F416139
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 344 | 197 | 344 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0101509|Ga0501033_0101509_1122_1805 |
| Length | 227 |
| Sequence | VDEVFDAEAIEAARVLFARPVEFLLGAAAVAQLPEPDLPEVAFAGRSNVGKSSLINALTGQKHLARASNEPGRTREVNLFRLDGRVRLVDLPGYGFAQASKTTVAKFQNLGRAYLRGRPNLKRVYLLIDARHGLKKVDAEALDALDQAAVSYQIVLTKADKVRPASDLAKVEAATLKGISRRPAAFPRVAVTSSETGAGIPELRAEIAAAAGLIDPPSPKTGDDRGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 130 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 134 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 135 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 136 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 137 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 138 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 139 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 140 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 148 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 151 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 152 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 153 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 154 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 157 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 167 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 168 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 169 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 170 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 183 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 194 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 195 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.74 |
| Nodule | 0 |
| Rhizoplane | 1.74 |
| Rhizosphere | 95.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10175497 | 3300005290 | Bacteria | 1220 |
| 2 | Ga0070658_10249584 | 3300005327 | Bacteria | 1505 |
| 3 | Ga0070683_100122296 | 3300005329 | Bacteria | 2459 |
| 4 | Ga0070683_100133989 | 3300005329 | Bacteria | 2345 |
| 5 | Ga0070683_100373759 | 3300005329 | Bacteria | 1358 |
| 6 | Ga0070690_100292557 | 3300005330 | Bacteria | 1165 |
| 7 | Ga0070670_100012097 | 3300005331 | Bacteria | 7379 |
| 8 | Ga0070670_100061345 | 3300005331 | Bacteria | 3228 |
| 9 | Ga0068869_100016426 | 3300005334 | Bacteria | 4989 |
| 10 | Ga0070680_100007449 | 3300005336 | Bacteria | 8350 |
| 11 | Ga0070680_100081796 | 3300005336 | Bacteria | 2665 |
| 12 | Ga0070680_100115823 | 3300005336 | Bacteria | 2234 |
| 13 | Ga0070680_100677375 | 3300005336 | Bacteria | 887 |
| 14 | Ga0070682_100008710 | 3300005337 | Bacteria | 5723 |
| 15 | Ga0068868_100019705 | 3300005338 | Bacteria | 5058 |
| 16 | Ga0068868_100058182 | 3300005338 | Bacteria | 3054 |
| 17 | Ga0068868_100294885 | 3300005338 | Bacteria | 1376 |
| 18 | Ga0070660_100031636 | 3300005339 | Bacteria | 3975 |
| 19 | Ga0070660_100132256 | 3300005339 | Bacteria | 1997 |
| 20 | Ga0070687_100013571 | 3300005343 | Bacteria | 3633 |
| 21 | Ga0070661_100001686 | 3300005344 | Bacteria | 15290 |
| 22 | Ga0070661_100008607 | 3300005344 | Bacteria | 7058 |
| 23 | Ga0070668_100342360 | 3300005347 | Unclassified | 1263 |
| 24 | Ga0070669_100446158 | 3300005353 | Bacteria | 1066 |
| 25 | Ga0070671_100500971 | 3300005355 | Bacteria | 1045 |
| 26 | Ga0070673_100377148 | 3300005364 | Bacteria | 1264 |
| 27 | Ga0070673_100624139 | 3300005364 | Bacteria | 985 |
| 28 | Ga0070659_100009705 | 3300005366 | Bacteria | 7071 |
| 29 | Ga0070659_100665611 | 3300005366 | Bacteria | 898 |
| 30 | Ga0070659_100951765 | 3300005366 | Bacteria | 752 |
| 31 | Ga0070667_100049075 | 3300005367 | Bacteria | 3554 |
| 32 | Ga0070667_100195360 | 3300005367 | Bacteria | 1794 |
| 33 | Ga0070700_100015928 | 3300005441 | Bacteria | 4273 |
| 34 | Ga0070694_100062903 | 3300005444 | Bacteria | 2536 |
| 35 | Ga0070663_100081920 | 3300005455 | Bacteria | 2373 |
| 36 | Ga0070662_100021590 | 3300005457 | Bacteria | 4398 |
| 37 | Ga0070662_100365407 | 3300005457 | Unclassified | 1185 |
| 38 | Ga0070681_10000537 | 3300005458 | Bacteria | 31196 |
| 39 | Ga0070681_10012055 | 3300005458 | Bacteria | 8574 |
| 40 | Ga0070681_10118671 | 3300005458 | Bacteria | 2582 |
| 41 | Ga0070681_10320118 | 3300005458 | Bacteria | 1461 |
| 42 | Ga0070685_10058253 | 3300005466 | Bacteria | 2251 |
| 43 | Ga0070685_10065184 | 3300005466 | Bacteria | 2143 |
| 44 | Ga0070679_100001266 | 3300005530 | Bacteria | 22304 |
| 45 | Ga0070679_100111728 | 3300005530 | Bacteria | 2719 |
| 46 | Ga0070684_100004930 | 3300005535 | Bacteria | 10186 |
| 47 | Ga0070684_100007871 | 3300005535 | Bacteria | 8312 |
| 48 | Ga0070684_100011110 | 3300005535 | Bacteria | 7164 |
| 49 | Ga0070684_100027899 | 3300005535 | Bacteria | 4770 |
| 50 | Ga0070684_100034892 | 3300005535 | Bacteria | 4303 |
| 51 | Ga0070684_100229939 | 3300005535 | Bacteria | 1693 |
| 52 | Ga0070684_100261006 | 3300005535 | Bacteria | 1585 |
| 53 | Ga0070684_100359375 | 3300005535 | Bacteria | 1340 |
| 54 | Ga0070684_100458819 | 3300005535 | Bacteria | 1178 |
| 55 | Ga0070684_100802515 | 3300005535 | Bacteria | 880 |
| 56 | Ga0068853_100258893 | 3300005539 | Bacteria | 1599 |
| 57 | Ga0070672_100153098 | 3300005543 | Bacteria | 1908 |
| 58 | Ga0070686_100199434 | 3300005544 | Bacteria | 1433 |
| 59 | Ga0070695_100064883 | 3300005545 | Bacteria | 2376 |
| 60 | Ga0070696_100119745 | 3300005546 | Unclassified | 1904 |
| 61 | Ga0070693_100002684 | 3300005547 | Bacteria | 8187 |
| 62 | Ga0070665_100225586 | 3300005548 | Bacteria | 1874 |
| 63 | Ga0070665_100284162 | 3300005548 | Bacteria | 1657 |
| 64 | Ga0070704_100131932 | 3300005549 | Bacteria | 1938 |
| 65 | Ga0068855_100014308 | 3300005563 | Bacteria | 9554 |
| 66 | Ga0068855_100252936 | 3300005563 | Bacteria | 1965 |
| 67 | Ga0068855_100393794 | 3300005563 | Bacteria | 1519 |
| 68 | Ga0070664_100010516 | 3300005564 | Bacteria | 7499 |
| 69 | Ga0070664_100025087 | 3300005564 | Bacteria | 4939 |
| 70 | Ga0070664_100048735 | 3300005564 | Bacteria | 3580 |
| 71 | Ga0070664_100084638 | 3300005564 | Bacteria | 2738 |
| 72 | Ga0068857_100005676 | 3300005577 | Bacteria | 10669 |
