F416286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 345 | 208 | 345 | 329 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100084638|Ga0070697_1000846381 |
| Length | 358 |
| Sequence | MPKVFAFLSVTRLLCLSSLAGATLLAGAQQLPTLAGQDQPSSSQSQSRDDAMSTLKVNVDVVQLFFNVKDKKGGLIPNLTKNDFQIFEDGKPQTIKYYAAESNLPLTLGILIDSSGSQERVLPMEKEVGGAFLSEILREKDLAFVLSFDVNVDLLQDFTNSVSRLKTALNQAKINTGGSVASVIPGMGGGPVPTAGNQRGTLLYDAIYLASHDELAHEVGRKAMVILTDGEDFGSQLTVKDAIEAAQKADSICYVLLIADRGFYGFGGYSGDREMKKLAEETGGRVINVGNKFDKLKEAFDQIALELRSQYNVGYTPTNSARDGTFRKVDIRAKKDYKIQARTGYYALGTRKRSETTH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 91 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 150 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 154 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 171 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 172 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 173 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 174 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 175 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 193 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 194 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 195 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 196 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 197 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 203 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 204 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 205 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0.87 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.8 |
| Rhizosphere | 92.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_9211755 | 2162886012 | Bacteria | 1565 |
| 2 | JGI24034J26672_10011554 | 3300002239 | Bacteria | 1325 |
| 3 | JGI24751J29686_10001372 | 3300002459 | Bacteria | 5123 |
| 4 | Ga0058862_11714472 | 3300004803 | Unclassified | 1154 |
| 5 | Ga0065715_10022507 | 3300005293 | Unclassified | 1972 |
| 6 | Ga0065715_10102599 | 3300005293 | Bacteria | 3098 |
| 7 | Ga0070676_10001539 | 3300005328 | Bacteria | 11671 |
| 8 | Ga0070683_100003068 | 3300005329 | Bacteria | 13443 |
| 9 | Ga0070683_100042539 | 3300005329 | Unclassified | 4183 |
| 10 | Ga0070670_100010978 | 3300005331 | Bacteria | 7737 |
| 11 | Ga0070670_100043040 | 3300005331 | Unclassified | 3883 |
| 12 | Ga0070670_100142317 | 3300005331 | Unclassified | 2074 |
| 13 | Ga0070677_10005728 | 3300005333 | Bacteria | 4107 |
| 14 | Ga0068869_100113480 | 3300005334 | Bacteria | 2064 |
| 15 | Ga0070680_100247067 | 3300005336 | Bacteria | 1508 |
| 16 | Ga0068868_100002828 | 3300005338 | Bacteria | 12021 |
| 17 | Ga0068868_100036578 | 3300005338 | Unclassified | 3801 |
| 18 | Ga0070660_100021423 | 3300005339 | Unclassified | 4767 |
| 19 | Ga0070660_100203999 | 3300005339 | Bacteria | 1604 |
| 20 | Ga0070661_100000564 | 3300005344 | Bacteria | 28146 |
| 21 | Ga0070661_100145059 | 3300005344 | Unclassified | 1791 |
| 22 | Ga0070668_100010468 | 3300005347 | Bacteria | 6894 |
| 23 | Ga0070669_100104915 | 3300005353 | Unclassified | 2137 |
| 24 | Ga0070675_100011704 | 3300005354 | Bacteria | 6877 |
| 25 | Ga0070675_100106852 | 3300005354 | Unclassified | 2363 |
| 26 | Ga0070673_100011141 | 3300005364 | Bacteria | 6131 |
| 27 | Ga0070673_100130566 | 3300005364 | Bacteria | 2107 |
| 28 | Ga0070688_100000761 | 3300005365 | Bacteria | 15904 |
| 29 | Ga0070659_100003196 | 3300005366 | Bacteria | 11663 |
| 30 | Ga0070659_100092743 | 3300005366 | Unclassified | 2422 |
| 31 | Ga0070667_100048424 | 3300005367 | Bacteria | 3577 |
| 32 | Ga0070709_10004888 | 3300005434 | Bacteria | 7242 |
| 33 | Ga0070709_10078710 | 3300005434 | Unclassified | 2145 |
| 34 | Ga0070709_10082590 | 3300005434 | Bacteria | 2099 |
| 35 | Ga0070714_100000040 | 3300005435 | Bacteria | 119253 |
| 36 | Ga0070714_100063060 | 3300005435 | Bacteria | 3186 |
| 37 | Ga0070714_100229923 | 3300005435 | Bacteria | 1708 |
| 38 | Ga0070713_100000634 | 3300005436 | Bacteria | 22440 |
| 39 | Ga0070713_100001648 | 3300005436 | Bacteria | 14346 |
| 40 | Ga0070713_100354308 | 3300005436 | Bacteria | 1362 |
| 41 | Ga0070710_10089800 | 3300005437 | Unclassified | 1810 |
| 42 | Ga0070711_100001709 | 3300005439 | Bacteria | 12163 |
| 43 | Ga0070711_100006344 | 3300005439 | Bacteria | 7124 |
| 44 | Ga0070711_100142996 | 3300005439 | Unclassified | 1796 |
| 45 | Ga0070708_100000770 | 3300005445 | Bacteria | 24102 |
| 46 | Ga0070708_100001110 | 3300005445 | Bacteria | 20552 |
| 47 | Ga0070708_100018478 | 3300005445 | Bacteria | 5834 |
| 48 | Ga0070708_100224515 | 3300005445 | Unclassified | 1762 |
| 49 | Ga0070663_100005971 | 3300005455 | Bacteria | 7289 |
| 50 | Ga0070681_10014888 | 3300005458 | Bacteria | 7733 |
| 51 | Ga0070681_10131417 | 3300005458 | Unclassified | 2436 |
| 52 | Ga0068867_100001635 | 3300005459 | Bacteria | 15592 |
| 53 | Ga0070685_10003192 | 3300005466 | Bacteria | 8344 |
| 54 | Ga0070706_100001381 | 3300005467 | Bacteria | 25765 |
| 55 | Ga0070706_100046590 | 3300005467 | Bacteria | 4002 |
| 56 | Ga0070706_100055949 | 3300005467 | Bacteria | 3641 |
| 57 | Ga0070706_100316637 | 3300005467 | Bacteria | 1455 |
| 58 | Ga0070707_100069530 | 3300005468 | Bacteria | 3390 |
| 59 | Ga0070707_100121152 | 3300005468 | Bacteria | 2540 |
| 60 | Ga0070698_100000336 | 3300005471 | Bacteria | 48369 |
| 61 | Ga0070698_100014191 | 3300005471 | Bacteria | 8421 |
| 62 | Ga0070698_100105357 | 3300005471 | Bacteria | 2790 |
| 63 | Ga0070699_100000648 | 3300005518 | Bacteria | 32606 |
| 64 | Ga0070699_100333501 | 3300005518 | Bacteria | 1365 |
| 65 | Ga0070679_100297197 | 3300005530 | Unclassified | 1566 |
| 66 | Ga0070684_100001979 | 3300005535 | Bacteria | 15067 |
| 67 | Ga0070684_100028825 | 3300005535 | Bacteria | 4699 |
| 68 | Ga0070684_100177731 | 3300005535 | Unclassified | 1935 |
| 69 | Ga0070697_100001964 | 3300005536 | Bacteria | 15740 |
| 70 | Ga0070697_100002439 | 3300005536 | Bacteria | 14310 |
| 71 | Ga0070697_100007086 | 3300005536 | Bacteria | 8721 |
| 72 | Ga0070697_100022280 | 3300005536 | Bacteria | 5027 |
| 73 | Ga0070697_100084638 | 3300005536 | Unclassified | 2615 |
| 74 | Ga0068853_100034605 | 3300005539 | Bacteria | 4288 |
| 75 | Ga0070686_100005119 | 3300005544 | Bacteria | 7235 |
| 76 | Ga0070696_100057526 | 3300005546 | Bacteria | 2714 |
| 77 | Ga0068855_100274077 | 3300005563 | Unclassified | 1875 |
| 78 | Ga0070664_100017332 | 3300005564 | Bacteria | 5913 |
| 79 | Ga0068854_100168936 | 3300005578 | Unclassified | 1700 |
| 80 | Ga0068856_100003015 | 3300005614 | Bacteria | 17242 |
| 81 | Ga0068856_100035164 | 3300005614 | Bacteria | 4909 |
| 82 | Ga0068856_100054988 | 3300005614 | Bacteria | 3928 |
| 83 | Ga0068856_100220773 | 3300005614 | Unclassified | 1910 |
| 84 | Ga0068852_100006298 | 3300005616 | Bacteria | 8568 |
| 85 | Ga0068852_100157998 | 3300005616 | Unclassified | 2114 |
| 86 | Ga0068864_100026522 | 3300005618 | Bacteria | 4886 |
| 87 | Ga0068866_10005966 | 3300005718 | Bacteria | 5067 |
| 88 | Ga0068861_100139985 | 3300005719 | Bacteria | 1974 |
| 89 | Ga0068851_10003451 | 3300005834 | Bacteria | 7032 |
| 90 | Ga0068851_10044034 | 3300005834 | Unclassified | 2252 |
| 91 | Ga0068858_100012401 | 3300005842 | Bacteria | 8037 |
| 92 | Ga0068860_100068076 | 3300005843 | Bacteria | 3383 |
| 93 | Ga0068862_100003832 | 3300005844 | Bacteria | 12810 |
| 94 | Ga0070717_10002200 | 3300006028 | Bacteria | 13706 |
| 95 | Ga0070717_10003006 | 3300006028 | Bacteria | 12007 |
| 96 | Ga0070717_10005322 | 3300006028 | Bacteria | 9380 |
| 97 | Ga0070717_10027909 | 3300006028 | Bacteria | 4513 |
| 98 | Ga0070717_10062241 | 3300006028 | Bacteria | 3094 |
| 99 | Ga0070717_10094833 | 3300006028 | Unclassified | 2525 |
| 100 | Ga0070717_10156559 | 3300006028 | Bacteria | 1974 |
| 101 | Ga0070717_10161491 | 3300006028 | Unclassified | 1944 |
| 102 | Ga0070716_100239706 | 3300006173 | Bacteria | 1229 |
| 103 | Ga0070712_100001404 | 3300006175 | Bacteria | 14643 |
| 104 | Ga0070712_100003230 | 3300006175 | Bacteria | 10046 |
| 105 | Ga0097621_100281004 | 3300006237 | Unclassified | 1465 |
| 106 | Ga0075431_100307333 | 3300006847 | Bacteria | 1601 |
| 107 | Ga0068865_100016958 | 3300006881 | Bacteria | 4674 |
| 108 | Ga0075436_100003071 | 3300006914 | Bacteria | 11438 |
| 109 | Ga0099795_10015577 | 3300007788 | Bacteria | 2385 |
| 110 | Ga0099795_10038390 | 3300007788 | Viruses | 1690 |
| 111 | Ga0105250_10016650 | 3300009092 | Bacteria | 2993 |
| 112 | Ga0105240_10025067 | 3300009093 | Bacteria | 7850 |
| 113 | Ga0105240_10032204 | 3300009093 | Bacteria | 6789 |
| 114 | Ga0105240_10046717 | 3300009093 | Bacteria | 5484 |
| 115 | Ga0105240_10257169 | 3300009093 | Unclassified | 2016 |
| 116 | Ga0105245_10006534 | 3300009098 | Bacteria | 10236 |
| 117 | Ga0105247_10001438 | 3300009101 | Bacteria | 17255 |
| 118 | Ga0114129_10125206 | 3300009147 | Bacteria | 3534 |
| 119 | Ga0105241_10013724 | 3300009174 | Bacteria | 5934 |
| 120 | Ga0105241_10021251 | 3300009174 | Bacteria | 4796 |
| 121 | Ga0105241_10099387 | 3300009174 | Bacteria | 2311 |
| 122 | Ga0105242_10001741 | 3300009176 | Bacteria | 17197 |
| 123 | Ga0105248_10080828 | 3300009177 | Bacteria | 3654 |
| 124 | Ga0105237_10007944 | 3300009545 | Bacteria | 11560 |
| 125 | Ga0105237_10035956 | 3300009545 | Bacteria | 5010 |
| 126 | Ga0105237_10087930 | 3300009545 | Unclassified | 3097 |
| 127 | Ga0105238_10062827 | 3300009551 | Bacteria | 3714 |
| 128 | Ga0105249_10029432 | 3300009553 | Bacteria | 4960 |
| 129 | Ga0105239_10011180 | 3300010375 | Bacteria | 10017 |
| 130 | Ga0105239_10055366 | 3300010375 | Bacteria | 4350 |
| 131 | Ga0105239_10267052 | 3300010375 | Bacteria | 1924 |
| 132 | Ga0105246_10000398 | 3300011119 | Bacteria | 23279 |
| 133 | Ga0157373_10007420 | 3300013100 | Bacteria | 8155 |
| 134 | Ga0157373_10041853 | 3300013100 | Bacteria | 3276 |
| 135 | Ga0157371_10020562 | 3300013102 | Bacteria | 4857 |
| 136 | Ga0157370_10295776 | 3300013104 | Unclassified | 1495 |
| 137 | Ga0157369_10000972 | 3300013105 | Bacteria | 36347 |
| 138 | Ga0157369_10038911 | 3300013105 | Bacteria | 5199 |
| 139 | Ga0157369_10073254 | 3300013105 | Unclassified | 3675 |
| 140 | Ga0157369_10207925 | 3300013105 | Bacteria | 2052 |
| 141 | Ga0157374_10002566 | 3300013296 | Bacteria | 15326 |
| 142 | Ga0157374_10040983 | 3300013296 | Bacteria | 4265 |
| 143 | Ga0157374_10049886 | 3300013296 | Unclassified | 3888 |
| 144 | Ga0157378_10055104 | 3300013297 | Bacteria | 3541 |
| 145 | Ga0163162_10093699 | 3300013306 | Bacteria | 3089 |
| 146 | Ga0157372_10006719 | 3300013307 | Bacteria | 12232 |
| 147 | Ga0157372_10009135 | 3300013307 | Bacteria | 10530 |
| 148 | Ga0157372_10080023 | 3300013307 | Bacteria | 3696 |
| 149 | Ga0157372_10152947 | 3300013307 | Unclassified | 2663 |
| 150 | Ga0163163_10005253 | 3300014325 | Bacteria | 11166 |
| 151 | Ga0163163_10012732 | 3300014325 | Bacteria | 7673 |
| 152 | Ga0163163_10073141 | 3300014325 | Bacteria | 3418 |
| 153 | Ga0182008_10004202 | 3300014497 | Bacteria | 8464 |
| 154 | Ga0182008_10031987 | 3300014497 | Unclassified | 2645 |
| 155 | Ga0157377_10001486 | 3300014745 | Bacteria | 10148 |
| 156 | Ga0157379_10008207 | 3300014968 | Bacteria | 9068 |
| 157 | Ga0182006_1035216 | 3300015261 | Unclassified | 1998 |
| 158 | Ga0182007_10002598 | 3300015262 | Bacteria | 8891 |
| 159 | Ga0182007_10006582 | 3300015262 | Unclassified | 4978 |
| 160 | Ga0163161_10004168 | 3300017792 | Bacteria | 10108 |
| 161 | Ga0213875_10059832 | 3300021388 | Bacteria | 1783 |
| 162 | Ga0207697_10003029 | 3300025315 | Bacteria | 8448 |
| 163 | Ga0207656_10001918 | 3300025321 | Bacteria | 6917 |
| 164 | Ga0207682_10006955 | 3300025893 | Bacteria | 4536 |
| 165 | Ga0207688_10001958 | 3300025901 | Bacteria | 11042 |
| 166 | Ga0207647_10003556 | 3300025904 | Bacteria | 11698 |
| 167 | Ga0207685_10028381 | 3300025905 | Bacteria | 1970 |
| 168 | Ga0207699_10001094 | 3300025906 | Bacteria | 12788 |
| 169 | Ga0207699_10035848 | 3300025906 | Bacteria | 2825 |
| 170 | Ga0207699_10072891 | 3300025906 | Unclassified | 2105 |
| 171 | Ga0207645_10000772 | 3300025907 | Bacteria | 26702 |
| 172 | Ga0207643_10000412 | 3300025908 | Bacteria | 28337 |
| 173 | Ga0207684_10000203 | 3300025910 | Bacteria | 91833 |
| 174 | Ga0207684_10005498 | 3300025910 | Bacteria | 11670 |
| 175 | Ga0207684_10024604 | 3300025910 | Bacteria | 5134 |
| 176 | Ga0207684_10028393 | 3300025910 | Bacteria | 4767 |
| 177 | Ga0207684_10068628 | 3300025910 | Bacteria | 3013 |
| 178 | Ga0207654_10020015 | 3300025911 | Bacteria | 3541 |
| 179 | Ga0207707_10023254 | 3300025912 | Bacteria | 5422 |
| 180 | Ga0207707_10105501 | 3300025912 | Unclassified | 2463 |
| 181 | Ga0207695_10056074 | 3300025913 | Bacteria | 4102 |
| 182 | Ga0207671_10233547 | 3300025914 | Bacteria | 1443 |
| 183 | Ga0207693_10000053 | 3300025915 | Bacteria | 97139 |
| 184 | Ga0207693_10000071 | 3300025915 | Bacteria | 89988 |
| 185 | Ga0207693_10092010 | 3300025915 | Unclassified | 2377 |
| 186 | Ga0207693_10379603 | 3300025915 | Bacteria | 1105 |
| 187 | Ga0207663_10002430 | 3300025916 | Bacteria | 8946 |
| 188 | Ga0207663_10044209 | 3300025916 | Unclassified | 2733 |
| 189 | Ga0207663_10157038 | 3300025916 | Unclassified | 1601 |
| 190 | Ga0207662_10015393 | 3300025918 | Bacteria | 4304 |
| 191 | Ga0207657_10003461 | 3300025919 | Bacteria | 16840 |
| 192 | Ga0207657_10016776 | 3300025919 | Bacteria | 7051 |
| 193 | Ga0207649_10000783 | 3300025920 | Bacteria | 20616 |
| 194 | Ga0207649_10100220 | 3300025920 | Bacteria | 1915 |
| 195 | Ga0207652_10168181 | 3300025921 | Bacteria | 1967 |
| 196 | Ga0207646_10006813 | 3300025922 | Bacteria | 11751 |
| 197 | Ga0207646_10007618 | 3300025922 | Bacteria | 10964 |
| 198 | Ga0207646_10042821 | 3300025922 | Unclassified | 4068 |
| 199 | Ga0207650_10000024 | 3300025925 | Bacteria | 299184 |
| 200 | Ga0207650_10105776 | 3300025925 | Bacteria | 2173 |
| 201 | Ga0207659_10144718 | 3300025926 | Bacteria | 1849 |
| 202 | Ga0207700_10000153 | 3300025928 | Bacteria | 41130 |
| 203 | Ga0207700_10000674 | 3300025928 | Bacteria | 19930 |
| 204 | Ga0207700_10016956 | 3300025928 | Unclassified | 4851 |
| 205 | Ga0207700_10062335 | 3300025928 | Bacteria | 2831 |
| 206 | Ga0207664_10000029 | 3300025929 | Bacteria | 183815 |
| 207 | Ga0207664_10004921 | 3300025929 | Bacteria | 9079 |
| 208 | Ga0207644_10080374 | 3300025931 | Bacteria | 2407 |
| 209 | Ga0207644_10308395 | 3300025931 | Unclassified | 1277 |
| 210 | Ga0207706_10000578 | 3300025933 | Bacteria | 39082 |
| 211 | Ga0207670_10022323 | 3300025936 | Bacteria | 3920 |
| 212 | Ga0207669_10126041 | 3300025937 | Bacteria | 1749 |
| 213 | Ga0207704_10012354 | 3300025938 | Bacteria | 4240 |
| 214 | Ga0207665_10005766 | 3300025939 | Bacteria | 8235 |
| 215 | Ga0207665_10041895 | 3300025939 | Bacteria | 3059 |
| 216 | Ga0207691_10000072 | 3300025940 | Bacteria | 83580 |
| 217 | Ga0207689_10001329 | 3300025942 | Bacteria | 23863 |
| 218 | Ga0207661_10000062 | 3300025944 | Bacteria | 75988 |
| 219 | Ga0207661_10042655 | 3300025944 | Unclassified | 3578 |
| 220 | Ga0207679_10000040 | 3300025945 | Bacteria | 127317 |
| 221 | Ga0207667_10172698 | 3300025949 | Unclassified | 2221 |
| 222 | Ga0207651_10017952 | 3300025960 | Bacteria | 4195 |
| 223 | Ga0207712_10330907 | 3300025961 | Bacteria | 1260 |
| 224 | Ga0207668_10031614 | 3300025972 | Bacteria | 3488 |
| 225 | Ga0207640_10012599 | 3300025981 | Bacteria | 4822 |
| 226 | Ga0207640_10162944 | 3300025981 | Unclassified | 1652 |
| 227 | Ga0207640_10333961 | 3300025981 | Unclassified | 1211 |
| 228 | Ga0207658_10008825 | 3300025986 | Bacteria | 6841 |
| 229 | Ga0207677_10026055 | 3300026023 | Unclassified | 3661 |
| 230 | Ga0207639_10023181 | 3300026041 | Bacteria | 4480 |
| 231 | Ga0207678_10000208 | 3300026067 | Bacteria | 51930 |
| 232 | Ga0207702_10145462 | 3300026078 | Unclassified | 2150 |
| 233 | Ga0207702_10192262 | 3300026078 | Unclassified | 1886 |
| 234 | Ga0207641_10000030 | 3300026088 | Bacteria | 224468 |
| 235 | Ga0207648_10000303 | 3300026089 | Bacteria | 53727 |
| 236 | Ga0207676_10000256 | 3300026095 | Bacteria | 46055 |
| 237 | Ga0207674_10000069 | 3300026116 | Bacteria | 106470 |
| 238 | Ga0207674_10037298 | 3300026116 | Bacteria | 5057 |
| 239 | Ga0207675_100177354 | 3300026118 | Bacteria | 2039 |
| 240 | Ga0207683_10000662 | 3300026121 | Bacteria | 31638 |
| 241 | Ga0207698_10333245 | 3300026142 | Unclassified | 1426 |
| 242 | Ga0268266_10002820 | 3300028379 | Bacteria | 18130 |
| 243 | Ga0268265_10004314 | 3300028380 | Bacteria | 9909 |
| 244 | Ga0268264_10117553 | 3300028381 | Bacteria | 2339 |
| 245 | Ga0265338_10002879 | 3300028800 | Bacteria | 25111 |
| 246 | Ga0265338_10102640 | 3300028800 | Bacteria | 2325 |
| 247 | Ga0265338_10259188 | 3300028800 | Unclassified | 1279 |
| 248 | Ga0265762_1001509 | 3300030760 | Bacteria | 4223 |
| 249 | Ga0265760_10018266 | 3300031090 | Bacteria | 2018 |
| 250 | Ga0265325_10082105 | 3300031241 | Bacteria | 1600 |
| 251 | Ga0265339_10006673 | 3300031249 | Bacteria | 7546 |
| 252 | Ga0265339_10147327 | 3300031249 | Unclassified | 1193 |
| 253 | Ga0265342_10070193 | 3300031712 | Bacteria | 2044 |
| 254 | Ga0307416_100503113 | 3300032002 | Unclassified | 1276 |
| 255 | Ga0373926_0026949 | 3300035083 | Bacteria | 2013 |
| 256 | Ga0373934_0002314 | 3300035086 | Bacteria | 7009 |
| 257 | Ga0373936_0017336 | 3300035113 | Bacteria | 2772 |
| 258 | Ga0373936_0042522 | 3300035113 | Bacteria | 1824 |
| 259 | Ga0373945_0004112 | 3300035116 | Bacteria | 4614 |
| 260 | Ga0373953_0016320 | 3300035117 | Bacteria | 2709 |
| 261 | Ga0373954_0021198 | 3300035118 | Unclassified | 2941 |
| 262 | Ga0373956_0037277 | 3300035119 | Unclassified | 2149 |
| 263 | Ga0373957_0019028 | 3300035120 | Bacteria | 2411 |
| 264 | Ga0373943_0000157 | 3300035170 | Bacteria | 26667 |
| 265 | Ga0373924_0000117 | 3300035410 | Bacteria | 22914 |
| 266 | Ga0373931_0006408 | 3300035691 | Bacteria | 5499 |
| 267 | Ga0373927_0000070 | 3300035695 | Bacteria | 73849 |
| 268 | Ga0373927_0091499 | 3300035695 | Bacteria | 1975 |
| 269 | Ga0373927_0114465 | 3300035695 | Bacteria | 1758 |
| 270 | Ga0373927_0154986 | 3300035695 | Bacteria | 1500 |
| 271 | Ga0373947_0001581 | 3300035725 | Bacteria | 13952 |
| 272 | Ga0373947_0006333 | 3300035725 | Bacteria | 6877 |
| 273 | Ga0373947_0099035 | 3300035725 | Bacteria | 1829 |
| 274 | Ga0373937_0060353 | 3300036401 | Bacteria | 3485 |
| 275 | Ga0373925_0001522 | 3300037068 | Bacteria | 19795 |
| 276 | Ga0373925_0176408 | 3300037068 | Bacteria | 1689 |
| 277 | Ga0373925_0347729 | 3300037068 | Unclassified | 1203 |
| 278 | Ga0395898_0272057 | 3300037466 | Bacteria | 1616 |
| 279 | Ga0395905_0003037 | 3300037471 | Bacteria | 18179 |
| 280 | Ga0395905_0016093 | 3300037471 | Bacteria | 7109 |
| 281 | Ga0395905_0029891 | 3300037471 | Bacteria | 5136 |
| 282 | Ga0395905_0059349 | 3300037471 | Bacteria | 3576 |
| 283 | Ga0395905_0094376 | 3300037471 | Bacteria | 2807 |
| 284 | Ga0395905_0168761 | 3300037471 | Bacteria | 2056 |
| 285 | Ga0436364_0415424 | 3300037853 | Bacteria | 6047 |
| 286 | Ga0436365_1855381 | 3300039437 | Bacteria | 1440 |
| 287 | Ga0436363_0502718 | 3300039450 | Bacteria | 4588 |
| 288 | Ga0436363_1251884 | 3300039450 | Bacteria | 3679 |
| 289 | Ga0451577_0018783 | 3300042876 | Bacteria | 6361 |
| 290 | Ga0466963_0019878 | 3300044694 | Bacteria | 4218 |
| 291 | Ga0466963_0161721 | 3300044694 | Unclassified | 1558 |
| 292 | Ga0466963_0329519 | 3300044694 | Unclassified | 1075 |
| 293 | Ga0466957_0078244 | 3300044842 | Unclassified | 2056 |
| 294 | Ga0466957_0234508 | 3300044842 | Unclassified | 1216 |
| 295 | Ga0466967_0000853 | 3300045976 | Bacteria | 16182 |
| 296 | Ga0466967_0011128 | 3300045976 | Bacteria | 6797 |
| 297 | Ga0466967_0436472 | 3300045976 | Unclassified | 1278 |
| 298 | Ga0495653_0081792 | 3300046463 | Unclassified | 2386 |
| 299 | Ga0495580_0000108 | 3300046472 | Bacteria | 55508 |
| 300 | Ga0495580_0001723 | 3300046472 | Bacteria | 19219 |
| 301 | Ga0495580_0032581 | 3300046472 | Bacteria | 3760 |
| 302 | Ga0495580_0044959 | 3300046472 | Unclassified | 3138 |
| 303 | Ga0495582_0023263 | 3300046473 | Bacteria | 3390 |
| 304 | Ga0495639_0008114 | 3300046475 | Bacteria | 4509 |
| 305 | Ga0495630_0030330 | 3300046517 | Bacteria | 4022 |
| 306 | Ga0495666_0106154 | 3300046526 | Unclassified | 1322 |
| 307 | Ga0495586_0050885 | 3300046535 | Bacteria | 2242 |
| 308 | Ga0495586_0121309 | 3300046535 | Bacteria | 1461 |
| 309 | Ga0495645_0038674 | 3300046543 | Bacteria | 3480 |
| 310 | Ga0495667_0114695 | 3300046559 | Unclassified | 1741 |
| 311 | Ga0495635_0033197 | 3300046663 | Bacteria | 3580 |
| 312 | Ga0495635_0115896 | 3300046663 | Unclassified | 1829 |
| 313 | Ga0495659_0021910 | 3300046664 | Viruses | 2156 |
| 314 | Ga0495658_0082370 | 3300046683 | Bacteria | 1891 |
| 315 | Ga0495669_0003551 | 3300046684 | Bacteria | 6430 |
| 316 | Ga0495669_0017677 | 3300046684 | Bacteria | 3062 |
| 317 | Ga0495674_0051459 | 3300047319 | Bacteria | 3631 |
| 318 | Ga0495675_0009381 | 3300047444 | Bacteria | 6088 |
| 319 | Ga0496102_0120059 | 3300048905 | Bacteria | 2455 |
| 320 | Ga0496102_0258398 | 3300048905 | Unclassified | 1642 |
| 321 | Ga0496103_0024690 | 3300048906 | Unclassified | 3627 |
| 322 | Ga0496104_0114362 | 3300048907 | Bacteria | 2588 |
| 323 | Ga0496104_0290253 | 3300048907 | Unclassified | 1548 |
| 324 | Ga0496106_0252374 | 3300048909 | Bacteria | 1410 |
| 325 | Ga0496106_0269793 | 3300048909 | Bacteria | 1362 |
| 326 | Ga0496107_0289539 | 3300048910 | Unclassified | 1219 |
| 327 | Ga0496108_0000410 | 3300048911 | Bacteria | 35171 |
| 328 | Ga0496108_0029739 | 3300048911 | Bacteria | 4527 |
| 329 | Ga0496109_0409327 | 3300048912 | Bacteria | 1281 |
| 330 | Ga0496110_0005663 | 3300048913 | Bacteria | 9804 |
| 331 | Ga0496112_0000155 | 3300048915 | Bacteria | 43076 |
| 332 | Ga0496112_0018989 | 3300048915 | Bacteria | 6480 |
| 333 | Ga0496112_0020108 | 3300048915 | Bacteria | 6320 |
| 334 | Ga0496112_0041710 | 3300048915 | Unclassified | 4490 |
| 335 | Ga0496113_0002103 | 3300048916 | Bacteria | 11478 |
| 336 | Ga0496113_0013614 | 3300048916 | Bacteria | 5519 |
| 337 | Ga0496115_0023906 | 3300048918 | Bacteria | 4745 |
| 338 | Ga0496115_0247555 | 3300048918 | Bacteria | 1468 |
| 339 | Ga0501298_004997 | 3300049521 | Bacteria | 2110 |
| 340 | Ga0501216_009768 | 3300049660 | Bacteria | 1534 |
| 341 | nmdc:mga05p37_197412_c1 | 3300050507 | Bacteria | 2439 |
| 342 | nmdc:mga0rr50_15222_c1 | 3300050513 | Bacteria | 5072 |
| 343 | nmdc:mga0rr50_69928_c1 | 3300050513 | Unclassified | 2673 |
| 344 | Ga0495601_0010401 | 3300053077 | Bacteria | 5536 |
| 345 | Ga0495612_0025457 | 3300053078 | Unclassified | 2376 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005614 | Ga0068856_100035164 | Ga0068856_1000351642 | 274 |
| 2 | 3300048918 | Ga0496115_0247555 | Ga0496115_0247555_410_1315 | 282 |
| 3 | 3300005434 | Ga0070709_10082590 | Ga0070709_100825901 | 286 |
| 4 | 3300025906 | Ga0207699_10035848 | Ga0207699_100358483 | 286 |
| 5 | 3300048915 | Ga0496112_0018989 | Ga0496112_0018989_4544_5527 | 288 |
| 6 | 3300025949 | Ga0207667_10172698 | Ga0207667_101726982 | 290 |
| 7 | 3300048905 | Ga0496102_0258398 | Ga0496102_0258398_65_973 | 290 |
| 8 | 3300005331 | Ga0070670_100142317 | Ga0070670_1001423173 | 291 |
| 9 | 3300005344 | Ga0070661_100145059 | Ga0070661_1001450591 | 291 |
| 10 | 3300005535 | Ga0070684_100177731 | Ga0070684_1001777312 | 291 |
| 11 | 3300005563 | Ga0068855_100274077 | Ga0068855_1002740772 | 291 |
| 12 | 3300005578 | Ga0068854_100168936 | Ga0068854_1001689362 | 291 |
| 13 | 3300005614 | Ga0068856_100054988 | Ga0068856_1000549882 | 291 |
| 14 | 3300005834 | Ga0068851_10044034 | Ga0068851_100440342 | 291 |
| 15 | 3300006237 | Ga0097621_100281004 | Ga0097621_1002810041 | 291 |
| 16 | 3300025912 | Ga0207707_10105501 | Ga0207707_101055013 | 291 |
| 17 | 3300025919 | Ga0207657_10016776 | Ga0207657_100167762 | 291 |
| 18 | 3300025920 | Ga0207649_10100220 | Ga0207649_101002201 | 291 |
| 19 | 3300025931 | Ga0207644_10308395 | Ga0207644_103083952 | 291 |
| 20 | 3300025944 | Ga0207661_10042655 | Ga0207661_100426553 | 291 |
| 21 | 3300025981 | Ga0207640_10162944 | Ga0207640_101629442 | 291 |
| 22 | 3300026142 | Ga0207698_10333245 | Ga0207698_103332451 | 291 |
| 23 | 3300014497 | Ga0182008_10004202 | Ga0182008_100042027 | 292 |
| 24 | 3300015262 | Ga0182007_10006582 | Ga0182007_100065824 | 292 |
| 25 | 3300046472 | Ga0495580_0032581 | Ga0495580_0032581_2329_3378 | 292 |
| 26 | 3300039450 | Ga0436363_1251884 | Ga0436363_1251884_466_1437 | 294 |
| 27 | 3300004803 | Ga0058862_11714472 | Ga0058862_117144721 | 295 |
| 28 | 3300037466 | Ga0395898_0272057 | Ga0395898_0272057_182_1150 | 296 |
| 29 | 3300046535 | Ga0495586_0121309 | Ga0495586_0121309_206_1177 | 296 |
| 30 | 3300046475 | Ga0495639_0008114 | Ga0495639_0008114_2680_3651 | 297 |
| 31 | 3300014325 | Ga0163163_10005253 | Ga0163163_100052539 | 298 |
| 32 | 3300032002 | Ga0307416_100503113 | Ga0307416_1005031131 | 298 |
| 33 | 3300035725 | Ga0373947_0006333 | Ga0373947_0006333_2126_3208 | 298 |
| 34 | 3300037068 | Ga0373925_0347729 | Ga0373925_0347729_14_1096 | 298 |
| 35 | 3300044842 | Ga0466957_0078244 | Ga0466957_0078244_50_985 | 298 |
| 36 | 3300046472 | Ga0495580_0000108 | Ga0495580_0000108_1122_2204 | 298 |
| 37 | 3300046683 | Ga0495658_0082370 | Ga0495658_0082370_695_1777 | 298 |
| 38 | 3300048915 | Ga0496112_0041710 | Ga0496112_0041710_158_1135 | 298 |
| 39 | 3300049521 | Ga0501298_004997 | Ga0501298_004997_838_1827 | 298 |
| 40 | 3300049660 | Ga0501216_009768 | Ga0501216_009768_247_1236 | 298 |
| 41 | 3300009093 | Ga0105240_10046717 | Ga0105240_100467172 | 299 |
| 42 | 3300009174 | Ga0105241_10013724 | Ga0105241_100137242 | 299 |
| 43 | 3300009174 | Ga0105241_10099387 | Ga0105241_100993872 | 299 |
| 44 | 3300009545 | Ga0105237_10035956 | Ga0105237_100359561 | 299 |
| 45 | 3300013105 | Ga0157369_10038911 | Ga0157369_100389115 | 299 |
| 46 | 3300013307 | Ga0157372_10006719 | Ga0157372_100067196 | 299 |
| 47 | 3300025905 | Ga0207685_10028381 | Ga0207685_100283812 | 299 |
| 48 | 3300025911 | Ga0207654_10020015 | Ga0207654_100200153 | 299 |
| 49 | 3300025914 | Ga0207671_10233547 | Ga0207671_102335471 | 299 |
| 50 | 3300025981 | Ga0207640_10333961 | Ga0207640_103339611 | 299 |
| 51 | 3300035120 | Ga0373957_0019028 | Ga0373957_0019028_1253_2305 | 299 |
| 52 | 3300035410 | Ga0373924_0000117 | Ga0373924_0000117_21669_22727 | 299 |
| 53 | 3300035691 | Ga0373931_0006408 | Ga0373931_0006408_1295_2380 | 299 |
| 54 | 3300035695 | Ga0373927_0091499 | Ga0373927_0091499_606_1664 | 299 |
| 55 | 3300035695 | Ga0373927_0114465 | Ga0373927_0114465_96_1181 | 299 |
| 56 | 3300035695 | Ga0373927_0154986 | Ga0373927_0154986_483_1484 | 299 |
| 57 | 3300035725 | Ga0373947_0099035 | Ga0373947_0099035_420_1478 | 299 |
| 58 | 3300037068 | Ga0373925_0176408 | Ga0373925_0176408_408_1493 | 299 |
| 59 | 3300046473 | Ga0495582_0023263 | Ga0495582_0023263_251_1309 | 299 |
| 60 | 3300046517 | Ga0495630_0030330 | Ga0495630_0030330_2791_3849 | 299 |
| 61 | 3300046526 | Ga0495666_0106154 | Ga0495666_0106154_86_1144 | 299 |
| 62 | 3300046559 | Ga0495667_0114695 | Ga0495667_0114695_480_1538 | 299 |
| 63 | 3300046663 | Ga0495635_0115896 | Ga0495635_0115896_760_1818 | 299 |
| 64 | 3300048918 | Ga0496115_0023906 | Ga0496115_0023906_3727_4728 | 299 |
| 65 | 3300006028 | Ga0070717_10005322 | Ga0070717_100053229 | 300 |
| 66 | 3300025915 | Ga0207693_10379603 | Ga0207693_103796031 | 300 |
| 67 | 3300044694 | Ga0466963_0329519 | Ga0466963_0329519_102_1040 | 300 |
| 68 | 3300044842 | Ga0466957_0234508 | Ga0466957_0234508_249_1205 | 301 |
| 69 | 3300048915 | Ga0496112_0020108 | Ga0496112_0020108_673_1728 | 301 |
| 70 | 3300030760 | Ga0265762_1001509 | Ga0265762_10015092 | 302 |
| 71 | 3300031090 | Ga0265760_10018266 | Ga0265760_100182662 | 302 |
| 72 | 3300005354 | Ga0070675_100106852 | Ga0070675_1001068522 | 303 |
| 73 | 3300010375 | Ga0105239_10267052 | Ga0105239_102670522 | 303 |
| 74 | 3300013307 | Ga0157372_10152947 | Ga0157372_101529473 | 303 |
| 75 | 3300014325 | Ga0163163_10073141 | Ga0163163_100731413 | 303 |
| 76 | 3300046684 | Ga0495669_0003551 | Ga0495669_0003551_662_1639 | 303 |
| 77 | 3300048912 | Ga0496109_0409327 | Ga0496109_0409327_13_990 | 303 |
| 78 | 3300048916 | Ga0496113_0013614 | Ga0496113_0013614_157_1134 | 303 |
| 79 | 3300006028 | Ga0070717_10156559 | Ga0070717_101565592 | 304 |
| 80 | 3300013296 | Ga0157374_10040983 | Ga0157374_100409833 | 304 |
| 81 | 3300037471 | Ga0395905_0003037 | Ga0395905_0003037_10881_11852 | 304 |
| 82 | 3300037471 | Ga0395905_0029891 | Ga0395905_0029891_3817_4785 | 304 |
| 83 | 3300037471 | Ga0395905_0094376 | Ga0395905_0094376_1721_2698 | 304 |
| 84 | 3300037471 | Ga0395905_0168761 | Ga0395905_0168761_476_1444 | 304 |
| 85 | 3300005339 | Ga0070660_100203999 | Ga0070660_1002039992 | 305 |
| 86 | 3300005364 | Ga0070673_100130566 | Ga0070673_1001305662 | 305 |
| 87 | 3300005535 | Ga0070684_100028825 | Ga0070684_1000288252 | 305 |
| 88 | 3300005618 | Ga0068864_100026522 | Ga0068864_1000265222 | 305 |
| 89 | 3300026116 | Ga0207674_10037298 | Ga0207674_100372983 | 305 |
| 90 | 3300042876 | Ga0451577_0018783 | Ga0451577_0018783_4865_5875 | 306 |
| 91 | 3300050513 | nmdc:mga0rr50_15222_c1 | nmdc:mga0rr50_15222_c1_657_1673 | 306 |
| 92 | 3300028800 | Ga0265338_10002879 | Ga0265338_1000287923 | 307 |
| 93 | 3300031249 | Ga0265339_10006673 | Ga0265339_100066734 | 307 |
| 94 | 3300005437 | Ga0070710_10089800 | Ga0070710_100898002 | 308 |
| 95 | 3300025928 | Ga0207700_10062335 | Ga0207700_100623352 | 308 |
| 96 | 3300025929 | Ga0207664_10004921 | Ga0207664_100049215 | 308 |
| 97 | 3300028800 | Ga0265338_10259188 | Ga0265338_102591881 | 308 |
| 98 | 3300045976 | Ga0466967_0436472 | Ga0466967_0436472_103_1170 | 308 |
| 99 | 3300031712 | Ga0265342_10070193 | Ga0265342_100701931 | 309 |
| 100 | 3300046684 | Ga0495669_0017677 | Ga0495669_0017677_220_1251 | 309 |
| 101 | 3300037471 | Ga0395905_0016093 | Ga0395905_0016093_884_1855 | 310 |
| 102 | 3300044694 | Ga0466963_0019878 | Ga0466963_0019878_2145_3143 | 310 |
| 103 | 3300046664 | Ga0495659_0021910 | Ga0495659_0021910_146_1231 | 310 |
| 104 | 3300005435 | Ga0070714_100063060 | Ga0070714_1000630602 | 312 |
| 105 | 3300005436 | Ga0070713_100001648 | Ga0070713_1000016489 | 312 |
| 106 | 3300005439 | Ga0070711_100001709 | Ga0070711_1000017095 | 312 |
| 107 | 3300006028 | Ga0070717_10002200 | Ga0070717_100022007 | 312 |
| 108 | 3300006175 | Ga0070712_100001404 | Ga0070712_1000014043 | 312 |
| 109 | 3300007788 | Ga0099795_10015577 | Ga0099795_100155772 | 312 |
| 110 | 3300013105 | Ga0157369_10000972 | Ga0157369_1000097234 | 312 |
| 111 | 3300025915 | Ga0207693_10000053 | Ga0207693_1000005353 | 312 |
| 112 | 3300025916 | Ga0207663_10002430 | Ga0207663_100024303 | 312 |
| 113 | 3300025928 | Ga0207700_10000674 | Ga0207700_100006749 | 312 |
| 114 | 3300035113 | Ga0373936_0017336 | Ga0373936_0017336_594_1676 | 312 |
| 115 | 3300047319 | Ga0495674_0051459 | Ga0495674_0051459_2380_3462 | 312 |
| 116 | 3300048907 | Ga0496104_0114362 | Ga0496104_0114362_830_1912 | 312 |
| 117 | 3300053077 | Ga0495601_0010401 | Ga0495601_0010401_2206_3288 | 312 |
| 118 | 3300005435 | Ga0070714_100000040 | Ga0070714_10000004012 | 313 |
| 119 | 3300005439 | Ga0070711_100006344 | Ga0070711_1000063446 | 313 |
| 120 | 3300005439 | Ga0070711_100142996 | Ga0070711_1001429962 | 313 |
| 121 | 3300005614 | Ga0068856_100003015 | Ga0068856_10000301512 | 313 |
| 122 | 3300006028 | Ga0070717_10062241 | Ga0070717_100622412 | 313 |
| 123 | 3300025916 | Ga0207663_10044209 | Ga0207663_100442092 | 313 |
| 124 | 3300025929 | Ga0207664_10000029 | Ga0207664_1000002994 | 313 |
| 125 | 3300026078 | Ga0207702_10145462 | Ga0207702_101454622 | 313 |
| 126 | 3300035117 | Ga0373953_0016320 | Ga0373953_0016320_786_1859 | 313 |
| 127 | 3300035118 | Ga0373954_0021198 | Ga0373954_0021198_1432_2505 | 313 |
| 128 | 3300037471 | Ga0395905_0059349 | Ga0395905_0059349_412_1422 | 313 |
| 129 | 3300044694 | Ga0466963_0161721 | Ga0466963_0161721_541_1536 | 313 |
| 130 | 3300046463 | Ga0495653_0081792 | Ga0495653_0081792_983_2056 | 313 |
| 131 | 3300046663 | Ga0495635_0033197 | Ga0495635_0033197_243_1316 | 313 |
| 132 | 3300005536 | Ga0070697_100007086 | Ga0070697_1000070861 | 314 |
| 133 | 3300005546 | Ga0070696_100057526 | Ga0070696_1000575262 | 314 |
| 134 | 3300006847 | Ga0075431_100307333 | Ga0075431_1003073332 | 314 |
| 135 | 3300009147 | Ga0114129_10125206 | Ga0114129_101252061 | 314 |
| 136 | 3300035083 | Ga0373926_0026949 | Ga0373926_0026949_344_1417 | 314 |
| 137 | 3300035086 | Ga0373934_0002314 | Ga0373934_0002314_176_1249 | 314 |
| 138 | 3300035113 | Ga0373936_0042522 | Ga0373936_0042522_729_1802 | 314 |
| 139 | 3300035116 | Ga0373945_0004112 | Ga0373945_0004112_900_1973 | 314 |
| 140 | 3300035170 | Ga0373943_0000157 | Ga0373943_0000157_16864_17937 | 314 |
| 141 | 3300035695 | Ga0373927_0000070 | Ga0373927_0000070_70405_71478 | 314 |
| 142 | 3300035725 | Ga0373947_0001581 | Ga0373947_0001581_5420_6493 | 314 |
| 143 | 3300037068 | Ga0373925_0001522 | Ga0373925_0001522_2921_3994 | 314 |
| 144 | 3300037853 | Ga0436364_0415424 | Ga0436364_0415424_491_1507 | 314 |
| 145 | 3300039450 | Ga0436363_0502718 | Ga0436363_0502718_2995_4011 | 314 |
| 146 | 3300050507 | nmdc:mga05p37_197412_c1 | nmdc:mga05p37_197412_c1_1089_2099 | 314 |
| 147 | 3300053078 | Ga0495612_0025457 | Ga0495612_0025457_552_1625 | 314 |
| 148 | 3300006028 | Ga0070717_10161491 | Ga0070717_101614911 | 315 |
| 149 | 3300046472 | Ga0495580_0044959 | Ga0495580_0044959_433_1443 | 315 |
| 150 | 3300005434 | Ga0070709_10004888 | Ga0070709_100048883 | 316 |
| 151 | 3300005436 | Ga0070713_100000634 | Ga0070713_1000006342 | 316 |
| 152 | 3300005445 | Ga0070708_100000770 | Ga0070708_10000077014 | 316 |
| 153 | 3300005467 | Ga0070706_100046590 | Ga0070706_1000465904 | 316 |
| 154 | 3300005468 | Ga0070707_100121152 | Ga0070707_1001211523 | 316 |
| 155 | 3300005471 | Ga0070698_100014191 | Ga0070698_1000141912 | 316 |
| 156 | 3300005518 | Ga0070699_100000648 | Ga0070699_10000064822 | 316 |
| 157 | 3300005536 | Ga0070697_100022280 | Ga0070697_1000222805 | 316 |
| 158 | 3300006028 | Ga0070717_10027909 | Ga0070717_100279091 | 316 |
| 159 | 3300006175 | Ga0070712_100003230 | Ga0070712_10000323011 | 316 |
| 160 | 3300014325 | Ga0163163_10012732 | Ga0163163_100127322 | 316 |
| 161 | 3300025906 | Ga0207699_10001094 | Ga0207699_100010947 | 316 |
| 162 | 3300025910 | Ga0207684_10000203 | Ga0207684_1000020369 | 316 |
| 163 | 3300025915 | Ga0207693_10000071 | Ga0207693_1000007177 | 316 |
| 164 | 3300025922 | Ga0207646_10007618 | Ga0207646_100076184 | 316 |
| 165 | 3300025928 | Ga0207700_10000153 | Ga0207700_1000015334 | 316 |
| 166 | 3300035119 | Ga0373956_0037277 | Ga0373956_0037277_575_1600 | 316 |
| 167 | 3300046472 | Ga0495580_0001723 | Ga0495580_0001723_10228_11253 | 316 |
| 168 | 3300046535 | Ga0495586_0050885 | Ga0495586_0050885_751_1794 | 316 |
| 169 | 3300046543 | Ga0495645_0038674 | Ga0495645_0038674_1121_2164 | 316 |
| 170 | 3300047444 | Ga0495675_0009381 | Ga0495675_0009381_2676_3719 | 316 |
| 171 | 3300005467 | Ga0070706_100055949 | Ga0070706_1000559492 | 317 |
| 172 | 3300005471 | Ga0070698_100105357 | Ga0070698_1001053572 | 317 |
| 173 | 3300009093 | Ga0105240_10025067 | Ga0105240_100250675 | 317 |
| 174 | 3300013307 | Ga0157372_10009135 | Ga0157372_1000913510 | 317 |
| 175 | 3300025910 | Ga0207684_10068628 | Ga0207684_100686282 | 317 |
| 176 | 3300005445 | Ga0070708_100001110 | Ga0070708_1000011109 | 318 |
| 177 | 3300005536 | Ga0070697_100001964 | Ga0070697_1000019649 | 318 |
| 178 | 3300007788 | Ga0099795_10038390 | Ga0099795_100383902 | 318 |
| 179 | 3300009093 | Ga0105240_10032204 | Ga0105240_100322044 | 318 |
| 180 | 3300036401 | Ga0373937_0060353 | Ga0373937_0060353_320_1345 | 318 |
| 181 | 3300050513 | nmdc:mga0rr50_69928_c1 | nmdc:mga0rr50_69928_c1_897_1907 | 318 |
| 182 | 3300006173 | Ga0070716_100239706 | Ga0070716_1002397061 | 319 |
| 183 | 3300006914 | Ga0075436_100003071 | Ga0075436_1000030714 | 319 |
| 184 | 3300048905 | Ga0496102_0120059 | Ga0496102_0120059_1189_2265 | 319 |
| 185 | 3300005434 | Ga0070709_10078710 | Ga0070709_100787101 | 320 |
| 186 | 3300025916 | Ga0207663_10157038 | Ga0207663_101570382 | 320 |
| 187 | 3300028800 | Ga0265338_10102640 | Ga0265338_101026402 | 320 |
| 188 | 3300031241 | Ga0265325_10082105 | Ga0265325_100821052 | 320 |
| 189 | 3300031249 | Ga0265339_10147327 | Ga0265339_101473271 | 320 |
| 190 | 3300045976 | Ga0466967_0000853 | Ga0466967_0000853_9870_10871 | 320 |
| 191 | 3300005293 | Ga0065715_10022507 | Ga0065715_100225072 | 321 |
| 192 | 3300005329 | Ga0070683_100042539 | Ga0070683_1000425394 | 321 |
| 193 | 3300005339 | Ga0070660_100021423 | Ga0070660_1000214232 | 321 |
| 194 | 3300005353 | Ga0070669_100104915 | Ga0070669_1001049152 | 321 |
| 195 | 3300005366 | Ga0070659_100092743 | Ga0070659_1000927432 | 321 |
| 196 | 3300005436 | Ga0070713_100354308 | Ga0070713_1003543081 | 321 |
| 197 | 3300005458 | Ga0070681_10131417 | Ga0070681_101314172 | 321 |
| 198 | 3300005616 | Ga0068852_100157998 | Ga0068852_1001579982 | 321 |
| 199 | 3300006028 | Ga0070717_10094833 | Ga0070717_100948332 | 321 |
| 200 | 3300009093 | Ga0105240_10257169 | Ga0105240_102571692 | 321 |
| 201 | 3300009174 | Ga0105241_10021251 | Ga0105241_100212514 | 321 |
| 202 | 3300009545 | Ga0105237_10087930 | Ga0105237_100879302 | 321 |
| 203 | 3300009551 | Ga0105238_10062827 | Ga0105238_100628273 | 321 |
| 204 | 3300010375 | Ga0105239_10055366 | Ga0105239_100553664 | 321 |
| 205 | 3300013100 | Ga0157373_10007420 | Ga0157373_100074208 | 321 |
| 206 | 3300013104 | Ga0157370_10295776 | Ga0157370_102957761 | 321 |
| 207 | 3300013105 | Ga0157369_10073254 | Ga0157369_100732542 | 321 |
| 208 | 3300013296 | Ga0157374_10049886 | Ga0157374_100498863 | 321 |
| 209 | 3300013297 | Ga0157378_10055104 | Ga0157378_100551043 | 321 |
| 210 | 3300013307 | Ga0157372_10080023 | Ga0157372_100800233 | 321 |
| 211 | 3300014497 | Ga0182008_10031987 | Ga0182008_100319872 | 321 |
| 212 | 3300015261 | Ga0182006_1035216 | Ga0182006_10352163 | 321 |
| 213 | 3300015262 | Ga0182007_10002598 | Ga0182007_100025982 | 321 |
| 214 | 3300025913 | Ga0207695_10056074 | Ga0207695_100560744 | 321 |
| 215 | 3300025928 | Ga0207700_10016956 | Ga0207700_100169562 | 321 |
| 216 | 3300045976 | Ga0466967_0011128 | Ga0466967_0011128_5502_6551 | 321 |
| 217 | 3300048906 | Ga0496103_0024690 | Ga0496103_0024690_1518_2534 | 321 |
| 218 | 3300048907 | Ga0496104_0290253 | Ga0496104_0290253_248_1264 | 321 |
| 219 | 3300048909 | Ga0496106_0269793 | Ga0496106_0269793_13_1029 | 321 |
| 220 | 3300048910 | Ga0496107_0289539 | Ga0496107_0289539_173_1189 | 321 |
| 221 | 3300048911 | Ga0496108_0029739 | Ga0496108_0029739_869_1885 | 321 |
| 222 | 3300005445 | Ga0070708_100018478 | Ga0070708_1000184784 | 322 |
| 223 | 3300005467 | Ga0070706_100316637 | Ga0070706_1003166372 | 322 |
| 224 | 3300005468 | Ga0070707_100069530 | Ga0070707_1000695303 | 322 |
| 225 | 3300025910 | Ga0207684_10028393 | Ga0207684_100283935 | 322 |
| 226 | 3300005458 | Ga0070681_10014888 | Ga0070681_100148883 | 323 |
| 227 | 3300005530 | Ga0070679_100297197 | Ga0070679_1002971971 | 323 |
| 228 | 3300005614 | Ga0068856_100220773 | Ga0068856_1002207732 | 323 |
| 229 | 3300025906 | Ga0207699_10072891 | Ga0207699_100728912 | 323 |
| 230 | 3300025912 | Ga0207707_10023254 | Ga0207707_100232543 | 323 |
| 231 | 3300025915 | Ga0207693_10092010 | Ga0207693_100920102 | 323 |
| 232 | 3300025921 | Ga0207652_10168181 | Ga0207652_101681812 | 323 |
| 233 | 3300025939 | Ga0207665_10005766 | Ga0207665_100057664 | 323 |
| 234 | 3300026078 | Ga0207702_10192262 | Ga0207702_101922622 | 323 |
| 235 | 3300006028 | Ga0070717_10003006 | Ga0070717_1000300612 | 325 |
| 236 | 3300025910 | Ga0207684_10024604 | Ga0207684_100246042 | 325 |
| 237 | 3300025922 | Ga0207646_10042821 | Ga0207646_100428211 | 325 |
| 238 | 3300025939 | Ga0207665_10041895 | Ga0207665_100418954 | 325 |
| 239 | 3300039437 | Ga0436365_1855381 | Ga0436365_1855381_324_1391 | 326 |
| 240 | 3300005435 | Ga0070714_100229923 | Ga0070714_1002299232 | 327 |
| 241 | 3300005445 | Ga0070708_100224515 | Ga0070708_1002245151 | 327 |
| 242 | 3300005467 | Ga0070706_100001381 | Ga0070706_1000013811 | 327 |
| 243 | 3300005471 | Ga0070698_100000336 | Ga0070698_10000033621 | 327 |
| 244 | 3300005518 | Ga0070699_100333501 | Ga0070699_1003335012 | 327 |
| 245 | 3300005536 | Ga0070697_100002439 | Ga0070697_1000024396 | 327 |
| 246 | 3300005536 | Ga0070697_100084638 | Ga0070697_1000846381 | 327 |
| 247 | 3300021388 | Ga0213875_10059832 | Ga0213875_100598321 | 327 |
| 248 | 3300025910 | Ga0207684_10005498 | Ga0207684_100054983 | 327 |
| 249 | 3300025922 | Ga0207646_10006813 | Ga0207646_100068137 | 327 |
| 250 | 2162886012 | MBSR1b_contig_9211755 | MBSR1b_0520.00004030 | 330 |
| 251 | 3300002239 | JGI24034J26672_10011554 | JGI24034J26672_100115542 | 330 |
| 252 | 3300002459 | JGI24751J29686_10001372 | JGI24751J29686_100013723 | 330 |
| 253 | 3300005293 | Ga0065715_10102599 | Ga0065715_101025993 | 330 |
| 254 | 3300005328 | Ga0070676_10001539 | Ga0070676_100015398 | 330 |
| 255 | 3300005329 | Ga0070683_100003068 | Ga0070683_10000306811 | 330 |
| 256 | 3300005331 | Ga0070670_100010978 | Ga0070670_1000109784 | 330 |
| 257 | 3300005331 | Ga0070670_100043040 | Ga0070670_1000430403 | 330 |
| 258 | 3300005333 | Ga0070677_10005728 | Ga0070677_100057281 | 330 |
| 259 | 3300005334 | Ga0068869_100113480 | Ga0068869_1001134803 | 330 |
| 260 | 3300005336 | Ga0070680_100247067 | Ga0070680_1002470672 | 330 |
| 261 | 3300005338 | Ga0068868_100002828 | Ga0068868_1000028288 | 330 |
| 262 | 3300005338 | Ga0068868_100036578 | Ga0068868_1000365783 | 330 |
| 263 | 3300005344 | Ga0070661_100000564 | Ga0070661_10000056411 | 330 |
| 264 | 3300005347 | Ga0070668_100010468 | Ga0070668_1000104683 | 330 |
| 265 | 3300005354 | Ga0070675_100011704 | Ga0070675_1000117044 | 330 |
| 266 | 3300005364 | Ga0070673_100011141 | Ga0070673_1000111416 | 330 |
| 267 | 3300005365 | Ga0070688_100000761 | Ga0070688_1000007615 | 330 |
| 268 | 3300005366 | Ga0070659_100003196 | Ga0070659_1000031964 | 330 |
| 269 | 3300005367 | Ga0070667_100048424 | Ga0070667_1000484242 | 330 |
| 270 | 3300005455 | Ga0070663_100005971 | Ga0070663_1000059714 | 330 |
| 271 | 3300005459 | Ga0068867_100001635 | Ga0068867_10000163510 | 330 |
| 272 | 3300005466 | Ga0070685_10003192 | Ga0070685_100031924 | 330 |
| 273 | 3300005535 | Ga0070684_100001979 | Ga0070684_10000197912 | 330 |
| 274 | 3300005539 | Ga0068853_100034605 | Ga0068853_1000346053 | 330 |
| 275 | 3300005544 | Ga0070686_100005119 | Ga0070686_1000051193 | 330 |
| 276 | 3300005564 | Ga0070664_100017332 | Ga0070664_1000173323 | 330 |
| 277 | 3300005616 | Ga0068852_100006298 | Ga0068852_1000062984 | 330 |
| 278 | 3300005718 | Ga0068866_10005966 | Ga0068866_100059662 | 330 |
| 279 | 3300005719 | Ga0068861_100139985 | Ga0068861_1001399853 | 330 |
| 280 | 3300005834 | Ga0068851_10003451 | Ga0068851_100034513 | 330 |
| 281 | 3300005842 | Ga0068858_100012401 | Ga0068858_1000124013 | 330 |
| 282 | 3300005843 | Ga0068860_100068076 | Ga0068860_1000680763 | 330 |
| 283 | 3300005844 | Ga0068862_100003832 | Ga0068862_1000038327 | 330 |
| 284 | 3300006881 | Ga0068865_100016958 | Ga0068865_1000169585 | 330 |
| 285 | 3300009092 | Ga0105250_10016650 | Ga0105250_100166502 | 330 |
| 286 | 3300009098 | Ga0105245_10006534 | Ga0105245_100065344 | 330 |
| 287 | 3300009101 | Ga0105247_10001438 | Ga0105247_1000143811 | 330 |
| 288 | 3300009176 | Ga0105242_10001741 | Ga0105242_100017413 | 330 |
| 289 | 3300009177 | Ga0105248_10080828 | Ga0105248_100808284 | 330 |
| 290 | 3300009545 | Ga0105237_10007944 | Ga0105237_100079445 | 330 |
| 291 | 3300009553 | Ga0105249_10029432 | Ga0105249_100294321 | 330 |
| 292 | 3300010375 | Ga0105239_10011180 | Ga0105239_100111808 | 330 |
| 293 | 3300011119 | Ga0105246_10000398 | Ga0105246_100003985 | 330 |
| 294 | 3300013100 | Ga0157373_10041853 | Ga0157373_100418533 | 330 |
| 295 | 3300013102 | Ga0157371_10020562 | Ga0157371_100205621 | 330 |
| 296 | 3300013105 | Ga0157369_10207925 | Ga0157369_102079252 | 330 |
| 297 | 3300013296 | Ga0157374_10002566 | Ga0157374_100025665 | 330 |
| 298 | 3300013306 | Ga0163162_10093699 | Ga0163162_100936992 | 330 |
| 299 | 3300014745 | Ga0157377_10001486 | Ga0157377_100014864 | 330 |
| 300 | 3300014968 | Ga0157379_10008207 | Ga0157379_100082075 | 330 |
| 301 | 3300017792 | Ga0163161_10004168 | Ga0163161_100041686 | 330 |
| 302 | 3300025315 | Ga0207697_10003029 | Ga0207697_100030294 | 330 |
| 303 | 3300025321 | Ga0207656_10001918 | Ga0207656_100019183 | 330 |
| 304 | 3300025893 | Ga0207682_10006955 | Ga0207682_100069552 | 330 |
| 305 | 3300025901 | Ga0207688_10001958 | Ga0207688_100019583 | 330 |
| 306 | 3300025904 | Ga0207647_10003556 | Ga0207647_1000355610 | 330 |
| 307 | 3300025907 | Ga0207645_10000772 | Ga0207645_1000077212 | 330 |
| 308 | 3300025908 | Ga0207643_10000412 | Ga0207643_100004122 | 330 |
| 309 | 3300025918 | Ga0207662_10015393 | Ga0207662_100153932 | 330 |
| 310 | 3300025919 | Ga0207657_10003461 | Ga0207657_1000346112 | 330 |
| 311 | 3300025920 | Ga0207649_10000783 | Ga0207649_1000078314 | 330 |
| 312 | 3300025925 | Ga0207650_10000024 | Ga0207650_10000024224 | 330 |
| 313 | 3300025925 | Ga0207650_10105776 | Ga0207650_101057762 | 330 |
| 314 | 3300025926 | Ga0207659_10144718 | Ga0207659_101447182 | 330 |
| 315 | 3300025931 | Ga0207644_10080374 | Ga0207644_100803742 | 330 |
| 316 | 3300025933 | Ga0207706_10000578 | Ga0207706_1000057813 | 330 |
| 317 | 3300025936 | Ga0207670_10022323 | Ga0207670_100223233 | 330 |
| 318 | 3300025937 | Ga0207669_10126041 | Ga0207669_101260412 | 330 |
| 319 | 3300025938 | Ga0207704_10012354 | Ga0207704_100123543 | 330 |
| 320 | 3300025940 | Ga0207691_10000072 | Ga0207691_1000007230 | 330 |
| 321 | 3300025942 | Ga0207689_10001329 | Ga0207689_1000132917 | 330 |
| 322 | 3300025944 | Ga0207661_10000062 | Ga0207661_1000006214 | 330 |
| 323 | 3300025945 | Ga0207679_10000040 | Ga0207679_1000004085 | 330 |
| 324 | 3300025960 | Ga0207651_10017952 | Ga0207651_100179523 | 330 |
| 325 | 3300025961 | Ga0207712_10330907 | Ga0207712_103309072 | 330 |
| 326 | 3300025972 | Ga0207668_10031614 | Ga0207668_100316143 | 330 |
| 327 | 3300025981 | Ga0207640_10012599 | Ga0207640_100125992 | 330 |
| 328 | 3300025986 | Ga0207658_10008825 | Ga0207658_100088255 | 330 |
| 329 | 3300026023 | Ga0207677_10026055 | Ga0207677_100260551 | 330 |
| 330 | 3300026041 | Ga0207639_10023181 | Ga0207639_100231811 | 330 |
| 331 | 3300026067 | Ga0207678_10000208 | Ga0207678_100002085 | 330 |
| 332 | 3300026088 | Ga0207641_10000030 | Ga0207641_10000030158 | 330 |
| 333 | 3300026089 | Ga0207648_10000303 | Ga0207648_100003034 | 330 |
| 334 | 3300026095 | Ga0207676_10000256 | Ga0207676_1000025642 | 330 |
| 335 | 3300026116 | Ga0207674_10000069 | Ga0207674_1000006913 | 330 |
| 336 | 3300026118 | Ga0207675_100177354 | Ga0207675_1001773542 | 330 |
| 337 | 3300026121 | Ga0207683_10000662 | Ga0207683_100006621 | 330 |
| 338 | 3300028379 | Ga0268266_10002820 | Ga0268266_1000282012 | 330 |
| 339 | 3300028380 | Ga0268265_10004314 | Ga0268265_100043147 | 330 |
| 340 | 3300028381 | Ga0268264_10117553 | Ga0268264_101175532 | 330 |
| 341 | 3300048909 | Ga0496106_0252374 | Ga0496106_0252374_97_1089 | 330 |
| 342 | 3300048911 | Ga0496108_0000410 | Ga0496108_0000410_4251_5243 | 330 |
| 343 | 3300048913 | Ga0496110_0005663 | Ga0496110_0005663_8299_9291 | 330 |
| 344 | 3300048915 | Ga0496112_0000155 | Ga0496112_0000155_2324_3316 | 330 |
| 345 | 3300048916 | Ga0496113_0002103 | Ga0496113_0002103_7791_8783 | 330 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6nmi-assembly1.cif.gz_E | cryo-em structure of the human tfiih core complex | 0.8082 | 92 | 283 |
| 4cn9-assembly2.cif.gz_B | structure of proximal thread matrix protein 1 (ptmp1) from the mussel byssus with zinc occupied midas motif | 0.8007 | 84 | 291 |
| 8ebw-assembly1.cif.gz_E | initial dna-lesion (ap) binding by xpc and tfiih complex2 | 0.8001 | 92 | 283 |
| 8ft6-assembly1.cif.gz_A | the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone, ala-ala linker variant, sumo tag-free preparation. | 0.7996 | 95 | 285 |
| 6ro4-assembly1.cif.gz_D | structure of the core tfiih-xpa-dna complex | 0.7896 | 91 | 283 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q66H58_3_138_3.40.50.410 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain | 0.8926 | 96 | 163 | 3.40.50.410 |
| af_D3ZN64_788_986_3.40.50.410 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain | 0.8292 | 89 | 286 | 3.40.50.410 |
| af_A0A0P0WT04_289_392_3.40.50.410 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain | 0.8199 | 95 | 166 | 3.40.50.410 |
| af_A0A0P0XV48_261_417_3.40.50.410 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain | 0.8168 | 95 | 220 | 3.40.50.410 |
| af_X1WEX1_155_342_3.40.50.410 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain | 0.8168 | 92 | 286 | 3.40.50.410 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257VP29-F1-model_v4 | VWA domain-containing protein | 0.9625 | 43 | 330 |
|
| AF-A0A257VP29-F1-model_v4 | VWA domain-containing protein | 0.9592 | 43 | 330 |
|
| AF-A0A833HID0-F1-model_v4 | VWA domain-containing protein | 0.9533 | 43 | 326 |
|
| AF-A0A3N5GDP9-F1-model_v4 | VWA domain-containing protein | 0.9499 | 41 | 326 |
|
| AF-A0A2V7YYK7-F1-model_v4 | VWFA domain-containing protein | 0.9487 | 41 | 326 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar