
24 Ga0068868_100624263 3300005338 Bacteria 957
25 Ga0070660_100013561 3300005339 Bacteria 5851
26 Ga0070660_100095511 3300005339 Bacteria 2350
27 Ga0070660_100247824 3300005339 Unclassified 1452
28 Ga0070660_100313691 3300005339 Bacteria 1287
29 Ga0070660_100726238 3300005339 Bacteria 833
30 Ga0070661_100010633 3300005344 Bacteria 6404
31 Ga0070661_100231075 3300005344 Unclassified 1421
32 Ga0070661_100368425 3300005344 Unclassified 1130
33 Ga0070661_100425199 3300005344 Bacteria 1053
34 Ga0070661_100807002 3300005344 Unclassified 770
35 Ga0070661_100921887 3300005344 Bacteria 722
36 Ga0070668_100044438 3300005347 Bacteria 3408
37 Ga0070669_100036563 3300005353 Bacteria 3559
38 Ga0070669_100079814 3300005353 Bacteria 2434
39 Ga0070669_100183055 3300005353 Bacteria 1640
40 Ga0070675_100647407 3300005354 Bacteria 960
41 Ga0070671_100000327 3300005355 Bacteria 32467
42 Ga0070671_100066838 3300005355 Bacteria 2996
43 Ga0070671_100520780 3300005355 Bacteria 1024
44 Ga0070671_101071852 3300005355 Unclassified 707
45 Ga0070674_100170035 3300005356 Bacteria 1661
46 Ga0070673_100101890 3300005364 Bacteria 2366
47 Ga0070673_100195940 3300005364 Bacteria 1738
48 Ga0070673_100425078 3300005364 Bacteria 1192
49 Ga0070659_100010316 3300005366 Bacteria 6870
50 Ga0070659_100022343 3300005366 Bacteria 4829
51 Ga0070659_100394365 3300005366 Bacteria 1168
52 Ga0070667_100011634 3300005367 Bacteria 7274
53 Ga0070667_100114584 3300005367 Bacteria 2341
54 Ga0070663_100011257 3300005455 Bacteria 5608
55 Ga0070663_100129360 3300005455 Bacteria 1916
56 Ga0070662_100019637 3300005457 Bacteria 4590
57 Ga0070662_100026971 3300005457 Bacteria 3983
58 Ga0070662_100068929 3300005457 Bacteria 2602
59 Ga0070662_100297154 3300005457 Bacteria 1311
60 Ga0070662_100300758 3300005457 Bacteria 1303
61 Ga0070662_100351415 3300005457 Unclassified 1208
62 Ga0070662_100491994 3300005457 Unclassified 1022
63 Ga0070681_10008482 3300005458 Bacteria 10061
64 Ga0070681_10040881 3300005458 Bacteria 4645
65 Ga0070681_10668792 3300005458 Bacteria 953
66 Ga0070679_100812039 3300005530 Unclassified 878
67 Ga0070679_101104230 3300005530 Bacteria 738
68 Ga0070684_100529230 3300005535 Bacteria 1093
69 Ga0068853_100008039 3300005539 Bacteria 8459
70 Ga0068853_100301726 3300005539 Bacteria 1480
71 Ga0068853_100356054 3300005539 Unclassified 1362
72 Ga0068853_100364703 3300005539 Bacteria 1346
73 Ga0070693_100072385 3300005547 Bacteria 2033
74 Ga0070693_100144930 3300005547 Bacteria 1499
75 Ga0070693_100197112 3300005547 Bacteria 1306
76 Ga0070665_100160994 3300005548 Bacteria 2247
77 Ga0070665_100262817 3300005548 Bacteria 1727
78 Ga0070665_100497213 3300005548 Bacteria 1231
79 Ga0068855_100002714 3300005563 Bacteria 21825
80 Ga0068855_100064273 3300005563 Bacteria 4280
81 Ga0068855_100230074 3300005563 Bacteria 2076
82 Ga0068855_100555342 3300005563 Bacteria 1242
83 Ga0070664_100003974 3300005564 Bacteria 11892
84 Ga0070664_100019192 3300005564 Bacteria 5623
85 Ga0070664_100031967 3300005564 Bacteria 4402
86 Ga0070664_100177884 3300005564 Bacteria 1890
87 Ga0070664_100343595 3300005564 Bacteria 1356
88 Ga0070664_100717509 3300005564 Unclassified 932
89 Ga0070664_100823749 3300005564 Unclassified 868
90 Ga0068857_100028653 3300005577 Bacteria 4914
91 Ga0068857_100124818 3300005577 Bacteria 2319
92 Ga0068857_100194813 3300005577 Bacteria 1846
93 Ga0068854_100207119 3300005578 Bacteria 1545
94 Ga0068854_100375949 3300005578 Bacteria 1169
95 Ga0068854_100674885 3300005578 Bacteria 889
96 Ga0068856_100497036 3300005614 Bacteria 1241
97 Ga0068856_100557234 3300005614 Bacteria 1167
98 Ga0068856_101085114 3300005614 Bacteria 818
99 Ga0068852_100024321 3300005616 Bacteria 4894
100 Ga0068852_100122656 3300005616 Bacteria 2382
101 Ga0068852_100394372 3300005616 Bacteria 1360
102 Ga0068852_100799393 3300005616 Archaea 957
103 Ga0068852_101349888 3300005616 Bacteria 735
104 Ga0068859_102312065 3300005617 Bacteria 593
105 Ga0068864_100002590 3300005618 Bacteria 14935
106 Ga0068861_100778095 3300005719 Unclassified 896
107 Ga0068851_10019349 3300005834 Bacteria 3289
108 Ga0068851_10174185 3300005834 Bacteria 1189
109 Ga0068851_10269075 3300005834 Unclassified 971
110 Ga0068870_10102328 3300005840 Bacteria 1621
111 Ga0068863_100075911 3300005841 Bacteria 3180
112 Ga0068860_100263954 3300005843 Bacteria 1679
113 Ga0068862_100600123 3300005844 Bacteria 1057
114 Ga0081539_10037296 3300005985 Bacteria 2897
115 Ga0097620_100052320 3300006931 Bacteria 4105
116 Ga0097620_102312174 3300006931 Bacteria 593
117 Ga0105241_10148809 3300009174 Bacteria 1913
118 Ga0105248_10000135 3300009177 Bacteria 85668
119 Ga0105248_10038616 3300009177 Bacteria 5344
120 Ga0105249_10067125 3300009553 Bacteria 3304
121 Ga0157373_10030435 3300013100 Bacteria 3885
122 Ga0157373_10069205 3300013100 Bacteria 2495
123 Ga0157371_10039590 3300013102 Bacteria 3371
124 Ga0157371_10127694 3300013102 Bacteria 1808
125 Ga0157371_10170416 3300013102 Bacteria 1555
126 Ga0157370_10491121 3300013104 Bacteria 1128
127 Ga0157370_10530217 3300013104 Bacteria 1080
128 Ga0157369_10041234 3300013105 Bacteria 5039
129 Ga0157369_10332388 3300013105 Bacteria 1579
130 Ga0157369_10458894 3300013105 Bacteria 1319
131 Ga0157374_10087166 3300013296 Bacteria 2971
132 Ga0157374_10868367 3300013296 Bacteria 919
133 Ga0163162_10071230 3300013306 Bacteria 3529
134 Ga0157372_10018941 3300013307 Bacteria 7408
135 Ga0157372_10374222 3300013307 Bacteria 1660
136 Ga0163163_10000459 3300014325 Bacteria 37223
137 Ga0206354_11199573 3300020081 Bacteria 721
138 Ga0206353_10756230 3300020082 Bacteria 811
139 Ga0207656_10135711 3300025321 Bacteria 1156
140 Ga0207656_10196776 3300025321 Unclassified 972
141 Ga0207656_10321958 3300025321 Bacteria 768
142 Ga0207682_10002864 3300025893 Bacteria 7616
143 Ga0207682_10060382 3300025893 Bacteria 1586
144 Ga0207645_10009921 3300025907 Bacteria 6560
145 Ga0207705_10015251 3300025909 Bacteria 5518
146 Ga0207705_10015410 3300025909 Bacteria 5485
147 Ga0207705_10044712 3300025909 Bacteria 3182
148 Ga0207705_10052044 3300025909 Bacteria 2947
149 Ga0207705_10213869 3300025909 Bacteria 1462
150 Ga0207705_10223171 3300025909 Bacteria 1432
151 Ga0207707_10013879 3300025912 Bacteria 7025
152 Ga0207660_10022859 3300025917 Bacteria 4215
153 Ga0207660_10247233 3300025917 Bacteria 1407
154 Ga0207657_10001281 3300025919 Bacteria 26752
155 Ga0207657_10010639 3300025919 Bacteria 9164
156 Ga0207657_10011597 3300025919 Bacteria 8743
157 Ga0207657_10020796 3300025919 Bacteria 6193
158 Ga0207657_10023236 3300025919 Bacteria 5778
159 Ga0207657_10235055 3300025919 Unclassified 1465
160 Ga0207649_10028668 3300025920 Bacteria 3279
161 Ga0207649_10079308 3300025920 Bacteria 2121
162 Ga0207649_10089887 3300025920 Bacteria 2008
163 Ga0207649_10727644 3300025920 Unclassified 771
164 Ga0207652_10034293 3300025921 Bacteria 4276
165 Ga0207652_10453298 3300025921 Bacteria 1156
166 Ga0207652_10681276 3300025921 Unclassified 918
167 Ga0207650_10186481 3300025925 Bacteria 1655
168 Ga0207659_10221855 3300025926 Bacteria 1520
169 Ga0207644_10005036 3300025931 Bacteria 8627
170 Ga0207690_10004902 3300025932 Bacteria 7895
171 Ga0207690_10057248 3300025932 Bacteria 2633
172 Ga0207690_10083214 3300025932 Bacteria 2240
173 Ga0207690_10153919 3300025932 Bacteria 1707
174 Ga0207690_10517031 3300025932 Unclassified 967
175 Ga0207706_10010134 3300025933 Bacteria 8625
176 Ga0207706_10057446 3300025933 Bacteria 3428
177 Ga0207706_10066757 3300025933 Bacteria 3166
178 Ga0207706_10351147 3300025933 Bacteria 1282
179 Ga0207669_10444174 3300025937 Unclassified 1026
180 Ga0207711_10003334 3300025941 Bacteria 13924
181 Ga0207661_10156855 3300025944 Bacteria 1972
182 Ga0207661_10578493 3300025944 Bacteria 1030
183 Ga0207679_10005172 3300025945 Bacteria 8172
184 Ga0207679_10133312 3300025945 Bacteria 1996
185 Ga0207679_10291001 3300025945 Unclassified 1404
186 Ga0207679_10680191 3300025945 Unclassified 933
187 Ga0207679_11523429 3300025945 Unclassified 613
188 Ga0207667_10030303 3300025949 Bacteria 5855
189 Ga0207667_10396498 3300025949 Bacteria 1405
190 Ga0207667_10431463 3300025949 Unclassified 1340
191 Ga0207651_10076853 3300025960 Bacteria 2388
192 Ga0207651_10368657 3300025960 Bacteria 1214
193 Ga0207651_10631619 3300025960 Bacteria 939
194 Ga0207712_10033341 3300025961 Bacteria 3481
195 Ga0207668_10175814 3300025972 Bacteria 1684
196 Ga0207640_10385182 3300025981 Bacteria 1137
197 Ga0207640_10401640 3300025981 Unclassified 1116
198 Ga0207640_10647092 3300025981 Bacteria 900
199 Ga0207658_10758318 3300025986 Bacteria 879
200 Ga0207639_10010067 3300026041 Bacteria 6540
201 Ga0207678_10001263 3300026067 Bacteria 23372
202 Ga0207678_10008714 3300026067 Bacteria 8931
203 Ga0207678_10170047 3300026067 Bacteria 1861
204 Ga0207702_10000072 3300026078 Bacteria 113840
205 Ga0207702_11359075 3300026078 Bacteria 704
206 Ga0207676_10024474 3300026095 Bacteria 4467
207 Ga0207674_10012119 3300026116 Bacteria 9653
208 Ga0207674_10012140 3300026116 Bacteria 9643
209 Ga0207674_10344904 3300026116 Bacteria 1440
210 Ga0207698_10155907 3300026142 Bacteria 1989
211 Ga0207698_10787501 3300026142 Bacteria 952
212 Ga0268266_10246680 3300028379 Bacteria 1650
213 Ga0268265_10051197 3300028380 Bacteria 3116
214 Ga0268265_10320486 3300028380 Bacteria 1403
215 Ga0307408_100027974 3300031548 Bacteria 3891
216 Ga0307408_100041476 3300031548 Bacteria 3263
217 Ga0307408_100273546 3300031548 Bacteria 1403
218 Ga0307408_100311029 3300031548 Bacteria 1324
219 Ga0307408_100336937 3300031548 Bacteria 1275
220 Ga0307408_100354367 3300031548 Bacteria 1246
221 Ga0307408_101197583 3300031548 Unclassified 708
222 Ga0307405_10009640 3300031731 Bacteria 4960
223 Ga0307405_10014820 3300031731 Bacteria 4204
224 Ga0307405_10033627 3300031731 Bacteria 3043
225 Ga0307405_10063082 3300031731 Bacteria 2349
226 Ga0307405_10105110 3300031731 Bacteria 1901
227 Ga0307405_10150877 3300031731 Bacteria 1634
228 Ga0307405_10194242 3300031731 Bacteria 1468
229 Ga0307413_10006949 3300031824 Bacteria 5212
230 Ga0307413_10008564 3300031824 Bacteria 4840
231 Ga0307413_10082598 3300031824 Bacteria 2064
232 Ga0307413_10191050 3300031824 Bacteria 1470
233 Ga0307413_10486802 3300031824 Bacteria 987
234 Ga0307413_10532407 3300031824 Bacteria 949
235 Ga0307413_11369588 3300031824 Unclassified 621
236 Ga0307410_10004700 3300031852 Bacteria 7103
237 Ga0307410_10004837 3300031852 Bacteria 7037
238 Ga0307410_10026867 3300031852 Bacteria 3630
239 Ga0307410_10083331 3300031852 Bacteria 2251
240 Ga0307410_10100263 3300031852 Bacteria 2074
241 Ga0307410_10105636 3300031852 Bacteria 2027
242 Ga0307410_10119155 3300031852 Bacteria 1922
243 Ga0307410_10316621 3300031852 Bacteria 1236
244 Ga0307410_10655396 3300031852 Unclassified 881
245 Ga0307410_10855708 3300031852 Bacteria 776
246 Ga0307406_10043921 3300031901 Bacteria 2798
247 Ga0307406_10080321 3300031901 Bacteria 2165
248 Ga0307406_10183469 3300031901 Bacteria 1525
249 Ga0307406_10264149 3300031901 Bacteria 1304
250 Ga0307407_10097872 3300031903 Bacteria 1814
251 Ga0307407_10129506 3300031903 Bacteria 1612
252 Ga0307407_10134214 3300031903 Bacteria 1588
253 Ga0307407_10147608 3300031903 Bacteria 1524
254 Ga0307407_11021697 3300031903 Bacteria 640
255 Ga0307412_10010607 3300031911 Bacteria 5311
256 Ga0307412_10027012 3300031911 Bacteria 3574
257 Ga0307412_10236013 3300031911 Bacteria 1411
258 Ga0307412_10254199 3300031911 Unclassified 1366
259 Ga0307412_10381352 3300031911 Bacteria 1141
260 Ga0307412_10732991 3300031911 Bacteria 851
261 Ga0307409_100000853 3300031995 Bacteria 14062
262 Ga0307409_100008187 3300031995 Bacteria 6324
263 Ga0307409_100100286 3300031995 Bacteria 2400
264 Ga0307409_100100845 3300031995 Bacteria 2394
265 Ga0307409_100106720 3300031995 Bacteria 2338
266 Ga0307409_100245073 3300031995 Bacteria 1634
267 Ga0307409_100257789 3300031995 Bacteria 1598
268 Ga0307409_100260997 3300031995 Bacteria 1590
269 Ga0307409_101258344 3300031995 Bacteria 764
270 Ga0307416_100050261 3300032002 Bacteria 3322
271 Ga0307416_100156160 3300032002 Bacteria 2101
272 Ga0307416_100168013 3300032002 Bacteria 2037
273 Ga0307416_100656178 3300032002 Bacteria 1134
274 Ga0307416_100741055 3300032002 Bacteria 1074
275 Ga0307416_102579101 3300032002 Bacteria 606
276 Ga0307414_10016112 3300032004 Bacteria 4534
277 Ga0307414_10023432 3300032004 Bacteria 3916
278 Ga0307414_10098194 3300032004 Bacteria 2196
279 Ga0307414_10113532 3300032004 Bacteria 2068
280 Ga0307414_10246358 3300032004 Bacteria 1482
281 Ga0307414_10634725 3300032004 Bacteria 961
282 Ga0307414_10688856 3300032004 Bacteria 924
283 Ga0307414_10699650 3300032004 Bacteria 917
284 Ga0307414_11794270 3300032004 Bacteria 572
285 Ga0307411_10011041 3300032005 Bacteria 4851
286 Ga0307411_10045622 3300032005 Bacteria 2820
287 Ga0307411_10181620 3300032005 Bacteria 1597
288 Ga0307411_10589556 3300032005 Bacteria 954
289 Ga0307411_10694686 3300032005 Bacteria 885
290 Ga0307411_10786742 3300032005 Bacteria 836
291 Ga0307415_100012518 3300032126 Bacteria 4908
292 Ga0307415_100069450 3300032126 Bacteria 2470
293 Ga0307415_100077080 3300032126 Bacteria 2365
294 Ga0307415_100219064 3300032126 Bacteria 1524
295 Ga0307415_100234206 3300032126 Bacteria 1481
296 Ga0307415_100863325 3300032126 Unclassified 831
297 Ga0307415_101332023 3300032126 Bacteria 681
298 Ga0395899_0132071 3300037312 Bacteria 1782
299 Ga0395899_0215187 3300037312 Bacteria 1333
300 Ga0395900_0288899 3300037418 Bacteria 1629
301 Ga0395900_0349060 3300037418 Bacteria 1453
302 Ga0395900_0985133 3300037418 Unclassified 763
303 Ga0395898_0802322 3300037466 Bacteria 881
304 Ga0395905_0022807 3300037471 Bacteria 5918
305 Ga0395905_0103234 3300037471 Bacteria 2677
306 Ga0395905_0647618 3300037471 Bacteria 958
307 Ga0451802_1402938 3300041460 Unclassified 880
308 Ga0439432_040736 3300042006 Bacteria 1473
309 Ga0439449_0054892 3300042007 Bacteria 1472
310 Ga0450920_041472 3300042122 Bacteria 918
311 Ga0450900_021239 3300042136 Bacteria 906
312 Ga0450918_050783 3300042531 Unclassified 755
313 Ga0466966_0061751 3300044684 Bacteria 2363
314 Ga0466963_0006520 3300044694 Bacteria 6912
315 Ga0466964_0033886 3300044706 Bacteria 2036
316 Ga0466959_0058952 3300045049 Bacteria 2796
317 Ga0466967_0022916 3300045976 Bacteria 5106
318 Ga0466967_0052264 3300045976 Bacteria 3585
319 Ga0466967_0092862 3300045976 Bacteria 2745
320 Ga0495585_0069179 3300046492 Bacteria 1927
321 Ga0495598_0000867 3300046537 Bacteria 5820
322 Ga0495633_0000803 3300046558 Bacteria 28051
323 Ga0495668_0365581 3300046616 Bacteria 792
324 Ga0495669_0008132 3300046684 Bacteria 4401
325 Ga0495669_0022035 3300046684 Bacteria 2767
326 Ga0495670_0004174 3300046691 Bacteria 7078
327 Ga0495677_0008467 3300047445 Bacteria 3820
328 Ga0495593_0086391 3300047673 Bacteria 1618
329 Ga0496100_0009185 3300048903 Bacteria 5547
330 Ga0496100_0306204 3300048903 Bacteria 1190
331 Ga0496101_0062020 3300048904 Bacteria 2717
332 Ga0496106_0000612 3300048909 Bacteria 25476
333 Ga0496107_0000238 3300048910 Bacteria 28814
334 Ga0496107_0037729 3300048910 Bacteria 3468
335 Ga0496107_0108061 3300048910 Bacteria 2043
336 Ga0496107_0110842 3300048910 Bacteria 2017
337 Ga0496107_0925182 3300048910 Bacteria 635
338 Ga0496108_0044154 3300048911 Bacteria 3721
339 Ga0496109_0001676 3300048912 Bacteria 18462
340 Ga0496109_1439739 3300048912 Unclassified 624
341 Ga0496110_0031775 3300048913 Bacteria 4557
342 Ga0496111_0001277 3300048914 Bacteria 14106
343 Ga0496112_0003263 3300048915 Bacteria 13387
344 Ga0496114_0169826 3300048917 Bacteria 1900
345 Ga0496115_0001625 3300048918 Bacteria 16179
346 Ga0501070_0479197 3300049586 Bacteria 1001
347 Ga0307412_10125756
348 JGI24740J21852_10030684
349 JGI24739J22299_10005805
350 JGI24737J22298_10010004
351 JGI24737J22298_10174685
352 JGI24735J21928_10015998
353 JGI24738J21930_10049681
354 rootH2_10142943
355 Ga0070658_10045424
356 Ga0070658_10278413
357 Ga0070676_10261179
358 Ga0070683_100385011
359 Ga0070690_101103804
360 Ga0070670_100080167
361 Ga0070670_100174427
362 Ga0070677_10002720
363 Ga0070666_10033267
364 Ga0070666_10091692
365 Ga0070680_100002079
366 Ga0070680_100721851
367 Ga0070680_100758551
368 Ga0070682_100026840
369 Ga0070682_100195381
370 Ga0068868_100624263
371 Ga0070660_100013561
372 Ga0070660_100095511
373 Ga0070660_100247824
374 Ga0070660_100313691
375 Ga0070660_100726238
376 Ga0070661_100010633
377 Ga0070661_100231075
378 Ga0070661_100368425
379 Ga0070661_100425199
380 Ga0070661_100807002
381 Ga0070661_100921887
382 Ga0070668_100044438
383 Ga0070669_100036563
384 Ga0070669_100079814
385 Ga0070669_100183055
386 Ga0070675_100647407
387 Ga0070671_100000327
388 Ga0070671_100066838
389 Ga0070671_100520780
390 Ga0070671_101071852
391 Ga0070674_100170035
392 Ga0070673_100101890
393 Ga0070673_100195940
394 Ga0070673_100425078
395 Ga0070659_100010316
396 Ga0070659_100022343
397 Ga0070659_100394365
398 Ga0070667_100011634
399 Ga0070667_100114584
400 Ga0070663_100011257
401 Ga0070663_100129360
402 Ga0070662_100019637
403 Ga0070662_100026971
404 Ga0070662_100068929
405 Ga0070662_100297154
406 Ga0070662_100300758
407 Ga0070662_100351415
408 Ga0070662_100491994
409 Ga0070681_10008482
410 Ga0070681_10040881
411 Ga0070681_10668792
412 Ga0070679_100812039
413 Ga0070679_101104230
414 Ga0070684_100529230
415 Ga0068853_100008039
416 Ga0068853_100301726
417 Ga0068853_100356054
418 Ga0068853_100364703
419 Ga0070693_100072385
420 Ga0070693_100144930
421 Ga0070693_100197112
422 Ga0070665_100160994
423 Ga0070665_100262817
424 Ga0070665_100497213
425 Ga0068855_100002714
426 Ga0068855_100064273
427 Ga0068855_100230074
428 Ga0068855_100555342
429 Ga0070664_100003974
430 Ga0070664_100019192
431 Ga0070664_100031967
432 Ga0070664_100177884
433 Ga0070664_100343595
434 Ga0070664_100717509
435 Ga0070664_100823749
436 Ga0068857_100028653
437 Ga0068857_100124818
438 Ga0068857_100194813
439 Ga0068854_100207119
440 Ga0068854_100375949
441 Ga0068854_100674885
442 Ga0068856_100497036
443 Ga0068856_100557234
444 Ga0068856_101085114
445 Ga0068852_100024321
446 Ga0068852_100122656
447 Ga0068852_100394372
448 Ga0068852_100799393
449 Ga0068852_101349888
450 Ga0068859_102312065
451 Ga0068864_100002590
452 Ga0068861_100778095
453 Ga0068851_10019349
454 Ga0068851_10174185
455 Ga0068851_10269075
456 Ga0068870_10102328
457 Ga0068863_100075911
458 Ga0068860_100263954
459 Ga0068862_100600123
460 Ga0081539_10037296
461 Ga0097620_100052320
462 Ga0097620_102312174
463 Ga0105241_10148809
464 Ga0105248_10000135
465 Ga0105248_10038616
466 Ga0105249_10067125
467 Ga0157373_10030435
468 Ga0157373_10069205
469 Ga0157371_10039590
470 Ga0157371_10127694
471 Ga0157371_10170416
472 Ga0157370_10491121
473 Ga0157370_10530217
474 Ga0157369_10041234
475 Ga0157369_10332388
476 Ga0157369_10458894
477 Ga0157374_10087166
478 Ga0157374_10868367
479 Ga0163162_10071230
480 Ga0157372_10018941
481 Ga0157372_10374222
482 Ga0163163_10000459
483 Ga0206354_11199573
484 Ga0206353_10756230
485 Ga0207656_10135711
486 Ga0207656_10196776
487 Ga0207656_10321958
488 Ga0207682_10002864
489 Ga0207682_10060382
490 Ga0207645_10009921
491 Ga0207705_10015251
492 Ga0207705_10015410
493 Ga0207705_10044712
494 Ga0207705_10052044
495 Ga0207705_10213869
496 Ga0207705_10223171
497 Ga0207707_10013879
498 Ga0207660_10022859
499 Ga0207660_10247233
500 Ga0207657_10001281
501 Ga0207657_10010639
502 Ga0207657_10011597
503 Ga0207657_10020796
504 Ga0207657_10023236
505 Ga0207657_10235055
506 Ga0207649_10028668
507 Ga0207649_10079308
508 Ga0207649_10089887
509 Ga0207649_10727644
510 Ga0207652_10034293
511 Ga0207652_10453298
512 Ga0207652_10681276
513 Ga0207650_10186481
514 Ga0207659_10221855
515 Ga0207644_10005036
516 Ga0207690_10004902
517 Ga0207690_10057248
518 Ga0207690_10083214
519 Ga0207690_10153919
520 Ga0207690_10517031
521 Ga0207706_10010134
522 Ga0207706_10057446
523 Ga0207706_10066757
524 Ga0207706_10351147
525 Ga0207669_10444174
526 Ga0207711_10003334
527 Ga0207661_10156855
528 Ga0207661_10578493
529 Ga0207679_10005172
530 Ga0207679_10133312
531 Ga0207679_10291001
532 Ga0207679_10680191
533 Ga0207679_11523429
534 Ga0207667_10030303
535 Ga0207667_10396498
536 Ga0207667_10431463
537 Ga0207651_10076853
538 Ga0207651_10368657
539 Ga0207651_10631619
540 Ga0207712_10033341
541 Ga0207668_10175814
542 Ga0207640_10385182
543 Ga0207640_10401640
544 Ga0207640_10647092
545 Ga0207658_10758318
546 Ga0207639_10010067
547 Ga0207678_10001263
548 Ga0207678_10008714
549 Ga0207678_10170047
550 Ga0207702_10000072
551 Ga0207702_11359075
552 Ga0207676_10024474
553 Ga0207674_10012119
554 Ga0207674_10012140
555 Ga0207674_10344904
556 Ga0207698_10155907
557 Ga0207698_10787501
558 Ga0268266_10246680
559 Ga0268265_10051197
560 Ga0268265_10320486
561 Ga0307408_100027974
562 Ga0307408_100041476
563 Ga0307408_100273546
564 Ga0307408_100311029
565 Ga0307408_100336937
566 Ga0307408_100354367
567 Ga0307408_101197583
568 Ga0307405_10009640
569 Ga0307405_10014820
570 Ga0307405_10033627
571 Ga0307405_10063082
572 Ga0307405_10105110
573 Ga0307405_10150877
574 Ga0307405_10194242
575 Ga0307413_10006949
576 Ga0307413_10008564
577 Ga0307413_10082598
578 Ga0307413_10191050
579 Ga0307413_10486802
580 Ga0307413_10532407
581 Ga0307413_11369588
582 Ga0307410_10004700
583 Ga0307410_10004837
584 Ga0307410_10026867
585 Ga0307410_10083331
586 Ga0307410_10100263
587 Ga0307410_10105636
588 Ga0307410_10119155
589 Ga0307410_10316621
590 Ga0307410_10655396
591 Ga0307410_10855708
592 Ga0307406_10043921
593 Ga0307406_10080321
594 Ga0307406_10183469
595 Ga0307406_10264149
596 Ga0307407_10097872
597 Ga0307407_10129506
598 Ga0307407_10134214
599 Ga0307407_10147608
600 Ga0307407_11021697
601 Ga0307412_10010607
602 Ga0307412_10027012
603 Ga0307412_10236013
604 Ga0307412_10254199
605 Ga0307412_10381352
606 Ga0307412_10732991
607 Ga0307409_100000853
608 Ga0307409_100008187
609 Ga0307409_100100286
610 Ga0307409_100100845
611 Ga0307409_100106720
612 Ga0307409_100245073
613 Ga0307409_100257789
614 Ga0307409_100260997
615 Ga0307409_101258344
616 Ga0307416_100050261
617 Ga0307416_100156160
618 Ga0307416_100168013
619 Ga0307416_100656178
620 Ga0307416_100741055
621 Ga0307416_102579101
622 Ga0307414_10016112
623 Ga0307414_10023432
624 Ga0307414_10098194
625 Ga0307414_10113532
626 Ga0307414_10246358
627 Ga0307414_10634725
628 Ga0307414_10688856
629 Ga0307414_10699650
630 Ga0307414_11794270
631 Ga0307411_10011041
632 Ga0307411_10045622
633 Ga0307411_10181620
634 Ga0307411_10589556
635 Ga0307411_10694686
636 Ga0307411_10786742
637 Ga0307415_100012518
638 Ga0307415_100069450
639 Ga0307415_100077080
640 Ga0307415_100219064
641 Ga0307415_100234206
642 Ga0307415_100863325
643 Ga0307415_101332023
644 Ga0395899_0132071
645 Ga0395899_0215187
646 Ga0395900_0288899
647 Ga0395900_0349060
648 Ga0395900_0985133
649 Ga0395898_0802322
650 Ga0395905_0022807
651 Ga0395905_0103234
652 Ga0395905_0647618
653 Ga0451802_1402938
654 Ga0439432_040736
655 Ga0439449_0054892
656 Ga0450920_041472
657 Ga0450900_021239
658 Ga0450918_050783
659 Ga0466966_0061751
660 Ga0466963_0006520
661 Ga0466964_0033886
662 Ga0466959_0058952
663 Ga0466967_0022916
664 Ga0466967_0052264
665 Ga0466967_0092862
666 Ga0495585_0069179
667 Ga0495598_0000867
668 Ga0495633_0000803
669 Ga0495668_0365581
670 Ga0495669_0008132
671 Ga0495669_0022035
672 Ga0495670_0004174
673 Ga0495677_0008467
674 Ga0495593_0086391
675 Ga0496100_0009185
676 Ga0496100_0306204
677 Ga0496101_0062020
678 Ga0496106_0000612
679 Ga0496107_0000238
680 Ga0496107_0037729
681 Ga0496107_0108061
682 Ga0496107_0110842
683 Ga0496107_0925182
684 Ga0496108_0044154
685 Ga0496109_0001676
686 Ga0496109_1439739
687 Ga0496110_0031775
688 Ga0496111_0001277
689 Ga0496112_0003263
690 Ga0496114_0169826
691 Ga0496115_0001625
692 Ga0501070_0479197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13563

2_5_RNA_ligase2

2'-5' RNA ligase superfamily

25

170

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d4g-assembly1.cif.gz_B structure of yjcg protein, a putative 2'-5' rna ligase from bacillus subtilis 0.8097 5 166
2d4g-assembly1.cif.gz_B structure of yjcg protein, a putative 2'-5' rna ligase from bacillus subtilis 0.784 5 166
1jh6-assembly1.cif.gz_A semi-reduced cyclic nucleotide phosphodiesterase from arabidopsis thaliana 0.7163 1 167
1jh6-assembly1.cif.gz_A semi-reduced cyclic nucleotide phosphodiesterase from arabidopsis thaliana 0.7126 1 167
1vgj-assembly1.cif.gz_A crystal structure of 2'-5' rna ligase from pyrococcus horikoshii 0.6996 4 167
ID Description Score Start End Superfamily
af_Q6H5G6_47_215_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7865 6 143 3.90.1140.10
2d4gB00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7852 5 166 3.90.1140.10
2d4gB00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7687 5 166 3.90.1140.10
af_Q2FZP9_3_169_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7585 6 166 3.90.1140.10
af_Q54TE4_5_145_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7219 41 166 3.90.1140.10
ID Description Score Start End GO Terms
AF-A0A7W6LPA7-F1-model_v4 2'-5' RNA ligase family protein 0.9915 2 167
AF-A0A418WNX0-F1-model_v4 2'-5' RNA ligase family protein 0.9884 1 166 GO:0016874
AF-A0A3M0EDS0-F1-model_v4 2'-5' RNA ligase superfamily protein 0.9876 2 166 GO:0016874
AF-A0A0Q4GC26-F1-model_v4 Phosphoesterase HXTX 0.9876 1 166
AF-A0A7T2GLA6-F1-model_v4 2'-5' RNA ligase family protein 0.9874 2 167 GO:0016874

Map