| 73 | Ga0068857_100021311 | 3300005577 | Bacteria | 5705 |
| 74 | Ga0068857_100513414 | 3300005577 | Bacteria | 1126 |
| 75 | Ga0068854_100017511 | 3300005578 | Bacteria | 4794 |
| 76 | Ga0068854_100333133 | 3300005578 | Bacteria | 1237 |
| 77 | Ga0068854_100341919 | 3300005578 | Bacteria | 1222 |
| 78 | Ga0068856_100003118 | 3300005614 | Bacteria | 16921 |
| 79 | Ga0068856_100242863 | 3300005614 | Bacteria | 1816 |
| 80 | Ga0070702_100001210 | 3300005615 | Bacteria | 10441 |
| 81 | Ga0070702_100454299 | 3300005615 | Bacteria | 930 |
| 82 | Ga0068852_100272870 | 3300005616 | Bacteria | 1628 |
| 83 | Ga0068852_100584612 | 3300005616 | Bacteria | 1120 |
| 84 | Ga0068859_100069480 | 3300005617 | Bacteria | 3557 |
| 85 | Ga0068859_100770233 | 3300005617 | Bacteria | 1051 |
| 86 | Ga0068864_100004023 | 3300005618 | Bacteria | 12078 |
| 87 | Ga0068861_100035801 | 3300005719 | Bacteria | 3680 |
| 88 | Ga0068851_10097232 | 3300005834 | Bacteria | 1558 |
| 89 | Ga0068870_10014121 | 3300005840 | Bacteria | 3767 |
| 90 | Ga0068870_10048653 | 3300005840 | Bacteria | 2234 |
| 91 | Ga0068863_100202536 | 3300005841 | Bacteria | 1910 |
| 92 | Ga0068863_100653386 | 3300005841 | Unclassified | 1043 |
| 93 | Ga0068862_100430673 | 3300005844 | Bacteria | 1240 |
| 94 | Ga0081540_1000165 | 3300005983 | Bacteria | 68435 |
| 95 | Ga0081539_10038688 | 3300005985 | Bacteria | 2823 |
| 96 | Ga0075368_10006471 | 3300006042 | Bacteria | 4094 |
| 97 | Ga0075367_10238939 | 3300006178 | Bacteria | 1138 |
| 98 | Ga0097621_100035250 | 3300006237 | Bacteria | 3998 |
| 99 | Ga0075428_100044371 | 3300006844 | Bacteria | 4885 |
| 100 | Ga0075428_100366925 | 3300006844 | Bacteria | 1544 |
| 101 | Ga0075428_101454515 | 3300006844 | Bacteria | 718 |
| 102 | Ga0075430_100352434 | 3300006846 | Bacteria | 1215 |
| 103 | Ga0075431_100039959 | 3300006847 | Bacteria | 4833 |
| 104 | Ga0075431_100216561 | 3300006847 | Bacteria | 1954 |
| 105 | Ga0075433_10185771 | 3300006852 | Bacteria | 1849 |
| 106 | Ga0075434_100001638 | 3300006871 | Bacteria | 19055 |
| 107 | Ga0075434_100633119 | 3300006871 | Bacteria | 1088 |
| 108 | Ga0075429_100066623 | 3300006880 | Bacteria | 3135 |
| 109 | Ga0068865_100089149 | 3300006881 | Bacteria | 2233 |
| 110 | Ga0097620_100069473 | 3300006931 | Bacteria | 3557 |
| 111 | Ga0097620_100770291 | 3300006931 | Bacteria | 1051 |
| 112 | Ga0075435_100009981 | 3300007076 | Bacteria | 6921 |
| 113 | Ga0075435_100338882 | 3300007076 | Bacteria | 1288 |
| 114 | Ga0105240_10115287 | 3300009093 | Bacteria | 3244 |
| 115 | Ga0105240_10417669 | 3300009093 | Bacteria | 1508 |
| 116 | Ga0105240_10472205 | 3300009093 | Bacteria | 1400 |
| 117 | Ga0105240_10613015 | 3300009093 | Bacteria | 1197 |
| 118 | Ga0111539_10001966 | 3300009094 | Bacteria | 27438 |
| 119 | Ga0111539_10038988 | 3300009094 | Bacteria | 5729 |
| 120 | Ga0111539_10153504 | 3300009094 | Bacteria | 2695 |
| 121 | Ga0105245_10174490 | 3300009098 | Bacteria | 2049 |
| 122 | Ga0105245_10208966 | 3300009098 | Bacteria | 1878 |
| 123 | Ga0105245_10677315 | 3300009098 | Bacteria | 1063 |
| 124 | Ga0114129_10011383 | 3300009147 | Bacteria | 12672 |
| 125 | Ga0114129_10500148 | 3300009147 | Bacteria | 1588 |
| 126 | Ga0114129_11004236 | 3300009147 | Bacteria | 1051 |
| 127 | Ga0105241_10034803 | 3300009174 | Bacteria | 3787 |
| 128 | Ga0105242_10002426 | 3300009176 | Bacteria | 14636 |
| 129 | Ga0105242_10351185 | 3300009176 | Bacteria | 1362 |
| 130 | Ga0105242_10472181 | 3300009176 | Bacteria | 1187 |
| 131 | Ga0105248_10045024 | 3300009177 | Bacteria | 4948 |
| 132 | Ga0105248_10078676 | 3300009177 | Bacteria | 3707 |
| 133 | Ga0105248_10105793 | 3300009177 | Bacteria | 3172 |
| 134 | Ga0105248_10185184 | 3300009177 | Bacteria | 2346 |
| 135 | Ga0105238_10075022 | 3300009551 | Bacteria | 3374 |
| 136 | Ga0105238_10137658 | 3300009551 | Bacteria | 2419 |
| 137 | Ga0105249_11000598 | 3300009553 | Unclassified | 905 |
| 138 | Ga0105249_11159847 | 3300009553 | Bacteria | 843 |
| 139 | Ga0105239_10678440 | 3300010375 | Bacteria | 1178 |
| 140 | Ga0105246_10000740 | 3300011119 | Bacteria | 18544 |
| 141 | Ga0105246_10422260 | 3300011119 | Unclassified | 1113 |
| 142 | Ga0157373_10014369 | 3300013100 | Bacteria | 5803 |
| 143 | Ga0157373_10237043 | 3300013100 | Bacteria | 1289 |
| 144 | Ga0157373_10265431 | 3300013100 | Bacteria | 1215 |
| 145 | Ga0157371_10030505 | 3300013102 | Bacteria | 3889 |
| 146 | Ga0157371_10045781 | 3300013102 | Bacteria | 3113 |
| 147 | Ga0157370_10002583 | 3300013104 | Bacteria | 21754 |
| 148 | Ga0157370_10652373 | 3300013104 | Bacteria | 962 |
| 149 | Ga0157369_10018895 | 3300013105 | Bacteria | 7723 |
| 150 | Ga0157369_10032821 | 3300013105 | Bacteria | 5705 |
| 151 | Ga0157369_10166940 | 3300013105 | Bacteria | 2321 |
| 152 | Ga0157369_10205671 | 3300013105 | Bacteria | 2065 |
| 153 | Ga0157378_10733970 | 3300013297 | Bacteria | 1009 |
| 154 | Ga0163162_10371198 | 3300013306 | Bacteria | 1564 |
| 155 | Ga0163162_10555871 | 3300013306 | Bacteria | 1276 |
| 156 | Ga0163162_10585765 | 3300013306 | Bacteria | 1242 |
| 157 | Ga0157372_10004564 | 3300013307 | Bacteria | 14742 |
| 158 | Ga0157372_10014053 | 3300013307 | Bacteria | 8552 |
| 159 | Ga0157372_10104874 | 3300013307 | Bacteria | 3233 |
| 160 | Ga0157372_10172147 | 3300013307 | Bacteria | 2505 |
| 161 | Ga0157372_10201592 | 3300013307 | Bacteria | 2305 |
| 162 | Ga0157375_10011506 | 3300013308 | Bacteria | 7817 |
| 163 | Ga0157375_10114633 | 3300013308 | Bacteria | 2797 |
| 164 | Ga0157375_10127039 | 3300013308 | Bacteria | 2666 |
| 165 | Ga0163163_10011972 | 3300014325 | Bacteria | 7893 |
| 166 | Ga0163163_10045719 | 3300014325 | Bacteria | 4299 |
| 167 | Ga0163163_10783621 | 3300014325 | Bacteria | 1017 |
| 168 | Ga0157377_10007774 | 3300014745 | Bacteria | 5196 |
| 169 | Ga0157379_10320651 | 3300014968 | Bacteria | 1415 |
| 170 | Ga0157376_10064884 | 3300014969 | Bacteria | 3081 |
| 171 | Ga0157376_10209203 | 3300014969 | Bacteria | 1800 |
| 172 | Ga0157376_10242900 | 3300014969 | Bacteria | 1678 |
| 173 | Ga0163161_10089485 | 3300017792 | Bacteria | 2277 |
| 174 | Ga0213872_10024453 | 3300021361 | Bacteria | 2779 |
| 175 | Ga0207656_10135668 | 3300025321 | Bacteria | 1156 |
| 176 | Ga0207645_10177928 | 3300025907 | Bacteria | 1395 |
| 177 | Ga0207645_10211372 | 3300025907 | Bacteria | 1278 |
| 178 | Ga0207643_10015691 | 3300025908 | Bacteria | 4125 |
| 179 | Ga0207707_10002059 | 3300025912 | Bacteria | 18248 |
| 180 | Ga0207707_10145600 | 3300025912 | Bacteria | 2071 |
| 181 | Ga0207707_10267977 | 3300025912 | Bacteria | 1481 |
| 182 | Ga0207707_10449248 | 3300025912 | Bacteria | 1103 |
| 183 | Ga0207695_10010019 | 3300025913 | Bacteria | 11641 |
| 184 | Ga0207695_10250474 | 3300025913 | Bacteria | 1671 |
| 185 | Ga0207660_10001001 | 3300025917 | Bacteria | 18744 |
| 186 | Ga0207660_10026312 | 3300025917 | Bacteria | 3961 |
| 187 | Ga0207660_10449904 | 3300025917 | Bacteria | 1041 |
| 188 | Ga0207657_10036213 | 3300025919 | Bacteria | 4419 |
| 189 | Ga0207657_10263088 | 3300025919 | Bacteria | 1372 |
| 190 | Ga0207649_10290369 | 3300025920 | Bacteria | 1192 |
| 191 | Ga0207649_10408579 | 3300025920 | Bacteria | 1017 |
| 192 | Ga0207652_10002364 | 3300025921 | Bacteria | 15949 |
| 193 | Ga0207652_10003711 | 3300025921 | Bacteria | 12536 |
| 194 | Ga0207652_10085091 | 3300025921 | Bacteria | 2771 |
| 195 | Ga0207681_10145440 | 3300025923 | Bacteria | 1771 |
| 196 | Ga0207681_10567717 | 3300025923 | Bacteria | 935 |
| 197 | Ga0207650_10037062 | 3300025925 | Bacteria | 3551 |
| 198 | Ga0207650_10314135 | 3300025925 | Bacteria | 1282 |
| 199 | Ga0207687_10012147 | 3300025927 | Bacteria | 5633 |
| 200 | Ga0207687_10018747 | 3300025927 | Bacteria | 4574 |
| 201 | Ga0207687_10092523 | 3300025927 | Bacteria | 2208 |
| 202 | Ga0207700_10124644 | 3300025928 | Bacteria | 2094 |
| 203 | Ga0207644_10496005 | 3300025931 | Bacteria | 1007 |
| 204 | Ga0207690_10045874 | 3300025932 | Bacteria | 2891 |
| 205 | Ga0207690_10244423 | 3300025932 | Bacteria | 1384 |
| 206 | Ga0207706_10009004 | 3300025933 | Bacteria | 9187 |
| 207 | Ga0207706_10514088 | 3300025933 | Unclassified | 1033 |
| 208 | Ga0207686_10113027 | 3300025934 | Bacteria | 1835 |
| 209 | Ga0207686_10132787 | 3300025934 | Bacteria | 1710 |
| 210 | Ga0207686_10143449 | 3300025934 | Bacteria | 1654 |
| 211 | Ga0207691_10372439 | 3300025940 | Unclassified | 1220 |
| 212 | Ga0207711_10120509 | 3300025941 | Bacteria | 2341 |
| 213 | Ga0207711_10129708 | 3300025941 | Bacteria | 2260 |
| 214 | Ga0207711_10273279 | 3300025941 | Bacteria | 1555 |
| 215 | Ga0207711_10609089 | 3300025941 | Bacteria | 1019 |
| 216 | Ga0207689_10000611 | 3300025942 | Bacteria | 34215 |
| 217 | Ga0207661_10048072 | 3300025944 | Bacteria | 3389 |
| 218 | Ga0207661_10138373 | 3300025944 | Bacteria | 2093 |
| 219 | Ga0207661_10156975 | 3300025944 | Bacteria | 1971 |
| 220 | Ga0207661_10248010 | 3300025944 | Bacteria | 1582 |
| 221 | Ga0207679_10000616 | 3300025945 | Bacteria | 23715 |
| 222 | Ga0207679_10042722 | 3300025945 | Bacteria | 3259 |
| 223 | Ga0207667_10107025 | 3300025949 | Bacteria | 2884 |
| 224 | Ga0207667_10190732 | 3300025949 | Bacteria | 2103 |
| 225 | Ga0207667_10505010 | 3300025949 | Bacteria | 1226 |
| 226 | Ga0207651_10097023 | 3300025960 | Bacteria | 2176 |
| 227 | Ga0207651_10186289 | 3300025960 | Bacteria | 1652 |
| 228 | Ga0207668_10058116 | 3300025972 | Bacteria | 2702 |
| 229 | Ga0207668_10081808 | 3300025972 | Bacteria | 2344 |
| 230 | Ga0207640_10172015 | 3300025981 | Bacteria | 1615 |
| 231 | Ga0207640_10308063 | 3300025981 | Bacteria | 1256 |
| 232 | Ga0207640_10692967 | 3300025981 | Bacteria | 872 |
| 233 | Ga0207658_10082264 | 3300025986 | Bacteria | 2472 |
| 234 | Ga0207677_10119300 | 3300026023 | Bacteria | 1981 |
| 235 | Ga0207677_10219310 | 3300026023 | Bacteria | 1524 |
| 236 | Ga0207703_10159382 | 3300026035 | Bacteria | 1975 |
| 237 | Ga0207703_10415957 | 3300026035 | Bacteria | 1250 |
| 238 | Ga0207678_10069599 | 3300026067 | Bacteria | 3017 |
| 239 | Ga0207708_10030008 | 3300026075 | Bacteria | 4123 |
| 240 | Ga0207708_10395287 | 3300026075 | Unclassified | 1142 |
| 241 | Ga0207702_10029194 | 3300026078 | Bacteria | 4587 |
| 242 | Ga0207641_10017716 | 3300026088 | Bacteria | 5835 |
| 243 | Ga0207676_10001052 | 3300026095 | Bacteria | 21024 |
| 244 | Ga0207676_10407479 | 3300026095 | Bacteria | 1272 |
| 245 | Ga0207674_10000120 | 3300026116 | Bacteria | 91883 |
| 246 | Ga0207674_10015240 | 3300026116 | Bacteria | 8456 |
| 247 | Ga0207675_100093819 | 3300026118 | Bacteria | 2823 |
| 248 | Ga0207675_100926202 | 3300026118 | Bacteria | 888 |
| 249 | Ga0207683_10099699 | 3300026121 | Bacteria | 2593 |
| 250 | Ga0207683_10311255 | 3300026121 | Unclassified | 1441 |
| 251 | Ga0207683_10651009 | 3300026121 | Bacteria | 976 |
| 252 | Ga0207698_10251430 | 3300026142 | Bacteria | 1618 |
| 253 | Ga0207698_10251628 | 3300026142 | Bacteria | 1617 |
| 254 | Ga0209968_1021774 | 3300027526 | Unclassified | 1042 |
| 255 | Ga0209999_1006782 | 3300027543 | Bacteria | 2061 |
| 256 | Ga0209813_10003804 | 3300027866 | Bacteria | 3564 |
| 257 | Ga0207428_10002579 | 3300027907 | Bacteria | 18097 |
| 258 | Ga0207428_10202312 | 3300027907 | Bacteria | 1494 |
| 259 | Ga0268265_10177257 | 3300028380 | Bacteria | 1828 |
| 260 | Ga0265338_10213834 | 3300028800 | Bacteria | 1445 |
| 261 | Ga0307405_10008940 | 3300031731 | Bacteria | 5111 |
| 262 | Ga0307413_10042274 | 3300031824 | Bacteria | 2677 |
| 263 | Ga0307413_10054698 | 3300031824 | Bacteria | 2423 |
| 264 | Ga0307410_10014915 | 3300031852 | Bacteria | 4591 |
| 265 | Ga0307406_10004563 | 3300031901 | Bacteria | 7541 |
| 266 | Ga0307406_10064885 | 3300031901 | Bacteria | 2371 |
| 267 | Ga0307407_10049612 | 3300031903 | Bacteria | 2396 |
| 268 | Ga0307407_10054433 | 3300031903 | Bacteria | 2308 |
| 269 | Ga0307412_10030643 | 3300031911 | Bacteria | 3389 |
| 270 | Ga0307409_100679685 | 3300031995 | Bacteria | 1026 |
| 271 | Ga0307416_100014321 | 3300032002 | Bacteria | 5429 |
| 272 | Ga0307411_10148154 | 3300032005 | Bacteria | 1740 |
| 273 | Ga0307415_100009621 | 3300032126 | Bacteria | 5432 |
| 274 | Ga0373934_0047618 | 3300035086 | Bacteria | 1696 |
| 275 | Ga0373923_0034221 | 3300035111 | Bacteria | 2061 |
| 276 | Ga0373953_0068167 | 3300035117 | Bacteria | 1464 |
| 277 | Ga0373931_0038806 | 3300035691 | Bacteria | 2493 |
| 278 | Ga0373935_0391041 | 3300035692 | Bacteria | 997 |
| 279 | Ga0373933_0155840 | 3300035724 | Bacteria | 1449 |
| 280 | Ga0373937_0293779 | 3300036401 | Bacteria | 1535 |
| 281 | Ga0373937_1050696 | 3300036401 | Bacteria | 763 |
| 282 | Ga0373925_0439922 | 3300037068 | Bacteria | 1067 |
| 283 | Ga0436365_0244643 | 3300039437 | Bacteria | 1974 |
| 284 | Ga0436365_1790669 | 3300039437 | Bacteria | 1915 |
| 285 | Ga0436361_0290947 | 3300039447 | Bacteria | 24175 |
| 286 | Ga0466966_0012857 | 3300044684 | Bacteria | 5543 |
| 287 | Ga0466963_0009965 | 3300044694 | Bacteria | 5742 |
| 288 | Ga0466957_0309125 | 3300044842 | Bacteria | 1064 |
| 289 | Ga0451576_0182534 | 3300045051 | Bacteria | 2191 |
| 290 | Ga0451576_0538265 | 3300045051 | Bacteria | 1227 |
| 291 | Ga0466967_0090544 | 3300045976 | Bacteria | 2779 |
| 292 | Ga0495629_0009156 | 3300046459 | Bacteria | 7251 |
| 293 | Ga0495582_0323277 | 3300046473 | Bacteria | 888 |
| 294 | Ga0495594_0113147 | 3300046499 | Bacteria | 1531 |
| 295 | Ga0495635_0095721 | 3300046663 | Bacteria | 2030 |
| 296 | Ga0495613_0668766 | 3300046689 | Bacteria | 686 |
| 297 | Ga0495581_0293085 | 3300047315 | Bacteria | 951 |
| 298 | Ga0495675_0038529 | 3300047444 | Bacteria | 3044 |
| 299 | Ga0496101_0263716 | 3300048904 | Bacteria | 1344 |
| 300 | Ga0496108_0551708 | 3300048911 | Bacteria | 1005 |
| 301 | Ga0496110_0038626 | 3300048913 | Bacteria | 4155 |
| 302 | Ga0496111_0022804 | 3300048914 | Bacteria | 4387 |
| 303 | Ga0496112_0063816 | 3300048915 | Bacteria | 3634 |
| 304 | Ga0496112_0088305 | 3300048915 | Bacteria | 3068 |
| 305 | Ga0496124_0062561 | 3300048927 | Bacteria | 3114 |
| 306 | Ga0501033_0037001 | 3300049570 | Bacteria | 3655 |
| 307 | Ga0501033_0101509 | 3300049570 | Bacteria | 2099 |
| 308 | Ga0501033_0120134 | 3300049570 | Bacteria | 1907 |
| 309 | Ga0501039_0293113 | 3300049575 | Bacteria | 1279 |
| 310 | Ga0501047_0122406 | 3300049581 | Bacteria | 2483 |
| 311 | Ga0501048_0295709 | 3300049582 | Bacteria | 1152 |
| 312 | Ga0501071_0030257 | 3300049587 | Bacteria | 3829 |
| 313 | Ga0501072_0165158 | 3300049588 | Bacteria | 1766 |
| 314 | Ga0501073_0305095 | 3300049589 | Bacteria | 1098 |
| 315 | Ga0501074_0038637 | 3300049590 | Bacteria | 3458 |
| 316 | Ga0501076_0006165 | 3300049592 | Bacteria | 8677 |
| 317 | Ga0501079_0045092 | 3300049741 | Bacteria | 3403 |
| 318 | Ga0501035_0071768 | 3300049822 | Bacteria | 3065 |
| 319 | Ga0501044_0102568 | 3300049823 | Bacteria | 2876 |
| 320 | Ga0501044_0289714 | 3300049823 | Bacteria | 1569 |
| 321 | nmdc:mga04h51_3536_c1 | 3300050495 | Bacteria | 3803 |
| 322 | nmdc:mga05p37_130339_c1 | 3300050507 | Bacteria | 3085 |
| 323 | nmdc:mga05p37_180482_c1 | 3300050507 | Bacteria | 2568 |
| 324 | nmdc:mga05p37_556006_c1 | 3300050507 | Bacteria | 1305 |
| 325 | nmdc:mga05p37_921191_c1 | 3300050507 | Bacteria | 939 |
| 326 | nmdc:mga0qj67_122295_c1 | 3300050509 | Bacteria | 2106 |
| 327 | nmdc:mga0qj67_318335_c1 | 3300050509 | Bacteria | 1259 |
| 328 | nmdc:mga06r32_215487_c1 | 3300050510 | Bacteria | 1908 |
| 329 | nmdc:mga08y16_162151_c1 | 3300050511 | Bacteria | 2323 |
| 330 | nmdc:mga08y16_26412_c1 | 3300050511 | Bacteria | 6123 |
| 331 | nmdc:mga08y16_87019_c1 | 3300050511 | Bacteria | 3256 |
| 332 | nmdc:mga0n895_7541_c1 | 3300050512 | Bacteria | 9349 |
| 333 | nmdc:mga0rr50_10063_c1 | 3300050513 | Bacteria | 5984 |
| 334 | nmdc:mga0rr50_240899_c1 | 3300050513 | Bacteria | 1499 |
| 335 | nmdc:mga08x19_78146_c1 | 3300050514 | Bacteria | 2168 |
| 336 | nmdc:mga0a205_260234_c1 | 3300050515 | Bacteria | 1613 |
| 337 | Ga0495612_0012833 | 3300053078 | Bacteria | 3377 |
| 338 | Ga0495612_0051917 | 3300053078 | Bacteria | 1686 |
| 339 | Ga0495619_0057036 | 3300053085 | Bacteria | 2591 |
| 340 | Ga0500643_008915 | 3300053087 | Bacteria | 3887 |
| 341 | Ga0500641_0001099 | 3300053096 | Bacteria | 9599 |
| 342 | Ga0501084_0093855 | 3300054114 | Bacteria | 2519 |
| 343 | Ga0501082_0052299 | 3300060353 | Bacteria | 3521 |
| 344 | Ga0530510_0230239 | 3300061734 | Bacteria | 1378 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035692 | Ga0373935_0391041 | Ga0373935_0391041_226_876 | 182 |
| 2 | 3300053078 | Ga0495612_0051917 | Ga0495612_0051917_294_944 | 182 |
| 3 | 3300006871 | Ga0075434_100001638 | Ga0075434_10000163817 | 183 |
| 4 | 3300007076 | Ga0075435_100009981 | Ga0075435_1000099812 | 183 |
| 5 | 3300050512 | nmdc:mga0n895_7541_c1 | nmdc:mga0n895_7541_c1_8480_9220 | 183 |
| 6 | 3300050513 | nmdc:mga0rr50_10063_c1 | nmdc:mga0rr50_10063_c1_5038_5778 | 183 |
| 7 | 3300050514 | nmdc:mga08x19_78146_c1 | nmdc:mga08x19_78146_c1_582_1322 | 183 |
| 8 | 3300005564 | Ga0070664_100048735 | Ga0070664_1000487352 | 189 |
| 9 | 3300025907 | Ga0207645_10177928 | Ga0207645_101779282 | 197 |
| 10 | 3300005444 | Ga0070694_100062903 | Ga0070694_1000629032 | 199 |
| 11 | 3300005549 | Ga0070704_100131932 | Ga0070704_1001319321 | 199 |
| 12 | 3300005578 | Ga0068854_100341919 | Ga0068854_1003419192 | 199 |
| 13 | 3300025981 | Ga0207640_10692967 | Ga0207640_106929672 | 199 |
| 14 | 3300021361 | Ga0213872_10024453 | Ga0213872_100244533 | 200 |
| 15 | 3300025907 | Ga0207645_10211372 | Ga0207645_102113722 | 200 |
| 16 | 3300026118 | Ga0207675_100926202 | Ga0207675_1009262022 | 200 |
| 17 | 3300031824 | Ga0307413_10042274 | Ga0307413_100422743 | 200 |
| 18 | 3300031903 | Ga0307407_10054433 | Ga0307407_100544332 | 200 |
| 19 | 3300039447 | Ga0436361_0290947 | Ga0436361_0290947_18203_18856 | 200 |
| 20 | 3300005336 | Ga0070680_100677375 | Ga0070680_1006773751 | 201 |
| 21 | 3300005441 | Ga0070700_100015928 | Ga0070700_1000159282 | 201 |
| 22 | 3300005719 | Ga0068861_100035801 | Ga0068861_1000358012 | 201 |
| 23 | 3300005983 | Ga0081540_1000165 | Ga0081540_100016566 | 201 |
| 24 | 3300006846 | Ga0075430_100352434 | Ga0075430_1003524341 | 201 |
| 25 | 3300006880 | Ga0075429_100066623 | Ga0075429_1000666233 | 201 |
| 26 | 3300013297 | Ga0157378_10733970 | Ga0157378_107339701 | 201 |
| 27 | 3300025917 | Ga0207660_10449904 | Ga0207660_104499042 | 201 |
| 28 | 3300026075 | Ga0207708_10030008 | Ga0207708_100300083 | 201 |
| 29 | 3300026118 | Ga0207675_100093819 | Ga0207675_1000938192 | 201 |
| 30 | 3300028800 | Ga0265338_10213834 | Ga0265338_102138342 | 201 |
| 31 | 3300035086 | Ga0373934_0047618 | Ga0373934_0047618_739_1383 | 201 |
| 32 | 3300035111 | Ga0373923_0034221 | Ga0373923_0034221_1356_2000 | 201 |
| 33 | 3300035117 | Ga0373953_0068167 | Ga0373953_0068167_101_745 | 201 |
| 34 | 3300035724 | Ga0373933_0155840 | Ga0373933_0155840_206_850 | 201 |
| 35 | 3300036401 | Ga0373937_0293779 | Ga0373937_0293779_72_716 | 201 |
| 36 | 3300046663 | Ga0495635_0095721 | Ga0495635_0095721_901_1545 | 201 |
| 37 | 3300047444 | Ga0495675_0038529 | Ga0495675_0038529_619_1263 | 201 |
| 38 | 3300048927 | Ga0496124_0062561 | Ga0496124_0062561_421_1065 | 201 |
| 39 | 3300049582 | Ga0501048_0295709 | Ga0501048_0295709_297_944 | 201 |
| 40 | 3300049587 | Ga0501071_0030257 | Ga0501071_0030257_2132_2779 | 201 |
| 41 | 3300049588 | Ga0501072_0165158 | Ga0501072_0165158_511_1158 | 201 |
| 42 | 3300049589 | Ga0501073_0305095 | Ga0501073_0305095_165_812 | 201 |
| 43 | 3300049590 | Ga0501074_0038637 | Ga0501074_0038637_385_1032 | 201 |
| 44 | 3300049592 | Ga0501076_0006165 | Ga0501076_0006165_4676_5323 | 201 |
| 45 | 3300049741 | Ga0501079_0045092 | Ga0501079_0045092_321_968 | 201 |
| 46 | 3300050507 | nmdc:mga05p37_180482_c1 | nmdc:mga05p37_180482_c1_275_931 | 201 |
| 47 | 3300050509 | nmdc:mga0qj67_122295_c1 | nmdc:mga0qj67_122295_c1_1437_2093 | 201 |
| 48 | 3300053078 | Ga0495612_0012833 | Ga0495612_0012833_318_962 | 201 |
| 49 | 3300054114 | Ga0501084_0093855 | Ga0501084_0093855_1021_1668 | 201 |
| 50 | 3300060353 | Ga0501082_0052299 | Ga0501082_0052299_1689_2336 | 201 |
| 51 | 3300061734 | Ga0530510_0230239 | Ga0530510_0230239_672_1319 | 201 |
| 52 | 3300006844 | Ga0075428_100044371 | Ga0075428_1000443712 | 202 |
| 53 | 3300006844 | Ga0075428_100366925 | Ga0075428_1003669252 | 202 |
| 54 | 3300006844 | Ga0075428_101454515 | Ga0075428_1014545151 | 202 |
| 55 | 3300006847 | Ga0075431_100216561 | Ga0075431_1002165612 | 202 |
| 56 | 3300006852 | Ga0075433_10185771 | Ga0075433_101857712 | 202 |
| 57 | 3300009094 | Ga0111539_10001966 | Ga0111539_1000196612 | 202 |
| 58 | 3300009094 | Ga0111539_10038988 | Ga0111539_100389884 | 202 |
| 59 | 3300009147 | Ga0114129_10011383 | Ga0114129_100113838 | 202 |
| 60 | 3300009147 | Ga0114129_11004236 | Ga0114129_110042361 | 202 |
| 61 | 3300027907 | Ga0207428_10002579 | Ga0207428_1000257914 | 202 |
| 62 | 3300027907 | Ga0207428_10202312 | Ga0207428_102023123 | 202 |
| 63 | 3300050507 | nmdc:mga05p37_130339_c1 | nmdc:mga05p37_130339_c1_49_726 | 202 |
| 64 | 3300050507 | nmdc:mga05p37_921191_c1 | nmdc:mga05p37_921191_c1_111_794 | 202 |
| 65 | 3300050509 | nmdc:mga0qj67_318335_c1 | nmdc:mga0qj67_318335_c1_79_756 | 202 |
| 66 | 3300050510 | nmdc:mga06r32_215487_c1 | nmdc:mga06r32_215487_c1_853_1533 | 202 |
| 67 | 3300050511 | nmdc:mga08y16_162151_c1 | nmdc:mga08y16_162151_c1_1291_1971 | 202 |
| 68 | 3300050511 | nmdc:mga08y16_26412_c1 | nmdc:mga08y16_26412_c1_2057_2734 | 202 |
| 69 | 3300050511 | nmdc:mga08y16_87019_c1 | nmdc:mga08y16_87019_c1_882_1562 | 202 |
| 70 | 3300050515 | nmdc:mga0a205_260234_c1 | nmdc:mga0a205_260234_c1_146_826 | 202 |
| 71 | 3300005458 | Ga0070681_10320118 | Ga0070681_103201182 | 203 |
| 72 | 3300005546 | Ga0070696_100119745 | Ga0070696_1001197451 | 203 |
| 73 | 3300027526 | Ga0209968_1021774 | Ga0209968_10217741 | 203 |
| 74 | 3300027543 | Ga0209999_1006782 | Ga0209999_10067822 | 203 |
| 75 | 3300005327 | Ga0070658_10249584 | Ga0070658_102495842 | 204 |
| 76 | 3300005329 | Ga0070683_100133989 | Ga0070683_1001339892 | 204 |
| 77 | 3300005336 | Ga0070680_100115823 | Ga0070680_1001158233 | 204 |
| 78 | 3300005339 | Ga0070660_100132256 | Ga0070660_1001322562 | 204 |
| 79 | 3300005366 | Ga0070659_100665611 | Ga0070659_1006656112 | 204 |
| 80 | 3300005455 | Ga0070663_100081920 | Ga0070663_1000819202 | 204 |
| 81 | 3300005578 | Ga0068854_100017511 | Ga0068854_1000175112 | 204 |
| 82 | 3300005615 | Ga0070702_100454299 | Ga0070702_1004542991 | 204 |
| 83 | 3300005616 | Ga0068852_100584612 | Ga0068852_1005846121 | 204 |
| 84 | 3300006042 | Ga0075368_10006471 | Ga0075368_100064712 | 204 |
| 85 | 3300006178 | Ga0075367_10238939 | Ga0075367_102389392 | 204 |
| 86 | 3300006847 | Ga0075431_100039959 | Ga0075431_1000399591 | 204 |
| 87 | 3300009093 | Ga0105240_10115287 | Ga0105240_101152871 | 204 |
| 88 | 3300009093 | Ga0105240_10472205 | Ga0105240_104722052 | 204 |
| 89 | 3300009147 | Ga0114129_10500148 | Ga0114129_105001481 | 204 |
| 90 | 3300009551 | Ga0105238_10137658 | Ga0105238_101376582 | 204 |
| 91 | 3300013102 | Ga0157371_10045781 | Ga0157371_100457814 | 204 |
| 92 | 3300013104 | Ga0157370_10652373 | Ga0157370_106523732 | 204 |
| 93 | 3300013105 | Ga0157369_10018895 | Ga0157369_100188956 | 204 |
| 94 | 3300013307 | Ga0157372_10014053 | Ga0157372_100140535 | 204 |
| 95 | 3300014969 | Ga0157376_10242900 | Ga0157376_102429002 | 204 |
| 96 | 3300025913 | Ga0207695_10250474 | Ga0207695_102504741 | 204 |
| 97 | 3300025919 | Ga0207657_10263088 | Ga0207657_102630882 | 204 |
| 98 | 3300025920 | Ga0207649_10408579 | Ga0207649_104085792 | 204 |
| 99 | 3300025949 | Ga0207667_10107025 | Ga0207667_101070252 | 204 |
| 100 | 3300025949 | Ga0207667_10190732 | Ga0207667_101907322 | 204 |
| 101 | 3300025949 | Ga0207667_10505010 | Ga0207667_105050102 | 204 |
| 102 | 3300025981 | Ga0207640_10172015 | Ga0207640_101720151 | 204 |
| 103 | 3300026067 | Ga0207678_10069599 | Ga0207678_100695992 | 204 |
| 104 | 3300026142 | Ga0207698_10251430 | Ga0207698_102514302 | 204 |
| 105 | 3300027866 | Ga0209813_10003804 | Ga0209813_100038042 | 204 |
| 106 | 3300037068 | Ga0373925_0439922 | Ga0373925_0439922_114_797 | 204 |
| 107 | 3300044684 | Ga0466966_0012857 | Ga0466966_0012857_3347_3988 | 204 |
| 108 | 3300050495 | nmdc:mga04h51_3536_c1 | nmdc:mga04h51_3536_c1_1417_2103 | 204 |
| 109 | 3300050507 | nmdc:mga05p37_556006_c1 | nmdc:mga05p37_556006_c1_66_731 | 204 |
| 110 | 3300053085 | Ga0495619_0057036 | Ga0495619_0057036_687_1370 | 204 |
| 111 | 3300005329 | Ga0070683_100122296 | Ga0070683_1001222962 | 205 |
| 112 | 3300005535 | Ga0070684_100802515 | Ga0070684_1008025151 | 205 |
| 113 | 3300025944 | Ga0207661_10156975 | Ga0207661_101569752 | 205 |
| 114 | 3300048904 | Ga0496101_0263716 | Ga0496101_0263716_288_923 | 205 |
| 115 | 3300005330 | Ga0070690_100292557 | Ga0070690_1002925572 | 206 |
| 116 | 3300005336 | Ga0070680_100081796 | Ga0070680_1000817963 | 206 |
| 117 | 3300005458 | Ga0070681_10000537 | Ga0070681_1000053723 | 206 |
| 118 | 3300005530 | Ga0070679_100001266 | Ga0070679_1000012664 | 206 |
| 119 | 3300005535 | Ga0070684_100007871 | Ga0070684_1000078715 | 206 |
| 120 | 3300005535 | Ga0070684_100034892 | Ga0070684_1000348924 | 206 |
| 121 | 3300005563 | Ga0068855_100014308 | Ga0068855_1000143084 | 206 |
| 122 | 3300005985 | Ga0081539_10038688 | Ga0081539_100386884 | 206 |
| 123 | 3300009098 | Ga0105245_10677315 | Ga0105245_106773152 | 206 |
| 124 | 3300009176 | Ga0105242_10472181 | Ga0105242_104721812 | 206 |
| 125 | 3300010375 | Ga0105239_10678440 | Ga0105239_106784402 | 206 |
| 126 | 3300013100 | Ga0157373_10237043 | Ga0157373_102370432 | 206 |
| 127 | 3300013104 | Ga0157370_10002583 | Ga0157370_1000258321 | 206 |
| 128 | 3300013105 | Ga0157369_10032821 | Ga0157369_100328212 | 206 |
| 129 | 3300013105 | Ga0157369_10205671 | Ga0157369_102056713 | 206 |
| 130 | 3300013307 | Ga0157372_10004564 | Ga0157372_100045642 | 206 |
| 131 | 3300025912 | Ga0207707_10145600 | Ga0207707_101456002 | 206 |
| 132 | 3300025913 | Ga0207695_10010019 | Ga0207695_100100195 | 206 |
| 133 | 3300025917 | Ga0207660_10001001 | Ga0207660_100010014 | 206 |
| 134 | 3300025921 | Ga0207652_10002364 | Ga0207652_100023642 | 206 |
| 135 | 3300025927 | Ga0207687_10092523 | Ga0207687_100925232 | 206 |
| 136 | 3300025941 | Ga0207711_10609089 | Ga0207711_106090892 | 206 |
| 137 | 3300025944 | Ga0207661_10138373 | Ga0207661_101383732 | 206 |
| 138 | 3300045051 | Ga0451576_0182534 | Ga0451576_0182534_504_1187 | 206 |
| 139 | 3300048915 | Ga0496112_0088305 | Ga0496112_0088305_641_1282 | 206 |
| 140 | 3300049570 | Ga0501033_0101509 | Ga0501033_0101509_1122_1805 | 206 |
| 141 | 3300053087 | Ga0500643_008915 | Ga0500643_008915_2687_3367 | 206 |
| 142 | 3300053096 | Ga0500641_0001099 | Ga0500641_0001099_6463_7176 | 206 |
| 143 | 3300005290 | Ga0065712_10175497 | Ga0065712_101754972 | 207 |
| 144 | 3300005329 | Ga0070683_100373759 | Ga0070683_1003737592 | 207 |
| 145 | 3300005331 | Ga0070670_100012097 | Ga0070670_1000120974 | 207 |
| 146 | 3300005331 | Ga0070670_100061345 | Ga0070670_1000613452 | 207 |
| 147 | 3300005334 | Ga0068869_100016426 | Ga0068869_1000164262 | 207 |
| 148 | 3300005336 | Ga0070680_100007449 | Ga0070680_1000074494 | 207 |
| 149 | 3300005337 | Ga0070682_100008710 | Ga0070682_1000087103 | 207 |
| 150 | 3300005338 | Ga0068868_100019705 | Ga0068868_1000197052 | 207 |
| 151 | 3300005338 | Ga0068868_100058182 | Ga0068868_1000581823 | 207 |
| 152 | 3300005338 | Ga0068868_100294885 | Ga0068868_1002948852 | 207 |
| 153 | 3300005339 | Ga0070660_100031636 | Ga0070660_1000316363 | 207 |
| 154 | 3300005343 | Ga0070687_100013571 | Ga0070687_1000135712 | 207 |
| 155 | 3300005344 | Ga0070661_100001686 | Ga0070661_1000016864 | 207 |
| 156 | 3300005344 | Ga0070661_100008607 | Ga0070661_1000086075 | 207 |
| 157 | 3300005347 | Ga0070668_100342360 | Ga0070668_1003423602 | 207 |
| 158 | 3300005353 | Ga0070669_100446158 | Ga0070669_1004461582 | 207 |
| 159 | 3300005355 | Ga0070671_100500971 | Ga0070671_1005009712 | 207 |
| 160 | 3300005364 | Ga0070673_100377148 | Ga0070673_1003771482 | 207 |
| 161 | 3300005364 | Ga0070673_100624139 | Ga0070673_1006241392 | 207 |
| 162 | 3300005366 | Ga0070659_100009705 | Ga0070659_1000097053 | 207 |
| 163 | 3300005366 | Ga0070659_100951765 | Ga0070659_1009517651 | 207 |
| 164 | 3300005367 | Ga0070667_100049075 | Ga0070667_1000490753 | 207 |
| 165 | 3300005367 | Ga0070667_100195360 | Ga0070667_1001953602 | 207 |
| 166 | 3300005457 | Ga0070662_100021590 | Ga0070662_1000215902 | 207 |
| 167 | 3300005457 | Ga0070662_100365407 | Ga0070662_1003654072 | 207 |
| 168 | 3300005458 | Ga0070681_10012055 | Ga0070681_100120555 | 207 |
| 169 | 3300005458 | Ga0070681_10118671 | Ga0070681_101186712 | 207 |
| 170 | 3300005466 | Ga0070685_10058253 | Ga0070685_100582533 | 207 |
| 171 | 3300005466 | Ga0070685_10065184 | Ga0070685_100651843 | 207 |
| 172 | 3300005530 | Ga0070679_100111728 | Ga0070679_1001117283 | 207 |
| 173 | 3300005535 | Ga0070684_100004930 | Ga0070684_1000049306 | 207 |
| 174 | 3300005535 | Ga0070684_100011110 | Ga0070684_1000111105 | 207 |
| 175 | 3300005535 | Ga0070684_100027899 | Ga0070684_1000278991 | 207 |
| 176 | 3300005535 | Ga0070684_100229939 | Ga0070684_1002299392 | 207 |
| 177 | 3300005535 | Ga0070684_100261006 | Ga0070684_1002610062 | 207 |
| 178 | 3300005535 | Ga0070684_100359375 | Ga0070684_1003593751 | 207 |
| 179 | 3300005535 | Ga0070684_100458819 | Ga0070684_1004588192 | 207 |
| 180 | 3300005539 | Ga0068853_100258893 | Ga0068853_1002588932 | 207 |
| 181 | 3300005543 | Ga0070672_100153098 | Ga0070672_1001530982 | 207 |
| 182 | 3300005544 | Ga0070686_100199434 | Ga0070686_1001994342 | 207 |
| 183 | 3300005545 | Ga0070695_100064883 | Ga0070695_1000648832 | 207 |
| 184 | 3300005547 | Ga0070693_100002684 | Ga0070693_1000026845 | 207 |
| 185 | 3300005548 | Ga0070665_100225586 | Ga0070665_1002255861 | 207 |
| 186 | 3300005548 | Ga0070665_100284162 | Ga0070665_1002841622 | 207 |
| 187 | 3300005563 | Ga0068855_100252936 | Ga0068855_1002529362 | 207 |
| 188 | 3300005563 | Ga0068855_100393794 | Ga0068855_1003937942 | 207 |
| 189 | 3300005564 | Ga0070664_100010516 | Ga0070664_1000105166 | 207 |
| 190 | 3300005564 | Ga0070664_100025087 | Ga0070664_1000250872 | 207 |
| 191 | 3300005564 | Ga0070664_100084638 | Ga0070664_1000846381 | 207 |
| 192 | 3300005577 | Ga0068857_100005676 | Ga0068857_1000056762 | 207 |
| 193 | 3300005577 | Ga0068857_100021311 | Ga0068857_1000213114 | 207 |
| 194 | 3300005577 | Ga0068857_100513414 | Ga0068857_1005134142 | 207 |
| 195 | 3300005578 | Ga0068854_100333133 | Ga0068854_1003331332 | 207 |
| 196 | 3300005614 | Ga0068856_100003118 | Ga0068856_10000311816 | 207 |
| 197 | 3300005614 | Ga0068856_100242863 | Ga0068856_1002428632 | 207 |
| 198 | 3300005615 | Ga0070702_100001210 | Ga0070702_1000012105 | 207 |
| 199 | 3300005616 | Ga0068852_100272870 | Ga0068852_1002728702 | 207 |
| 200 | 3300005617 | Ga0068859_100069480 | Ga0068859_1000694804 | 207 |
| 201 | 3300005617 | Ga0068859_100770233 | Ga0068859_1007702332 | 207 |
| 202 | 3300005618 | Ga0068864_100004023 | Ga0068864_1000040238 | 207 |
| 203 | 3300005834 | Ga0068851_10097232 | Ga0068851_100972321 | 207 |
| 204 | 3300005840 | Ga0068870_10014121 | Ga0068870_100141212 | 207 |
| 205 | 3300005840 | Ga0068870_10048653 | Ga0068870_100486532 | 207 |
| 206 | 3300005841 | Ga0068863_100202536 | Ga0068863_1002025363 | 207 |
| 207 | 3300005841 | Ga0068863_100653386 | Ga0068863_1006533862 | 207 |
| 208 | 3300005844 | Ga0068862_100430673 | Ga0068862_1004306732 | 207 |
| 209 | 3300006237 | Ga0097621_100035250 | Ga0097621_1000352502 | 207 |
| 210 | 3300006871 | Ga0075434_100633119 | Ga0075434_1006331192 | 207 |
| 211 | 3300006881 | Ga0068865_100089149 | Ga0068865_1000891493 | 207 |
| 212 | 3300006931 | Ga0097620_100069473 | Ga0097620_1000694734 | 207 |
| 213 | 3300006931 | Ga0097620_100770291 | Ga0097620_1007702912 | 207 |
| 214 | 3300007076 | Ga0075435_100338882 | Ga0075435_1003388822 | 207 |
| 215 | 3300009093 | Ga0105240_10417669 | Ga0105240_104176692 | 207 |
| 216 | 3300009093 | Ga0105240_10613015 | Ga0105240_106130152 | 207 |
| 217 | 3300009094 | Ga0111539_10153504 | Ga0111539_101535042 | 207 |
| 218 | 3300009098 | Ga0105245_10174490 | Ga0105245_101744902 | 207 |
| 219 | 3300009098 | Ga0105245_10208966 | Ga0105245_102089662 | 207 |
| 220 | 3300009174 | Ga0105241_10034803 | Ga0105241_100348032 | 207 |
| 221 | 3300009176 | Ga0105242_10002426 | Ga0105242_100024265 | 207 |
| 222 | 3300009176 | Ga0105242_10351185 | Ga0105242_103511852 | 207 |
| 223 | 3300009177 | Ga0105248_10045024 | Ga0105248_100450242 | 207 |
| 224 | 3300009177 | Ga0105248_10078676 | Ga0105248_100786764 | 207 |
| 225 | 3300009177 | Ga0105248_10105793 | Ga0105248_101057932 | 207 |
| 226 | 3300009177 | Ga0105248_10185184 | Ga0105248_101851842 | 207 |
| 227 | 3300009551 | Ga0105238_10075022 | Ga0105238_100750222 | 207 |
| 228 | 3300009553 | Ga0105249_11000598 | Ga0105249_110005982 | 207 |
| 229 | 3300009553 | Ga0105249_11159847 | Ga0105249_111598472 | 207 |
| 230 | 3300011119 | Ga0105246_10000740 | Ga0105246_100007404 | 207 |
| 231 | 3300011119 | Ga0105246_10422260 | Ga0105246_104222602 | 207 |
| 232 | 3300013100 | Ga0157373_10014369 | Ga0157373_100143692 | 207 |
| 233 | 3300013100 | Ga0157373_10265431 | Ga0157373_102654312 | 207 |
| 234 | 3300013102 | Ga0157371_10030505 | Ga0157371_100305054 | 207 |
| 235 | 3300013105 | Ga0157369_10166940 | Ga0157369_101669402 | 207 |
| 236 | 3300013306 | Ga0163162_10371198 | Ga0163162_103711982 | 207 |
| 237 | 3300013306 | Ga0163162_10555871 | Ga0163162_105558712 | 207 |
| 238 | 3300013306 | Ga0163162_10585765 | Ga0163162_105857652 | 207 |
| 239 | 3300013307 | Ga0157372_10104874 | Ga0157372_101048744 | 207 |
| 240 | 3300013307 | Ga0157372_10172147 | Ga0157372_101721472 | 207 |
| 241 | 3300013307 | Ga0157372_10201592 | Ga0157372_102015922 | 207 |
| 242 | 3300013308 | Ga0157375_10011506 | Ga0157375_100115062 | 207 |
| 243 | 3300013308 | Ga0157375_10114633 | Ga0157375_101146333 | 207 |
| 244 | 3300013308 | Ga0157375_10127039 | Ga0157375_101270392 | 207 |
| 245 | 3300014325 | Ga0163163_10011972 | Ga0163163_100119725 | 207 |
| 246 | 3300014325 | Ga0163163_10045719 | Ga0163163_100457192 | 207 |
| 247 | 3300014325 | Ga0163163_10783621 | Ga0163163_107836212 | 207 |
| 248 | 3300014745 | Ga0157377_10007774 | Ga0157377_100077744 | 207 |
| 249 | 3300014968 | Ga0157379_10320651 | Ga0157379_103206512 | 207 |
| 250 | 3300014969 | Ga0157376_10064884 | Ga0157376_100648842 | 207 |
| 251 | 3300014969 | Ga0157376_10209203 | Ga0157376_102092032 | 207 |
| 252 | 3300017792 | Ga0163161_10089485 | Ga0163161_100894852 | 207 |
| 253 | 3300025321 | Ga0207656_10135668 | Ga0207656_101356681 | 207 |
| 254 | 3300025908 | Ga0207643_10015691 | Ga0207643_100156914 | 207 |
| 255 | 3300025912 | Ga0207707_10002059 | Ga0207707_1000205912 | 207 |
| 256 | 3300025912 | Ga0207707_10267977 | Ga0207707_102679772 | 207 |
| 257 | 3300025912 | Ga0207707_10449248 | Ga0207707_104492482 | 207 |
| 258 | 3300025917 | Ga0207660_10026312 | Ga0207660_100263122 | 207 |
| 259 | 3300025919 | Ga0207657_10036213 | Ga0207657_100362132 | 207 |
| 260 | 3300025920 | Ga0207649_10290369 | Ga0207649_102903691 | 207 |
| 261 | 3300025921 | Ga0207652_10003711 | Ga0207652_100037119 | 207 |
| 262 | 3300025921 | Ga0207652_10085091 | Ga0207652_100850912 | 207 |
| 263 | 3300025923 | Ga0207681_10145440 | Ga0207681_101454402 | 207 |
| 264 | 3300025923 | Ga0207681_10567717 | Ga0207681_105677171 | 207 |
| 265 | 3300025925 | Ga0207650_10037062 | Ga0207650_100370622 | 207 |
| 266 | 3300025925 | Ga0207650_10314135 | Ga0207650_103141352 | 207 |
| 267 | 3300025927 | Ga0207687_10012147 | Ga0207687_100121472 | 207 |
| 268 | 3300025927 | Ga0207687_10018747 | Ga0207687_100187472 | 207 |
| 269 | 3300025928 | Ga0207700_10124644 | Ga0207700_101246442 | 207 |
| 270 | 3300025931 | Ga0207644_10496005 | Ga0207644_104960051 | 207 |
| 271 | 3300025932 | Ga0207690_10045874 | Ga0207690_100458742 | 207 |
| 272 | 3300025932 | Ga0207690_10244423 | Ga0207690_102444232 | 207 |
| 273 | 3300025933 | Ga0207706_10009004 | Ga0207706_100090048 | 207 |
| 274 | 3300025933 | Ga0207706_10514088 | Ga0207706_105140882 | 207 |
| 275 | 3300025934 | Ga0207686_10113027 | Ga0207686_101130272 | 207 |
| 276 | 3300025934 | Ga0207686_10132787 | Ga0207686_101327872 | 207 |
| 277 | 3300025934 | Ga0207686_10143449 | Ga0207686_101434492 | 207 |
| 278 | 3300025940 | Ga0207691_10372439 | Ga0207691_103724392 | 207 |
| 279 | 3300025941 | Ga0207711_10120509 | Ga0207711_101205092 | 207 |
| 280 | 3300025941 | Ga0207711_10129708 | Ga0207711_101297083 | 207 |
| 281 | 3300025941 | Ga0207711_10273279 | Ga0207711_102732792 | 207 |
| 282 | 3300025942 | Ga0207689_10000611 | Ga0207689_1000061116 | 207 |
| 283 | 3300025944 | Ga0207661_10048072 | Ga0207661_100480722 | 207 |
| 284 | 3300025944 | Ga0207661_10248010 | Ga0207661_102480102 | 207 |
| 285 | 3300025945 | Ga0207679_10000616 | Ga0207679_100006164 | 207 |
| 286 | 3300025945 | Ga0207679_10042722 | Ga0207679_100427222 | 207 |
| 287 | 3300025960 | Ga0207651_10097023 | Ga0207651_100970233 | 207 |
| 288 | 3300025960 | Ga0207651_10186289 | Ga0207651_101862892 | 207 |
| 289 | 3300025972 | Ga0207668_10058116 | Ga0207668_100581163 | 207 |
| 290 | 3300025972 | Ga0207668_10081808 | Ga0207668_100818082 | 207 |
| 291 | 3300025981 | Ga0207640_10308063 | Ga0207640_103080632 | 207 |
| 292 | 3300025986 | Ga0207658_10082264 | Ga0207658_100822642 | 207 |
| 293 | 3300026023 | Ga0207677_10119300 | Ga0207677_101193002 | 207 |
| 294 | 3300026023 | Ga0207677_10219310 | Ga0207677_102193102 | 207 |
| 295 | 3300026035 | Ga0207703_10159382 | Ga0207703_101593822 | 207 |
| 296 | 3300026035 | Ga0207703_10415957 | Ga0207703_104159572 | 207 |
| 297 | 3300026075 | Ga0207708_10395287 | Ga0207708_103952872 | 207 |
| 298 | 3300026078 | Ga0207702_10029194 | Ga0207702_100291942 | 207 |
| 299 | 3300026088 | Ga0207641_10017716 | Ga0207641_100177162 | 207 |
| 300 | 3300026095 | Ga0207676_10001052 | Ga0207676_100010522 | 207 |
| 301 | 3300026095 | Ga0207676_10407479 | Ga0207676_104074792 | 207 |
| 302 | 3300026116 | Ga0207674_10000120 | Ga0207674_1000012047 | 207 |
| 303 | 3300026116 | Ga0207674_10015240 | Ga0207674_100152404 | 207 |
| 304 | 3300026121 | Ga0207683_10099699 | Ga0207683_100996992 | 207 |
| 305 | 3300026121 | Ga0207683_10311255 | Ga0207683_103112552 | 207 |
| 306 | 3300026121 | Ga0207683_10651009 | Ga0207683_106510092 | 207 |
| 307 | 3300026142 | Ga0207698_10251628 | Ga0207698_102516282 | 207 |
| 308 | 3300028380 | Ga0268265_10177257 | Ga0268265_101772572 | 207 |
| 309 | 3300031731 | Ga0307405_10008940 | Ga0307405_100089402 | 207 |
| 310 | 3300031824 | Ga0307413_10054698 | Ga0307413_100546982 | 207 |
| 311 | 3300031852 | Ga0307410_10014915 | Ga0307410_100149154 | 207 |
| 312 | 3300031901 | Ga0307406_10004563 | Ga0307406_100045634 | 207 |
| 313 | 3300031901 | Ga0307406_10064885 | Ga0307406_100648852 | 207 |
| 314 | 3300031903 | Ga0307407_10049612 | Ga0307407_100496122 | 207 |
| 315 | 3300031911 | Ga0307412_10030643 | Ga0307412_100306433 | 207 |
| 316 | 3300031995 | Ga0307409_100679685 | Ga0307409_1006796852 | 207 |
| 317 | 3300032002 | Ga0307416_100014321 | Ga0307416_1000143214 | 207 |
| 318 | 3300032005 | Ga0307411_10148154 | Ga0307411_101481542 | 207 |
| 319 | 3300032126 | Ga0307415_100009621 | Ga0307415_1000096212 | 207 |
| 320 | 3300035691 | Ga0373931_0038806 | Ga0373931_0038806_1175_1798 | 207 |
| 321 | 3300036401 | Ga0373937_1050696 | Ga0373937_1050696_57_680 | 207 |
| 322 | 3300039437 | Ga0436365_0244643 | Ga0436365_0244643_695_1384 | 207 |
| 323 | 3300039437 | Ga0436365_1790669 | Ga0436365_1790669_317_985 | 207 |
| 324 | 3300044694 | Ga0466963_0009965 | Ga0466963_0009965_951_1604 | 207 |
| 325 | 3300044842 | Ga0466957_0309125 | Ga0466957_0309125_135_788 | 207 |
| 326 | 3300045051 | Ga0451576_0538265 | Ga0451576_0538265_460_1083 | 207 |
| 327 | 3300045976 | Ga0466967_0090544 | Ga0466967_0090544_710_1363 | 207 |
| 328 | 3300046459 | Ga0495629_0009156 | Ga0495629_0009156_6488_7111 | 207 |
| 329 | 3300046473 | Ga0495582_0323277 | Ga0495582_0323277_187_840 | 207 |
| 330 | 3300046499 | Ga0495594_0113147 | Ga0495594_0113147_352_975 | 207 |
| 331 | 3300046689 | Ga0495613_0668766 | Ga0495613_0668766_35_658 | 207 |
| 332 | 3300047315 | Ga0495581_0293085 | Ga0495581_0293085_156_779 | 207 |
| 333 | 3300048911 | Ga0496108_0551708 | Ga0496108_0551708_104_754 | 207 |
| 334 | 3300048913 | Ga0496110_0038626 | Ga0496110_0038626_47_697 | 207 |
| 335 | 3300048914 | Ga0496111_0022804 | Ga0496111_0022804_1207_1857 | 207 |
| 336 | 3300048915 | Ga0496112_0063816 | Ga0496112_0063816_2484_3107 | 207 |
| 337 | 3300049570 | Ga0501033_0037001 | Ga0501033_0037001_116_862 | 207 |
| 338 | 3300049570 | Ga0501033_0120134 | Ga0501033_0120134_462_1091 | 207 |
| 339 | 3300049575 | Ga0501039_0293113 | Ga0501039_0293113_370_1116 | 207 |
| 340 | 3300049581 | Ga0501047_0122406 | Ga0501047_0122406_1183_1929 | 207 |
| 341 | 3300049822 | Ga0501035_0071768 | Ga0501035_0071768_2089_2835 | 207 |
| 342 | 3300049823 | Ga0501044_0102568 | Ga0501044_0102568_580_1326 | 207 |
| 343 | 3300049823 | Ga0501044_0289714 | Ga0501044_0289714_421_1050 | 207 |
| 344 | 3300050513 | nmdc:mga0rr50_240899_c1 | nmdc:mga0rr50_240899_c1_372_995 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1svi-assembly1.cif.gz_A | crystal structure of the gtp-binding protein ysxc complexed with gdp | 0.9218 | 9 | 202 |
| 1svi-assembly1.cif.gz_A | crystal structure of the gtp-binding protein ysxc complexed with gdp | 0.9122 | 9 | 202 |
| 1sul-assembly1.cif.gz_A | crystal structure of the apo-ysxc | 0.9076 | 10 | 202 |
| 3pqc-assembly1.cif.gz_A | crystal structure of thermotoga maritima ribosome biogenesis gtp-binding protein engb (ysxc/yiha) in complex with gdp | 0.905 | 9 | 200 |
| 1svw-assembly2.cif.gz_B | crystal structure of ysxc complexed with gmppnp | 0.9042 | 10 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1sulA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9076 | 10 | 202 | 3.40.50.300 |
| 3pqcA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.905 | 9 | 200 | 3.40.50.300 |
| af_C0H4D6_57_283_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.901 | 26 | 201 | 3.40.50.300 |
| 3pqcA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8961 | 9 | 200 | 3.40.50.300 |
| af_Q8IL49_94_294_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8951 | 12 | 199 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7RU34-F1-model_v4 | Tr-type G domain-containing protein | 0.9816 | 107 | 206 |
GO:0003924
GO:0005525 GO:0005829 |
| AF-A0A1Q7JA29-F1-model_v4 | G domain-containing protein | 0.9789 | 115 | 201 |
|
| AF-A0A0F2IZF0-F1-model_v4 | deleted | 0.97 | 104 | 201 |
|
| AF-A0A143BP95-F1-model_v4 | Probable GTP-binding protein EngB | 0.9577 | 9 | 207 |
GO:0000917
GO:0005525 GO:0046872 |
| AF-A0A645HEP8-F1-model_v4 | Putative GTP-binding protein EngB | 0.9536 | 104 | 201 |
GO:0005829
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar