F416161

General Info

Members Datasets Scaffolds Average Seq Length
344 234 688 97

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_818256_c1|nmdc:mga0yw44_818256_c1_96_389
Length 89
Sequence MFTGTLTFDLLLPGDSRSLKAKRSYLRPIVAALRRLEVAAAEVGAAELHGRAGTADHVGEVLDRCERLVAGRPEVELLSTRRRLHHDDD

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
143 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
144 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
145 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
189 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
190 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
191 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
192 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
195 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
196 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
197 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
198 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
199 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
200 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
201 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
202 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
203 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
204 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
205 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
206 2855683550 Micromonospora sp. RP3T Isolate Unclassified
207 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
208 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
209 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
210 2858868258 Micromonospora sp. MH33 Isolate Unclassified
211 2858882152 Micromonospora noduli MED15 Isolate Nodule
212 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
213 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
214 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
215 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
216 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
217 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
218 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
219 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
220 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
221 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
222 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
223 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
224 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
225 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
226 2902582711 Micromonospora sp. AP08 Isolate Unclassified
227 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
228 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
229 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
230 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
231 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
232 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
233 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
234 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.08
Metatranscriptomes 0.58
Isolates 11.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.49
Nodule 1.45
Rhizoplane 3.78
Rhizosphere 80.81
Stem 0
Stem Tuber 0
Unclassified 3.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_818256_c1 3300050492 Bacteria 632
2 JGI25406J46586_10267743 3300003203 Bacteria 504
3 Ga0070658_10606615 3300005327 Bacteria 949
4 Ga0070676_10658802 3300005328 Bacteria 761
5 Ga0070683_100099052 3300005329 Bacteria 2744
6 Ga0070683_100826807 3300005329 Bacteria 888
7 Ga0070670_100158649 3300005331 Bacteria 1960
8 Ga0068869_100005603 3300005334 Bacteria 7907
9 Ga0068869_100226013 3300005334 Bacteria 1485
10 Ga0070682_100269242 3300005337 Bacteria 1237
11 Ga0070682_100585307 3300005337 Bacteria 879
12 Ga0070682_100970230 3300005337 Bacteria 703
13 Ga0068868_100085685 3300005338 Bacteria 2532
14 Ga0068868_101295943 3300005338 Bacteria 676
15 Ga0070660_100025067 3300005339 Bacteria 4431
16 Ga0070691_10232699 3300005341 Bacteria 981
17 Ga0070687_100209627 3300005343 Bacteria 1186
18 Ga0070661_100007707 3300005344 Bacteria 7437
19 Ga0070661_100885875 3300005344 Bacteria 736
20 Ga0070692_10088826 3300005345 Bacteria 1677
21 Ga0070668_100074780 3300005347 Bacteria 2644
22 Ga0070668_101088296 3300005347 Bacteria 721
23 Ga0070669_100093437 3300005353 Bacteria 2259
24 Ga0070675_100315274 3300005354 Bacteria 1381
25 Ga0070674_100777409 3300005356 Bacteria 825
26 Ga0070659_100021661 3300005366 Bacteria 4899
27 Ga0070667_100117360 3300005367 Bacteria 2312
28 Ga0070714_100244343 3300005435 Bacteria 1658
29 Ga0070714_101141021 3300005435 Bacteria 760
30 Ga0070713_100266256 3300005436 Bacteria 1568
31 Ga0070710_10703822 3300005437 Bacteria 713
32 Ga0070701_10967849 3300005438 Unclassified 592
33 Ga0070700_100808763 3300005441 Unclassified 755
34 Ga0070694_100120464 3300005444 Bacteria 1882
35 Ga0070663_100024261 3300005455 Bacteria 4079
36 Ga0070678_100089990 3300005456 Bacteria 2351
37 Ga0070681_10138748 3300005458 Bacteria 2361
38 Ga0070681_10798664 3300005458 Bacteria 861
39 Ga0070679_100897251 3300005530 Bacteria 830
40 Ga0070679_100990583 3300005530 Bacteria 784
41 Ga0070679_101952187 3300005530 Unclassified 536
42 Ga0070684_100001375 3300005535 Bacteria 17480
43 Ga0070684_100102071 3300005535 Bacteria 2564
44 Ga0070684_100322322 3300005535 Bacteria 1419
45 Ga0068853_101687539 3300005539 Bacteria 614
46 Ga0068853_102056795 3300005539 Bacteria 554
47 Ga0070672_100377547 3300005543 Bacteria 1212
48 Ga0070686_101193404 3300005544 Bacteria 632
49 Ga0070695_100793546 3300005545 Bacteria 758
50 Ga0070693_100888276 3300005547 Bacteria 667
51 Ga0070664_100001631 3300005564 Bacteria 17957
52 Ga0070664_100164024 3300005564 Bacteria 1968
53 Ga0070664_101506452 3300005564 Unclassified 636
54 Ga0068857_100022409 3300005577 Bacteria 5557
55 Ga0068857_100072776 3300005577 Bacteria 3062
56 Ga0068857_100325385 3300005577 Bacteria 1420
57 Ga0068854_100589514 3300005578 Bacteria 948
58 Ga0068856_100796582 3300005614 Bacteria 965
59 Ga0070702_100064898 3300005615 Bacteria 2137
60 Ga0068852_100027051 3300005616 Bacteria 4670
61 Ga0068859_100062199 3300005617 Bacteria 3763
62 Ga0068859_100234143 3300005617 Bacteria 1925
63 Ga0068864_100006181 3300005618 Bacteria 9820
64 Ga0068864_101582519 3300005618 Bacteria 659
65 Ga0068861_100065355 3300005719 Bacteria 2802
66 Ga0068861_100305207 3300005719 Bacteria 1380
67 Ga0068870_10219505 3300005840 Bacteria 1163
68 Ga0068863_100025046 3300005841 Bacteria 5690
69 Ga0068863_100239120 3300005841 Bacteria 1753
70 Ga0068863_100482707 3300005841 Bacteria 1219
71 Ga0068863_102295167 3300005841 Unclassified 549
72 Ga0068858_100045122 3300005842 Bacteria 4084
73 Ga0068858_100112028 3300005842 Bacteria 2548
74 Ga0068858_101637125 3300005842 Unclassified 635
75 Ga0068860_100015364 3300005843 Bacteria 7480
76 Ga0068860_100647909 3300005843 Bacteria 1064
77 Ga0068862_100445892 3300005844 Bacteria 1219
78 Ga0068862_100553969 3300005844 Bacteria 1098
79 Ga0068862_101692999 3300005844 Bacteria 641
80 Ga0081540_1055919 3300005983 Bacteria 1919
81 Ga0081540_1242792 3300005983 Bacteria 631
82 Ga0081539_10000357 3300005985 Bacteria 100714
83 Ga0081539_10005461 3300005985 Bacteria 12962
84 Ga0081539_10073025 3300005985 Bacteria 1831
85 Ga0070717_10217372 3300006028 Bacteria 1679
86 Ga0075365_10931666 3300006038 Bacteria 612
87 Ga0070716_100013359 3300006173 Bacteria 4183
88 Ga0070716_100139254 3300006173 Bacteria 1545
89 Ga0070712_100837287 3300006175 Bacteria 791
90 Ga0075428_100692459 3300006844 Bacteria 1086
91 Ga0075428_100909887 3300006844 Bacteria 933
92 Ga0075428_101548817 3300006844 Bacteria 694
93 Ga0075428_101764739 3300006844 Bacteria 645
94 Ga0075430_100375772 3300006846 Bacteria 1173
95 Ga0075430_100507215 3300006846 Bacteria 995
96 Ga0075430_101658998 3300006846 Bacteria 525
97 Ga0075431_100046737 3300006847 Bacteria 4464
98 Ga0075431_100091397 3300006847 Bacteria 3142
99 Ga0075431_100104691 3300006847 Bacteria 2920
100 Ga0075431_100505721 3300006847 Bacteria 1199
101 Ga0075431_100770023 3300006847 Bacteria 937
102 Ga0075429_100060366 3300006880 Bacteria 3303
103 Ga0075429_100267611 3300006880 Bacteria 1497
104 Ga0075429_100376543 3300006880 Bacteria 1243
105 Ga0075429_100990656 3300006880 Bacteria 735
106 Ga0068865_100816759 3300006881 Bacteria 805
107 Ga0097620_100062201 3300006931 Bacteria 3763
108 Ga0097620_100234113 3300006931 Bacteria 1925
109 Ga0075435_100394912 3300007076 Bacteria 1189
110 Ga0111539_10010979 3300009094 Bacteria 11400
111 Ga0111539_13353519 3300009094 Bacteria 515
112 Ga0105245_10030325 3300009098 Bacteria 4782
113 Ga0114129_10930850 3300009147 Bacteria 1099
114 Ga0114129_11358663 3300009147 Bacteria 878
115 Ga0105243_10189595 3300009148 Bacteria 1795
116 Ga0105241_10632186 3300009174 Bacteria 970
117 Ga0105248_10265074 3300009177 Bacteria 1934
118 Ga0105248_11117094 3300009177 Bacteria 891
119 Ga0105249_10770979 3300009553 Bacteria 1025
120 Ga0105246_11509880 3300011119 Bacteria 631
121 Ga0157371_11346168 3300013102 Bacteria 553
122 Ga0157378_10266517 3300013297 Bacteria 1645
123 Ga0157372_12148023 3300013307 Bacteria 641
124 Ga0157375_10383489 3300013308 Bacteria 1572
125 Ga0163163_10015729 3300014325 Bacteria 7006
126 Ga0163163_10246323 3300014325 Bacteria 1837
127 Ga0163163_11865174 3300014325 Bacteria 661
128 Ga0157377_10009962 3300014745 Bacteria 4687
129 Ga0157379_10095485 3300014968 Bacteria 2668
130 Ga0157379_10361000 3300014968 Bacteria 1331
131 Ga0157379_10949280 3300014968 Unclassified 818
132 Ga0206356_11368051 3300020070 Bacteria 1021
133 Ga0206353_11843145 3300020082 Bacteria 631
134 Ga0207688_10221652 3300025901 Bacteria 1139
135 Ga0207645_10274294 3300025907 Bacteria 1119
136 Ga0207705_10779323 3300025909 Bacteria 742
137 Ga0207654_10352250 3300025911 Bacteria 1014
138 Ga0207707_10039233 3300025912 Bacteria 4140
139 Ga0207693_10068467 3300025915 Bacteria 2778
140 Ga0207657_10518592 3300025919 Bacteria 933
141 Ga0207649_10026800 3300025920 Bacteria 3375
142 Ga0207681_10093124 3300025923 Bacteria 2156
143 Ga0207650_10168589 3300025925 Bacteria 1739
144 Ga0207659_10004550 3300025926 Bacteria 8391
145 Ga0207659_10151263 3300025926 Bacteria 1813
146 Ga0207687_10015068 3300025927 Bacteria 5064
147 Ga0207700_10172079 3300025928 Bacteria 1807
148 Ga0207644_10177440 3300025931 Bacteria 1668
149 Ga0207709_10150995 3300025935 Bacteria 1609
150 Ga0207709_10758802 3300025935 Bacteria 780
151 Ga0207670_10687947 3300025936 Bacteria 846
152 Ga0207704_10677426 3300025938 Bacteria 852
153 Ga0207665_10138054 3300025939 Bacteria 1736
154 Ga0207665_11019582 3300025939 Bacteria 659
155 Ga0207691_10243138 3300025940 Bacteria 1555
156 Ga0207711_10265943 3300025941 Bacteria 1577
157 Ga0207689_10003715 3300025942 Bacteria 13912
158 Ga0207689_10081885 3300025942 Bacteria 2653
159 Ga0207661_10009951 3300025944 Bacteria 6831
160 Ga0207661_10112858 3300025944 Bacteria 2302
161 Ga0207661_10187695 3300025944 Bacteria 1811
162 Ga0207661_10688893 3300025944 Bacteria 940
163 Ga0207661_11663310 3300025944 Bacteria 583
164 Ga0207679_10017724 3300025945 Bacteria 4756
165 Ga0207679_10131000 3300025945 Bacteria 2012
166 Ga0207712_10551182 3300025961 Bacteria 992
167 Ga0207712_11484706 3300025961 Unclassified 607
168 Ga0207668_10287867 3300025972 Bacteria 1350
169 Ga0207668_11330415 3300025972 Bacteria 647
170 Ga0207640_10081930 3300025981 Bacteria 2208
171 Ga0207640_11149286 3300025981 Bacteria 689
172 Ga0207658_10093625 3300025986 Bacteria 2336
173 Ga0207677_10022820 3300026023 Bacteria 3853
174 Ga0207703_10068326 3300026035 Bacteria 2928
175 Ga0207703_10233076 3300026035 Bacteria 1652
176 Ga0207639_10467543 3300026041 Bacteria 1147
177 Ga0207639_10554193 3300026041 Bacteria 1056
178 Ga0207678_10016947 3300026067 Bacteria 6398
179 Ga0207678_10504592 3300026067 Bacteria 1055
180 Ga0207708_10174939 3300026075 Bacteria 1702
181 Ga0207708_10862828 3300026075 Unclassified 782
182 Ga0207702_10706244 3300026078 Bacteria 994
183 Ga0207641_10091826 3300026088 Bacteria 2658
184 Ga0207641_10397593 3300026088 Bacteria 1322
185 Ga0207676_10060816 3300026095 Bacteria 2989
186 Ga0207676_10394554 3300026095 Bacteria 1292
187 Ga0207676_10934612 3300026095 Bacteria 852
188 Ga0207676_11346160 3300026095 Bacteria 709
189 Ga0207676_11785409 3300026095 Bacteria 614
190 Ga0207674_10004071 3300026116 Bacteria 17712
191 Ga0207674_10355165 3300026116 Bacteria 1417
192 Ga0207675_100081533 3300026118 Bacteria 3033
193 Ga0207675_100159244 3300026118 Bacteria 2153
194 Ga0207683_10111112 3300026121 Bacteria 2454
195 Ga0207683_10739133 3300026121 Bacteria 913
196 Ga0207683_10835212 3300026121 Bacteria 855
197 Ga0207698_10012792 3300026142 Bacteria 5509
198 Ga0207428_10085365 3300027907 Bacteria 2458
199 Ga0268265_10021759 3300028380 Bacteria 4497
200 Ga0268265_10773353 3300028380 Unclassified 934
201 Ga0268265_10783018 3300028380 Bacteria 928
202 Ga0268264_10021176 3300028381 Bacteria 5311
203 Ga0268264_10418716 3300028381 Bacteria 1291
204 Ga0307515_10004496 3300028794 Bacteria 28853
205 Ga0307515_10593311 3300028794 Bacteria 718
206 Ga0307511_10263687 3300030521 Bacteria 814
207 Ga0307512_10162312 3300030522 Bacteria 1305
208 Ga0307508_10014482 3300031616 Bacteria 7193
209 Ga0307405_10010405 3300031731 Bacteria 4818
210 Ga0307413_10007503 3300031824 Bacteria 5072
211 Ga0307413_10633317 3300031824 Bacteria 880
212 Ga0307413_10660936 3300031824 Bacteria 863
213 Ga0307413_10861676 3300031824 Bacteria 766
214 Ga0307518_10014635 3300031838 Bacteria 5606
215 Ga0307410_10020844 3300031852 Bacteria 4020
216 Ga0307410_11577796 3300031852 Bacteria 580
217 Ga0307406_10003377 3300031901 Bacteria 8701
218 Ga0307407_10007045 3300031903 Bacteria 5061
219 Ga0307407_10673843 3300031903 Bacteria 777
220 Ga0307412_10202961 3300031911 Bacteria 1507
221 Ga0307409_100008873 3300031995 Bacteria 6136
222 Ga0307409_102921985 3300031995 Bacteria 505
223 Ga0307416_100004231 3300032002 Bacteria 8618
224 Ga0307416_101890741 3300032002 Bacteria 700
225 Ga0307416_103786798 3300032002 Bacteria 506
226 Ga0307411_10187270 3300032005 Bacteria 1577
227 Ga0307415_100000101 3300032126 Bacteria 36015
228 Ga0307415_100057753 3300032126 Bacteria 2668
229 Ga0307415_100107367 3300032126 Bacteria 2062
230 Ga0307415_100261729 3300032126 Bacteria 1412
231 Ga0307415_100403329 3300032126 Bacteria 1168
232 Ga0307415_101588399 3300032126 Bacteria 628
233 Ga0307507_10351677 3300033179 Bacteria 866
234 Ga0373946_0140186 3300035171 Bacteria 1120
235 Ga0373935_0102437 3300035692 Bacteria 1889
236 Ga0373947_0637989 3300035725 Bacteria 726
237 Ga0451791_1765316 3300041451 Bacteria 1734
238 Ga0451798_1037701 3300041458 Bacteria 634
239 Ga0451804_0281574 3300041463 Bacteria 590
240 Ga0451849_0365634 3300041505 Bacteria 1016
241 Ga0451853_0317859 3300041512 Bacteria 3974
242 Ga0439459_0173959 3300042438 Bacteria 575
243 Ga0466957_0316784 3300044842 Bacteria 1051
244 Ga0495582_0402631 3300046473 Bacteria 789
245 Ga0495662_0306570 3300046476 Bacteria 781
246 Ga0495594_0249390 3300046499 Bacteria 1011
247 Ga0495606_0002428 3300046507 Bacteria 21716
248 Ga0495630_0546602 3300046517 Bacteria 888
249 Ga0495668_0000103 3300046616 Bacteria 135853
250 Ga0495625_0000643 3300046660 Bacteria 50299
251 Ga0495683_0033216 3300047323 Bacteria 2627
252 Ga0496104_0014097 3300048907 Bacteria 7215
253 Ga0496105_0062287 3300048908 Bacteria 3078
254 Ga0496108_0116431 3300048911 Bacteria 2289
255 Ga0496109_0011696 3300048912 Bacteria 7548
256 Ga0496109_1127990 3300048912 Bacteria 721
257 Ga0496110_0008445 3300048913 Bacteria 8290
258 Ga0496111_0040936 3300048914 Bacteria 3324
259 Ga0496112_0045583 3300048915 Bacteria 4298
260 Ga0496112_0309413 3300048915 Bacteria 1525
261 Ga0496113_0015096 3300048916 Bacteria 5293
262 Ga0496126_0310888 3300048929 Bacteria 1297
263 Ga0501032_0076398 3300049569 Bacteria 2230
264 Ga0501034_0197211 3300049571 Bacteria 1973
265 Ga0501034_0288758 3300049571 Bacteria 1579
266 Ga0501036_0130591 3300049572 Bacteria 2121
267 Ga0501037_0033969 3300049573 Bacteria 3766
268 Ga0501039_0357462 3300049575 Bacteria 1147
269 Ga0501040_0306225 3300049576 Bacteria 1136
270 Ga0501043_0104596 3300049579 Bacteria 2225
271 Ga0501046_0033811 3300049580 Bacteria 4129
272 Ga0501047_0154744 3300049581 Bacteria 2167
273 Ga0501068_0360585 3300049584 Bacteria 935
274 Ga0501072_1281525 3300049588 Bacteria 568
275 Ga0501074_0152284 3300049590 Bacteria 1653
276 Ga0501035_0184734 3300049822 Bacteria 1795
277 Ga0501044_0035834 3300049823 Bacteria 5193
278 nmdc:mga03n38_808616_c1 3300050490 Bacteria 546
279 nmdc:mga00v17_280682_c1 3300050491 Bacteria 1081
280 nmdc:mga05p37_604367_c1 3300050507 Bacteria 1237
281 nmdc:mga05p37_698677_c1 3300050507 Bacteria 1127
282 nmdc:mga05p37_705225_c1 3300050507 Bacteria 1120
283 nmdc:mga05p37_9220_c1 3300050507 Bacteria 11662
284 nmdc:mga09592_1145058_c1 3300050508 Bacteria 645
285 nmdc:mga09592_1391174_c1 3300050508 Unclassified 574
286 nmdc:mga09592_55312_c1 3300050508 Bacteria 3353
287 nmdc:mga0qj67_32678_c1 3300050509 Bacteria 4059
288 nmdc:mga0qj67_560313_c1 3300050509 Bacteria 916
289 nmdc:mga06r32_127875_c1 3300050510 Bacteria 2510
290 nmdc:mga06r32_154426_c1 3300050510 Bacteria 2275
291 nmdc:mga06r32_281047_c1 3300050510 Bacteria 974
292 nmdc:mga06r32_433313_c1 3300050510 Bacteria 1295
293 nmdc:mga06r32_495375_c1 3300050510 Bacteria 1199
294 nmdc:mga06r32_50410_c1 3300050510 Bacteria 3982
295 nmdc:mga06r32_573466_c1 3300050510 Bacteria 1101
296 nmdc:mga08y16_18875_c1 3300050511 Bacteria 7264
297 nmdc:mga0n895_1046830_c1 3300050512 Bacteria 795
298 Ga0500646_0000037 3300053090 Bacteria 37584
299 Ga0500650_0334527 3300053098 Bacteria 665
300 Ga0500660_173656 3300053100 Bacteria 792
301 Ga0500594_0044845 3300053118 Bacteria 1224
302 Ga0500617_225903 3300053124 Bacteria 660
303 Ga0500568_0136707 3300053139 Bacteria 909
304 Ga0500577_0241555 3300053142 Bacteria 784
305 Ga0500588_0021824 3300053146 Bacteria 1734
306 2515497093 2515154088 Bacteria 5526283
307 2515721911 2515154129 Bacteria 5584369
308 2515757050 2515154137 Bacteria 5711575
309 2516085832 2515154202 Bacteria 5471270
310 2516091196 2515154203 Bacteria 5458536
311 2753264652 2751185782 Bacteria 11227053
312 2831937946 2831935698 Bacteria 5963223
313 2832007566 2832004796 Bacteria 6538017
314 2855670991 2855670206 Bacteria 7120389
315 2855682190 2855676851 Bacteria 7063653
316 2855689347 2855683550 Bacteria 7134265
317 2856861132 2856858025 Bacteria 7255264
318 2857292398 2857288857 Bacteria 7189066
319 2858853064 2858848962 Bacteria 6963058
320 2858869063 2858868258 Bacteria 7683772
321 2858884152 2858882152 Bacteria 7230291
322 2858889695 2858888857 Bacteria 7060307
323 2858896615 2858895516 Bacteria 7378898
324 2858903842 2858902515 Bacteria 7086037
325 2861520697 2861520306 Bacteria 8348283
326 2866071015 2866065130 Bacteria 6518152
327 2867304799 2867302475 Bacteria 7087181
328 2867315588 2867312974 Bacteria 7058875
329 2867324448 2867319477 Bacteria 7069771
330 2867507785 2867507094 Bacteria 6506033
331 2869051710 2869048445 Bacteria 6875584
332 2869068517 2869061728 Bacteria 7112407
333 2869073724 2869068681 Bacteria 7205615
334 2880492977 2880489317 Bacteria 7096270
335 2880499329 2880495981 Bacteria 7340502
336 2902587948 2902582711 Bacteria 6187705
337 2929221305 2929219909 Bacteria 6984360
338 2929227927 2929226422 Bacteria 7248583
339 2996226592 2996221748 Bacteria 6799777
340 8003832300 8003830390 Bacteria 6541657
341 8003857884 8003856774 Bacteria 7675274
342 8054710403 8054704163 Bacteria 7247792
343 8054731976 8054727385 Bacteria 7558670
344 8054739098 8054734606 Bacteria 6947278
345 nmdc:mga0yw44_818256_c1
346 JGI25406J46586_10267743
347 Ga0070658_10606615
348 Ga0070676_10658802
349 Ga0070683_100099052
350 Ga0070683_100826807
351 Ga0070670_100158649
352 Ga0068869_100005603
353 Ga0068869_100226013
354 Ga0070682_100269242
355 Ga0070682_100585307
356 Ga0070682_100970230
357 Ga0068868_100085685
358 Ga0068868_101295943
359 Ga0070660_100025067
360 Ga0070691_10232699
361 Ga0070687_100209627
362 Ga0070661_100007707
363 Ga0070661_100885875
364 Ga0070692_10088826
365 Ga0070668_100074780
366 Ga0070668_101088296
367 Ga0070669_100093437
368 Ga0070675_100315274
369 Ga0070674_100777409
370 Ga0070659_100021661
371 Ga0070667_100117360
372 Ga0070714_100244343
373 Ga0070714_101141021
374 Ga0070713_100266256
375 Ga0070710_10703822
376 Ga0070701_10967849
377 Ga0070700_100808763
378 Ga0070694_100120464
379 Ga0070663_100024261
380 Ga0070678_100089990
381 Ga0070681_10138748
382 Ga0070681_10798664
383 Ga0070679_100897251
384 Ga0070679_100990583
385 Ga0070679_101952187
386 Ga0070684_100001375
387 Ga0070684_100102071
388 Ga0070684_100322322
389 Ga0068853_101687539
390 Ga0068853_102056795
391 Ga0070672_100377547
392 Ga0070686_101193404
393 Ga0070695_100793546
394 Ga0070693_100888276
395 Ga0070664_100001631
396 Ga0070664_100164024
397 Ga0070664_101506452
398 Ga0068857_100022409
399 Ga0068857_100072776
400 Ga0068857_100325385
401 Ga0068854_100589514
402 Ga0068856_100796582
403 Ga0070702_100064898
404 Ga0068852_100027051
405 Ga0068859_100062199
406 Ga0068859_100234143
407 Ga0068864_100006181
408 Ga0068864_101582519
409 Ga0068861_100065355
410 Ga0068861_100305207
411 Ga0068870_10219505
412 Ga0068863_100025046
413 Ga0068863_100239120
414 Ga0068863_100482707
415 Ga0068863_102295167
416 Ga0068858_100045122
417 Ga0068858_100112028
418 Ga0068858_101637125
419 Ga0068860_100015364
420 Ga0068860_100647909
421 Ga0068862_100445892
422 Ga0068862_100553969
423 Ga0068862_101692999
424 Ga0081540_1055919
425 Ga0081540_1242792
426 Ga0081539_10000357
427 Ga0081539_10005461
428 Ga0081539_10073025
429 Ga0070717_10217372
430 Ga0075365_10931666
431 Ga0070716_100013359
432 Ga0070716_100139254
433 Ga0070712_100837287
434 Ga0075428_100692459
435 Ga0075428_100909887
436 Ga0075428_101548817
437 Ga0075428_101764739
438 Ga0075430_100375772
439 Ga0075430_100507215
440 Ga0075430_101658998
441 Ga0075431_100046737
442 Ga0075431_100091397
443 Ga0075431_100104691
444 Ga0075431_100505721
445 Ga0075431_100770023
446 Ga0075429_100060366
447 Ga0075429_100267611
448 Ga0075429_100376543
449 Ga0075429_100990656
450 Ga0068865_100816759
451 Ga0097620_100062201
452 Ga0097620_100234113
453 Ga0075435_100394912
454 Ga0111539_10010979
455 Ga0111539_13353519
456 Ga0105245_10030325
457 Ga0114129_10930850
458 Ga0114129_11358663
459 Ga0105243_10189595
460 Ga0105241_10632186
461 Ga0105248_10265074
462 Ga0105248_11117094
463 Ga0105249_10770979
464 Ga0105246_11509880
465 Ga0157371_11346168
466 Ga0157378_10266517
467 Ga0157372_12148023
468 Ga0157375_10383489
469 Ga0163163_10015729
470 Ga0163163_10246323
471 Ga0163163_11865174
472 Ga0157377_10009962
473 Ga0157379_10095485
474 Ga0157379_10361000
475 Ga0157379_10949280
476 Ga0206356_11368051
477 Ga0206353_11843145
478 Ga0207688_10221652
479 Ga0207645_10274294
480 Ga0207705_10779323
481 Ga0207654_10352250
482 Ga0207707_10039233
483 Ga0207693_10068467
484 Ga0207657_10518592
485 Ga0207649_10026800
486 Ga0207681_10093124
487 Ga0207650_10168589
488 Ga0207659_10004550
489 Ga0207659_10151263
490 Ga0207687_10015068
491 Ga0207700_10172079
492 Ga0207644_10177440
493 Ga0207709_10150995
494 Ga0207709_10758802
495 Ga0207670_10687947
496 Ga0207704_10677426
497 Ga0207665_10138054
498 Ga0207665_11019582
499 Ga0207691_10243138
500 Ga0207711_10265943
501 Ga0207689_10003715
502 Ga0207689_10081885
503 Ga0207661_10009951
504 Ga0207661_10112858
505 Ga0207661_10187695
506 Ga0207661_10688893
507 Ga0207661_11663310
508 Ga0207679_10017724
509 Ga0207679_10131000
510 Ga0207712_10551182
511 Ga0207712_11484706
512 Ga0207668_10287867
513 Ga0207668_11330415
514 Ga0207640_10081930
515 Ga0207640_11149286
516 Ga0207658_10093625
517 Ga0207677_10022820
518 Ga0207703_10068326
519 Ga0207703_10233076
520 Ga0207639_10467543
521 Ga0207639_10554193
522 Ga0207678_10016947
523 Ga0207678_10504592
524 Ga0207708_10174939
525 Ga0207708_10862828
526 Ga0207702_10706244
527 Ga0207641_10091826
528 Ga0207641_10397593
529 Ga0207676_10060816
530 Ga0207676_10394554
531 Ga0207676_10934612
532 Ga0207676_11346160
533 Ga0207676_11785409
534 Ga0207674_10004071
535 Ga0207674_10355165
536 Ga0207675_100081533
537 Ga0207675_100159244
538 Ga0207683_10111112
539 Ga0207683_10739133
540 Ga0207683_10835212
541 Ga0207698_10012792
542 Ga0207428_10085365
543 Ga0268265_10021759
544 Ga0268265_10773353
545 Ga0268265_10783018
546 Ga0268264_10021176
547 Ga0268264_10418716
548 Ga0307515_10004496
549 Ga0307515_10593311
550 Ga0307511_10263687
551 Ga0307512_10162312
552 Ga0307508_10014482
553 Ga0307405_10010405
554 Ga0307413_10007503
555 Ga0307413_10633317
556 Ga0307413_10660936
557 Ga0307413_10861676
558 Ga0307518_10014635
559 Ga0307410_10020844
560 Ga0307410_11577796
561 Ga0307406_10003377
562 Ga0307407_10007045
563 Ga0307407_10673843
564 Ga0307412_10202961
565 Ga0307409_100008873
566 Ga0307409_102921985
567 Ga0307416_100004231
568 Ga0307416_101890741
569 Ga0307416_103786798
570 Ga0307411_10187270
571 Ga0307415_100000101
572 Ga0307415_100057753
573 Ga0307415_100107367
574 Ga0307415_100261729
575 Ga0307415_100403329
576 Ga0307415_101588399
577 Ga0307507_10351677
578 Ga0373946_0140186
579 Ga0373935_0102437
580 Ga0373947_0637989
581 Ga0451791_1765316
582 Ga0451798_1037701
583 Ga0451804_0281574
584 Ga0451849_0365634
585 Ga0451853_0317859
586 Ga0439459_0173959
587 Ga0466957_0316784
588 Ga0495582_0402631
589 Ga0495662_0306570
590 Ga0495594_0249390
591 Ga0495606_0002428
592 Ga0495630_0546602
593 Ga0495668_0000103
594 Ga0495625_0000643
595 Ga0495683_0033216
596 Ga0496104_0014097
597 Ga0496105_0062287
598 Ga0496108_0116431
599 Ga0496109_0011696
600 Ga0496109_1127990
601 Ga0496110_0008445
602 Ga0496111_0040936
603 Ga0496112_0045583
604 Ga0496112_0309413
605 Ga0496113_0015096
606 Ga0496126_0310888
607 Ga0501032_0076398
608 Ga0501034_0197211
609 Ga0501034_0288758
610 Ga0501036_0130591
611 Ga0501037_0033969
612 Ga0501039_0357462
613 Ga0501040_0306225
614 Ga0501043_0104596
615 Ga0501046_0033811
616 Ga0501047_0154744
617 Ga0501068_0360585
618 Ga0501072_1281525
619 Ga0501074_0152284
620 Ga0501035_0184734
621 Ga0501044_0035834
622 nmdc:mga03n38_808616_c1
623 nmdc:mga00v17_280682_c1
624 nmdc:mga05p37_604367_c1
625 nmdc:mga05p37_698677_c1
626 nmdc:mga05p37_705225_c1
627 nmdc:mga05p37_9220_c1
628 nmdc:mga09592_1145058_c1
629 nmdc:mga09592_1391174_c1
630 nmdc:mga09592_55312_c1
631 nmdc:mga0qj67_32678_c1
632 nmdc:mga0qj67_560313_c1
633 nmdc:mga06r32_127875_c1
634 nmdc:mga06r32_154426_c1
635 nmdc:mga06r32_281047_c1
636 nmdc:mga06r32_433313_c1
637 nmdc:mga06r32_495375_c1
638 nmdc:mga06r32_50410_c1
639 nmdc:mga06r32_573466_c1
640 nmdc:mga08y16_18875_c1
641 nmdc:mga0n895_1046830_c1
642 Ga0500646_0000037
643 Ga0500650_0334527
644 Ga0500660_173656
645 Ga0500594_0044845
646 Ga0500617_225903
647 Ga0500568_0136707
648 Ga0500577_0241555
649 Ga0500588_0021824
650 2515497093
651 2515721911
652 2515757050
653 2516085832
654 2516091196
655 2753264652
656 2831937946
657 2832007566
658 2855670991
659 2855682190
660 2855689347
661 2856861132
662 2857292398
663 2858853064
664 2858869063
665 2858884152
666 2858889695
667 2858896615
668 2858903842
669 2861520697
670 2866071015
671 2867304799
672 2867315588
673 2867324448
674 2867507785
675 2869051710
676 2869068517
677 2869073724
678 2880492977
679 2880499329
680 2902587948
681 2929221305
682 2929227927
683 2996226592
684 8003832300
685 8003857884
686 8054710403
687 8054731976
688 8054739098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04456

DUF503

Protein of unknown function (DUF503)

3

82

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j27-assembly1.cif.gz_A crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution 0.9367 2 93
1j27-assembly1.cif.gz_A crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution 0.8726 2 93
7qh2-assembly1.cif.gz_F cryo-em structure of ldh-etfab complex from acetobacterium woodii 0.7843 5 76
7b90-assembly1.cif.gz_E circular permutant of ribosomal protein s6, p54-55 truncated, i8a mutant 0.7388 4 91
2iyg-assembly1.cif.gz_B dark state structure of the bluf domain of the rhodobacterial protein appa 0.7067 1 91
ID Description Score Start End Superfamily
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9575 1 96 3.30.70.1120
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9479 1 96 3.30.70.1120
1j27A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9368 2 93 3.30.70.1120
1j27A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.8727 2 93 3.30.70.1120
af_Q7TNG8_361_443_3.30.70.2740 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7421 5 80 3.30.70.2740
ID Description Score Start End GO Terms
AF-A0A1C5GRL1-F1-model_v4 DUF503 domain-containing protein 0.9981 2 97
AF-A0A1C5GRL1-F1-model_v4 DUF503 domain-containing protein 0.9777 2 97
AF-A0A810L796-F1-model_v4 DUF503 domain-containing protein 0.9776 2 97
AF-A0A5N5DVL2-F1-model_v4 DUF503 domain-containing protein 0.9734 3 87
AF-L7F587-F1-model_v4 DUF503 domain-containing protein 0.9722 2 97

Map