F416139

General Info

Members Datasets Scaffolds Average Seq Length
344 197 344 213

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0101509|Ga0501033_0101509_1122_1805
Length 227
Sequence VDEVFDAEAIEAARVLFARPVEFLLGAAAVAQLPEPDLPEVAFAGRSNVGKSSLINALTGQKHLARASNEPGRTREVNLFRLDGRVRLVDLPGYGFAQASKTTVAKFQNLGRAYLRGRPNLKRVYLLIDARHGLKKVDAEALDALDQAAVSYQIVLTKADKVRPASDLAKVEAATLKGISRRPAAFPRVAVTSSETGAGIPELRAEIAAAAGLIDPPSPKTGDDRGG

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 1.74
Rhizosphere 95.64
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10175497 3300005290 Bacteria 1220
2 Ga0070658_10249584 3300005327 Bacteria 1505
3 Ga0070683_100122296 3300005329 Bacteria 2459
4 Ga0070683_100133989 3300005329 Bacteria 2345
5 Ga0070683_100373759 3300005329 Bacteria 1358
6 Ga0070690_100292557 3300005330 Bacteria 1165
7 Ga0070670_100012097 3300005331 Bacteria 7379
8 Ga0070670_100061345 3300005331 Bacteria 3228
9 Ga0068869_100016426 3300005334 Bacteria 4989
10 Ga0070680_100007449 3300005336 Bacteria 8350
11 Ga0070680_100081796 3300005336 Bacteria 2665
12 Ga0070680_100115823 3300005336 Bacteria 2234
13 Ga0070680_100677375 3300005336 Bacteria 887
14 Ga0070682_100008710 3300005337 Bacteria 5723
15 Ga0068868_100019705 3300005338 Bacteria 5058
16 Ga0068868_100058182 3300005338 Bacteria 3054
17 Ga0068868_100294885 3300005338 Bacteria 1376
18 Ga0070660_100031636 3300005339 Bacteria 3975
19 Ga0070660_100132256 3300005339 Bacteria 1997
20 Ga0070687_100013571 3300005343 Bacteria 3633
21 Ga0070661_100001686 3300005344 Bacteria 15290
22 Ga0070661_100008607 3300005344 Bacteria 7058
23 Ga0070668_100342360 3300005347 Unclassified 1263
24 Ga0070669_100446158 3300005353 Bacteria 1066
25 Ga0070671_100500971 3300005355 Bacteria 1045
26 Ga0070673_100377148 3300005364 Bacteria 1264
27 Ga0070673_100624139 3300005364 Bacteria 985
28 Ga0070659_100009705 3300005366 Bacteria 7071
29 Ga0070659_100665611 3300005366 Bacteria 898
30 Ga0070659_100951765 3300005366 Bacteria 752
31 Ga0070667_100049075 3300005367 Bacteria 3554
32 Ga0070667_100195360 3300005367 Bacteria 1794
33 Ga0070700_100015928 3300005441 Bacteria 4273
34 Ga0070694_100062903 3300005444 Bacteria 2536
35 Ga0070663_100081920 3300005455 Bacteria 2373
36 Ga0070662_100021590 3300005457 Bacteria 4398
37 Ga0070662_100365407 3300005457 Unclassified 1185
38 Ga0070681_10000537 3300005458 Bacteria 31196
39 Ga0070681_10012055 3300005458 Bacteria 8574
40 Ga0070681_10118671 3300005458 Bacteria 2582
41 Ga0070681_10320118 3300005458 Bacteria 1461
42 Ga0070685_10058253 3300005466 Bacteria 2251
43 Ga0070685_10065184 3300005466 Bacteria 2143
44 Ga0070679_100001266 3300005530 Bacteria 22304
45 Ga0070679_100111728 3300005530 Bacteria 2719
46 Ga0070684_100004930 3300005535 Bacteria 10186
47 Ga0070684_100007871 3300005535 Bacteria 8312
48 Ga0070684_100011110 3300005535 Bacteria 7164
49 Ga0070684_100027899 3300005535 Bacteria 4770
50 Ga0070684_100034892 3300005535 Bacteria 4303
51 Ga0070684_100229939 3300005535 Bacteria 1693
52 Ga0070684_100261006 3300005535 Bacteria 1585
53 Ga0070684_100359375 3300005535 Bacteria 1340
54 Ga0070684_100458819 3300005535 Bacteria 1178
55 Ga0070684_100802515 3300005535 Bacteria 880
56 Ga0068853_100258893 3300005539 Bacteria 1599
57 Ga0070672_100153098 3300005543 Bacteria 1908
58 Ga0070686_100199434 3300005544 Bacteria 1433
59 Ga0070695_100064883 3300005545 Bacteria 2376
60 Ga0070696_100119745 3300005546 Unclassified 1904
61 Ga0070693_100002684 3300005547 Bacteria 8187
62 Ga0070665_100225586 3300005548 Bacteria 1874
63 Ga0070665_100284162 3300005548 Bacteria 1657
64 Ga0070704_100131932 3300005549 Bacteria 1938
65 Ga0068855_100014308 3300005563 Bacteria 9554
66 Ga0068855_100252936 3300005563 Bacteria 1965
67 Ga0068855_100393794 3300005563 Bacteria 1519
68 Ga0070664_100010516 3300005564 Bacteria 7499
69 Ga0070664_100025087 3300005564 Bacteria 4939
70 Ga0070664_100048735 3300005564 Bacteria 3580
71 Ga0070664_100084638 3300005564 Bacteria 2738
72 Ga0068857_100005676 3300005577 Bacteria 10669
73 Ga0068857_100021311 3300005577 Bacteria 5705
74 Ga0068857_100513414 3300005577 Bacteria 1126
75 Ga0068854_100017511 3300005578 Bacteria 4794
76 Ga0068854_100333133 3300005578 Bacteria 1237
77 Ga0068854_100341919 3300005578 Bacteria 1222
78 Ga0068856_100003118 3300005614 Bacteria 16921
79 Ga0068856_100242863 3300005614 Bacteria 1816
80 Ga0070702_100001210 3300005615 Bacteria 10441
81 Ga0070702_100454299 3300005615 Bacteria 930
82 Ga0068852_100272870 3300005616 Bacteria 1628
83 Ga0068852_100584612 3300005616 Bacteria 1120
84 Ga0068859_100069480 3300005617 Bacteria 3557
85 Ga0068859_100770233 3300005617 Bacteria 1051
86 Ga0068864_100004023 3300005618 Bacteria 12078
87 Ga0068861_100035801 3300005719 Bacteria 3680
88 Ga0068851_10097232 3300005834 Bacteria 1558
89 Ga0068870_10014121 3300005840 Bacteria 3767
90 Ga0068870_10048653 3300005840 Bacteria 2234
91 Ga0068863_100202536 3300005841 Bacteria 1910
92 Ga0068863_100653386 3300005841 Unclassified 1043
93 Ga0068862_100430673 3300005844 Bacteria 1240
94 Ga0081540_1000165 3300005983 Bacteria 68435
95 Ga0081539_10038688 3300005985 Bacteria 2823
96 Ga0075368_10006471 3300006042 Bacteria 4094
97 Ga0075367_10238939 3300006178 Bacteria 1138
98 Ga0097621_100035250 3300006237 Bacteria 3998
99 Ga0075428_100044371 3300006844 Bacteria 4885
100 Ga0075428_100366925 3300006844 Bacteria 1544
101 Ga0075428_101454515 3300006844 Bacteria 718
102 Ga0075430_100352434 3300006846 Bacteria 1215
103 Ga0075431_100039959 3300006847 Bacteria 4833
104 Ga0075431_100216561 3300006847 Bacteria 1954
105 Ga0075433_10185771 3300006852 Bacteria 1849
106 Ga0075434_100001638 3300006871 Bacteria 19055
107 Ga0075434_100633119 3300006871 Bacteria 1088
108 Ga0075429_100066623 3300006880 Bacteria 3135
109 Ga0068865_100089149 3300006881 Bacteria 2233
110 Ga0097620_100069473 3300006931 Bacteria 3557
111 Ga0097620_100770291 3300006931 Bacteria 1051
112 Ga0075435_100009981 3300007076 Bacteria 6921
113 Ga0075435_100338882 3300007076 Bacteria 1288
114 Ga0105240_10115287 3300009093 Bacteria 3244
115 Ga0105240_10417669 3300009093 Bacteria 1508
116 Ga0105240_10472205 3300009093 Bacteria 1400
117 Ga0105240_10613015 3300009093 Bacteria 1197
118 Ga0111539_10001966 3300009094 Bacteria 27438
119 Ga0111539_10038988 3300009094 Bacteria 5729
120 Ga0111539_10153504 3300009094 Bacteria 2695
121 Ga0105245_10174490 3300009098 Bacteria 2049
122 Ga0105245_10208966 3300009098 Bacteria 1878
123 Ga0105245_10677315 3300009098 Bacteria 1063
124 Ga0114129_10011383 3300009147 Bacteria 12672
125 Ga0114129_10500148 3300009147 Bacteria 1588
126 Ga0114129_11004236 3300009147 Bacteria 1051
127 Ga0105241_10034803 3300009174 Bacteria 3787
128 Ga0105242_10002426 3300009176 Bacteria 14636
129 Ga0105242_10351185 3300009176 Bacteria 1362
130 Ga0105242_10472181 3300009176 Bacteria 1187
131 Ga0105248_10045024 3300009177 Bacteria 4948
132 Ga0105248_10078676 3300009177 Bacteria 3707
133 Ga0105248_10105793 3300009177 Bacteria 3172
134 Ga0105248_10185184 3300009177 Bacteria 2346
135 Ga0105238_10075022 3300009551 Bacteria 3374
136 Ga0105238_10137658 3300009551 Bacteria 2419
137 Ga0105249_11000598 3300009553 Unclassified 905
138 Ga0105249_11159847 3300009553 Bacteria 843
139 Ga0105239_10678440 3300010375 Bacteria 1178
140 Ga0105246_10000740 3300011119 Bacteria 18544
141 Ga0105246_10422260 3300011119 Unclassified 1113
142 Ga0157373_10014369 3300013100 Bacteria 5803
143 Ga0157373_10237043 3300013100 Bacteria 1289
144 Ga0157373_10265431 3300013100 Bacteria 1215
145 Ga0157371_10030505 3300013102 Bacteria 3889
146 Ga0157371_10045781 3300013102 Bacteria 3113
147 Ga0157370_10002583 3300013104 Bacteria 21754
148 Ga0157370_10652373 3300013104 Bacteria 962
149 Ga0157369_10018895 3300013105 Bacteria 7723
150 Ga0157369_10032821 3300013105 Bacteria 5705
151 Ga0157369_10166940 3300013105 Bacteria 2321
152 Ga0157369_10205671 3300013105 Bacteria 2065
153 Ga0157378_10733970 3300013297 Bacteria 1009
154 Ga0163162_10371198 3300013306 Bacteria 1564
155 Ga0163162_10555871 3300013306 Bacteria 1276
156 Ga0163162_10585765 3300013306 Bacteria 1242
157 Ga0157372_10004564 3300013307 Bacteria 14742
158 Ga0157372_10014053 3300013307 Bacteria 8552
159 Ga0157372_10104874 3300013307 Bacteria 3233
160 Ga0157372_10172147 3300013307 Bacteria 2505
161 Ga0157372_10201592 3300013307 Bacteria 2305
162 Ga0157375_10011506 3300013308 Bacteria 7817
163 Ga0157375_10114633 3300013308 Bacteria 2797
164 Ga0157375_10127039 3300013308 Bacteria 2666
165 Ga0163163_10011972 3300014325 Bacteria 7893
166 Ga0163163_10045719 3300014325 Bacteria 4299
167 Ga0163163_10783621 3300014325 Bacteria 1017
168 Ga0157377_10007774 3300014745 Bacteria 5196
169 Ga0157379_10320651 3300014968 Bacteria 1415
170 Ga0157376_10064884 3300014969 Bacteria 3081
171 Ga0157376_10209203 3300014969 Bacteria 1800
172 Ga0157376_10242900 3300014969 Bacteria 1678
173 Ga0163161_10089485 3300017792 Bacteria 2277
174 Ga0213872_10024453 3300021361 Bacteria 2779
175 Ga0207656_10135668 3300025321 Bacteria 1156
176 Ga0207645_10177928 3300025907 Bacteria 1395
177 Ga0207645_10211372 3300025907 Bacteria 1278
178 Ga0207643_10015691 3300025908 Bacteria 4125
179 Ga0207707_10002059 3300025912 Bacteria 18248
180 Ga0207707_10145600 3300025912 Bacteria 2071
181 Ga0207707_10267977 3300025912 Bacteria 1481
182 Ga0207707_10449248 3300025912 Bacteria 1103
183 Ga0207695_10010019 3300025913 Bacteria 11641
184 Ga0207695_10250474 3300025913 Bacteria 1671
185 Ga0207660_10001001 3300025917 Bacteria 18744
186 Ga0207660_10026312 3300025917 Bacteria 3961
187 Ga0207660_10449904 3300025917 Bacteria 1041
188 Ga0207657_10036213 3300025919 Bacteria 4419
189 Ga0207657_10263088 3300025919 Bacteria 1372
190 Ga0207649_10290369 3300025920 Bacteria 1192
191 Ga0207649_10408579 3300025920 Bacteria 1017
192 Ga0207652_10002364 3300025921 Bacteria 15949
193 Ga0207652_10003711 3300025921 Bacteria 12536
194 Ga0207652_10085091 3300025921 Bacteria 2771
195 Ga0207681_10145440 3300025923 Bacteria 1771
196 Ga0207681_10567717 3300025923 Bacteria 935
197 Ga0207650_10037062 3300025925 Bacteria 3551
198 Ga0207650_10314135 3300025925 Bacteria 1282
199 Ga0207687_10012147 3300025927 Bacteria 5633
200 Ga0207687_10018747 3300025927 Bacteria 4574
201 Ga0207687_10092523 3300025927 Bacteria 2208
202 Ga0207700_10124644 3300025928 Bacteria 2094
203 Ga0207644_10496005 3300025931 Bacteria 1007
204 Ga0207690_10045874 3300025932 Bacteria 2891
205 Ga0207690_10244423 3300025932 Bacteria 1384
206 Ga0207706_10009004 3300025933 Bacteria 9187
207 Ga0207706_10514088 3300025933 Unclassified 1033
208 Ga0207686_10113027 3300025934 Bacteria 1835
209 Ga0207686_10132787 3300025934 Bacteria 1710
210 Ga0207686_10143449 3300025934 Bacteria 1654
211 Ga0207691_10372439 3300025940 Unclassified 1220
212 Ga0207711_10120509 3300025941 Bacteria 2341
213 Ga0207711_10129708 3300025941 Bacteria 2260
214 Ga0207711_10273279 3300025941 Bacteria 1555
215 Ga0207711_10609089 3300025941 Bacteria 1019
216 Ga0207689_10000611 3300025942 Bacteria 34215
217 Ga0207661_10048072 3300025944 Bacteria 3389
218 Ga0207661_10138373 3300025944 Bacteria 2093
219 Ga0207661_10156975 3300025944 Bacteria 1971
220 Ga0207661_10248010 3300025944 Bacteria 1582
221 Ga0207679_10000616 3300025945 Bacteria 23715
222 Ga0207679_10042722 3300025945 Bacteria 3259
223 Ga0207667_10107025 3300025949 Bacteria 2884
224 Ga0207667_10190732 3300025949 Bacteria 2103
225 Ga0207667_10505010 3300025949 Bacteria 1226
226 Ga0207651_10097023 3300025960 Bacteria 2176
227 Ga0207651_10186289 3300025960 Bacteria 1652
228 Ga0207668_10058116 3300025972 Bacteria 2702
229 Ga0207668_10081808 3300025972 Bacteria 2344
230 Ga0207640_10172015 3300025981 Bacteria 1615
231 Ga0207640_10308063 3300025981 Bacteria 1256
232 Ga0207640_10692967 3300025981 Bacteria 872
233 Ga0207658_10082264 3300025986 Bacteria 2472
234 Ga0207677_10119300 3300026023 Bacteria 1981
235 Ga0207677_10219310 3300026023 Bacteria 1524
236 Ga0207703_10159382 3300026035 Bacteria 1975
237 Ga0207703_10415957 3300026035 Bacteria 1250
238 Ga0207678_10069599 3300026067 Bacteria 3017
239 Ga0207708_10030008 3300026075 Bacteria 4123
240 Ga0207708_10395287 3300026075 Unclassified 1142
241 Ga0207702_10029194 3300026078 Bacteria 4587
242 Ga0207641_10017716 3300026088 Bacteria 5835
243 Ga0207676_10001052 3300026095 Bacteria 21024
244 Ga0207676_10407479 3300026095 Bacteria 1272
245 Ga0207674_10000120 3300026116 Bacteria 91883
246 Ga0207674_10015240 3300026116 Bacteria 8456
247 Ga0207675_100093819 3300026118 Bacteria 2823
248 Ga0207675_100926202 3300026118 Bacteria 888
249 Ga0207683_10099699 3300026121 Bacteria 2593
250 Ga0207683_10311255 3300026121 Unclassified 1441
251 Ga0207683_10651009 3300026121 Bacteria 976
252 Ga0207698_10251430 3300026142 Bacteria 1618
253 Ga0207698_10251628 3300026142 Bacteria 1617
254 Ga0209968_1021774 3300027526 Unclassified 1042
255 Ga0209999_1006782 3300027543 Bacteria 2061
256 Ga0209813_10003804 3300027866 Bacteria 3564
257 Ga0207428_10002579 3300027907 Bacteria 18097
258 Ga0207428_10202312 3300027907 Bacteria 1494
259 Ga0268265_10177257 3300028380 Bacteria 1828
260 Ga0265338_10213834 3300028800 Bacteria 1445
261 Ga0307405_10008940 3300031731 Bacteria 5111
262 Ga0307413_10042274 3300031824 Bacteria 2677
263 Ga0307413_10054698 3300031824 Bacteria 2423
264 Ga0307410_10014915 3300031852 Bacteria 4591
265 Ga0307406_10004563 3300031901 Bacteria 7541
266 Ga0307406_10064885 3300031901 Bacteria 2371
267 Ga0307407_10049612 3300031903 Bacteria 2396
268 Ga0307407_10054433 3300031903 Bacteria 2308
269 Ga0307412_10030643 3300031911 Bacteria 3389
270 Ga0307409_100679685 3300031995 Bacteria 1026
271 Ga0307416_100014321 3300032002 Bacteria 5429
272 Ga0307411_10148154 3300032005 Bacteria 1740
273 Ga0307415_100009621 3300032126 Bacteria 5432
274 Ga0373934_0047618 3300035086 Bacteria 1696
275 Ga0373923_0034221 3300035111 Bacteria 2061
276 Ga0373953_0068167 3300035117 Bacteria 1464
277 Ga0373931_0038806 3300035691 Bacteria 2493
278 Ga0373935_0391041 3300035692 Bacteria 997
279 Ga0373933_0155840 3300035724 Bacteria 1449
280 Ga0373937_0293779 3300036401 Bacteria 1535
281 Ga0373937_1050696 3300036401 Bacteria 763
282 Ga0373925_0439922 3300037068 Bacteria 1067
283 Ga0436365_0244643 3300039437 Bacteria 1974
284 Ga0436365_1790669 3300039437 Bacteria 1915
285 Ga0436361_0290947 3300039447 Bacteria 24175
286 Ga0466966_0012857 3300044684 Bacteria 5543
287 Ga0466963_0009965 3300044694 Bacteria 5742
288 Ga0466957_0309125 3300044842 Bacteria 1064
289 Ga0451576_0182534 3300045051 Bacteria 2191
290 Ga0451576_0538265 3300045051 Bacteria 1227
291 Ga0466967_0090544 3300045976 Bacteria 2779
292 Ga0495629_0009156 3300046459 Bacteria 7251
293 Ga0495582_0323277 3300046473 Bacteria 888
294 Ga0495594_0113147 3300046499 Bacteria 1531
295 Ga0495635_0095721 3300046663 Bacteria 2030
296 Ga0495613_0668766 3300046689 Bacteria 686
297 Ga0495581_0293085 3300047315 Bacteria 951
298 Ga0495675_0038529 3300047444 Bacteria 3044
299 Ga0496101_0263716 3300048904 Bacteria 1344
300 Ga0496108_0551708 3300048911 Bacteria 1005
301 Ga0496110_0038626 3300048913 Bacteria 4155
302 Ga0496111_0022804 3300048914 Bacteria 4387
303 Ga0496112_0063816 3300048915 Bacteria 3634
304 Ga0496112_0088305 3300048915 Bacteria 3068
305 Ga0496124_0062561 3300048927 Bacteria 3114
306 Ga0501033_0037001 3300049570 Bacteria 3655
307 Ga0501033_0101509 3300049570 Bacteria 2099
308 Ga0501033_0120134 3300049570 Bacteria 1907
309 Ga0501039_0293113 3300049575 Bacteria 1279
310 Ga0501047_0122406 3300049581 Bacteria 2483
311 Ga0501048_0295709 3300049582 Bacteria 1152
312 Ga0501071_0030257 3300049587 Bacteria 3829
313 Ga0501072_0165158 3300049588 Bacteria 1766
314 Ga0501073_0305095 3300049589 Bacteria 1098
315 Ga0501074_0038637 3300049590 Bacteria 3458
316 Ga0501076_0006165 3300049592 Bacteria 8677
317 Ga0501079_0045092 3300049741 Bacteria 3403
318 Ga0501035_0071768 3300049822 Bacteria 3065
319 Ga0501044_0102568 3300049823 Bacteria 2876
320 Ga0501044_0289714 3300049823 Bacteria 1569
321 nmdc:mga04h51_3536_c1 3300050495 Bacteria 3803
322 nmdc:mga05p37_130339_c1 3300050507 Bacteria 3085
323 nmdc:mga05p37_180482_c1 3300050507 Bacteria 2568
324 nmdc:mga05p37_556006_c1 3300050507 Bacteria 1305
325 nmdc:mga05p37_921191_c1 3300050507 Bacteria 939
326 nmdc:mga0qj67_122295_c1 3300050509 Bacteria 2106
327 nmdc:mga0qj67_318335_c1 3300050509 Bacteria 1259
328 nmdc:mga06r32_215487_c1 3300050510 Bacteria 1908
329 nmdc:mga08y16_162151_c1 3300050511 Bacteria 2323
330 nmdc:mga08y16_26412_c1 3300050511 Bacteria 6123
331 nmdc:mga08y16_87019_c1 3300050511 Bacteria 3256
332 nmdc:mga0n895_7541_c1 3300050512 Bacteria 9349
333 nmdc:mga0rr50_10063_c1 3300050513 Bacteria 5984
334 nmdc:mga0rr50_240899_c1 3300050513 Bacteria 1499
335 nmdc:mga08x19_78146_c1 3300050514 Bacteria 2168
336 nmdc:mga0a205_260234_c1 3300050515 Bacteria 1613
337 Ga0495612_0012833 3300053078 Bacteria 3377
338 Ga0495612_0051917 3300053078 Bacteria 1686
339 Ga0495619_0057036 3300053085 Bacteria 2591
340 Ga0500643_008915 3300053087 Bacteria 3887
341 Ga0500641_0001099 3300053096 Bacteria 9599
342 Ga0501084_0093855 3300054114 Bacteria 2519
343 Ga0501082_0052299 3300060353 Bacteria 3521
344 Ga0530510_0230239 3300061734 Bacteria 1378

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0391041 Ga0373935_0391041_226_876 182
2 3300053078 Ga0495612_0051917 Ga0495612_0051917_294_944 182
3 3300006871 Ga0075434_100001638 Ga0075434_10000163817 183
4 3300007076 Ga0075435_100009981 Ga0075435_1000099812 183
5 3300050512 nmdc:mga0n895_7541_c1 nmdc:mga0n895_7541_c1_8480_9220 183
6 3300050513 nmdc:mga0rr50_10063_c1 nmdc:mga0rr50_10063_c1_5038_5778 183
7 3300050514 nmdc:mga08x19_78146_c1 nmdc:mga08x19_78146_c1_582_1322 183
8 3300005564 Ga0070664_100048735 Ga0070664_1000487352 189
9 3300025907 Ga0207645_10177928 Ga0207645_101779282 197
10 3300005444 Ga0070694_100062903 Ga0070694_1000629032 199
11 3300005549 Ga0070704_100131932 Ga0070704_1001319321 199
12 3300005578 Ga0068854_100341919 Ga0068854_1003419192 199
13 3300025981 Ga0207640_10692967 Ga0207640_106929672 199
14 3300021361 Ga0213872_10024453 Ga0213872_100244533 200
15 3300025907 Ga0207645_10211372 Ga0207645_102113722 200
16 3300026118 Ga0207675_100926202 Ga0207675_1009262022 200
17 3300031824 Ga0307413_10042274 Ga0307413_100422743 200
18 3300031903 Ga0307407_10054433 Ga0307407_100544332 200
19 3300039447 Ga0436361_0290947 Ga0436361_0290947_18203_18856 200
20 3300005336 Ga0070680_100677375 Ga0070680_1006773751 201
21 3300005441 Ga0070700_100015928 Ga0070700_1000159282 201
22 3300005719 Ga0068861_100035801 Ga0068861_1000358012 201
23 3300005983 Ga0081540_1000165 Ga0081540_100016566 201
24 3300006846 Ga0075430_100352434 Ga0075430_1003524341 201
25 3300006880 Ga0075429_100066623 Ga0075429_1000666233 201
26 3300013297 Ga0157378_10733970 Ga0157378_107339701 201
27 3300025917 Ga0207660_10449904 Ga0207660_104499042 201
28 3300026075 Ga0207708_10030008 Ga0207708_100300083 201
29 3300026118 Ga0207675_100093819 Ga0207675_1000938192 201
30 3300028800 Ga0265338_10213834 Ga0265338_102138342 201
31 3300035086 Ga0373934_0047618 Ga0373934_0047618_739_1383 201
32 3300035111 Ga0373923_0034221 Ga0373923_0034221_1356_2000 201
33 3300035117 Ga0373953_0068167 Ga0373953_0068167_101_745 201
34 3300035724 Ga0373933_0155840 Ga0373933_0155840_206_850 201
35 3300036401 Ga0373937_0293779 Ga0373937_0293779_72_716 201
36 3300046663 Ga0495635_0095721 Ga0495635_0095721_901_1545 201
37 3300047444 Ga0495675_0038529 Ga0495675_0038529_619_1263 201
38 3300048927 Ga0496124_0062561 Ga0496124_0062561_421_1065 201
39 3300049582 Ga0501048_0295709 Ga0501048_0295709_297_944 201
40 3300049587 Ga0501071_0030257 Ga0501071_0030257_2132_2779 201
41 3300049588 Ga0501072_0165158 Ga0501072_0165158_511_1158 201
42 3300049589 Ga0501073_0305095 Ga0501073_0305095_165_812 201
43 3300049590 Ga0501074_0038637 Ga0501074_0038637_385_1032 201
44 3300049592 Ga0501076_0006165 Ga0501076_0006165_4676_5323 201
45 3300049741 Ga0501079_0045092 Ga0501079_0045092_321_968 201
46 3300050507 nmdc:mga05p37_180482_c1 nmdc:mga05p37_180482_c1_275_931 201
47 3300050509 nmdc:mga0qj67_122295_c1 nmdc:mga0qj67_122295_c1_1437_2093 201
48 3300053078 Ga0495612_0012833 Ga0495612_0012833_318_962 201
49 3300054114 Ga0501084_0093855 Ga0501084_0093855_1021_1668 201
50 3300060353 Ga0501082_0052299 Ga0501082_0052299_1689_2336 201
51 3300061734 Ga0530510_0230239 Ga0530510_0230239_672_1319 201
52 3300006844 Ga0075428_100044371 Ga0075428_1000443712 202
53 3300006844 Ga0075428_100366925 Ga0075428_1003669252 202
54 3300006844 Ga0075428_101454515 Ga0075428_1014545151 202
55 3300006847 Ga0075431_100216561 Ga0075431_1002165612 202
56 3300006852 Ga0075433_10185771 Ga0075433_101857712 202
57 3300009094 Ga0111539_10001966 Ga0111539_1000196612 202
58 3300009094 Ga0111539_10038988 Ga0111539_100389884 202
59 3300009147 Ga0114129_10011383 Ga0114129_100113838 202
60 3300009147 Ga0114129_11004236 Ga0114129_110042361 202
61 3300027907 Ga0207428_10002579 Ga0207428_1000257914 202
62 3300027907 Ga0207428_10202312 Ga0207428_102023123 202
63 3300050507 nmdc:mga05p37_130339_c1 nmdc:mga05p37_130339_c1_49_726 202
64 3300050507 nmdc:mga05p37_921191_c1 nmdc:mga05p37_921191_c1_111_794 202
65 3300050509 nmdc:mga0qj67_318335_c1 nmdc:mga0qj67_318335_c1_79_756 202
66 3300050510 nmdc:mga06r32_215487_c1 nmdc:mga06r32_215487_c1_853_1533 202
67 3300050511 nmdc:mga08y16_162151_c1 nmdc:mga08y16_162151_c1_1291_1971 202
68 3300050511 nmdc:mga08y16_26412_c1 nmdc:mga08y16_26412_c1_2057_2734 202
69 3300050511 nmdc:mga08y16_87019_c1 nmdc:mga08y16_87019_c1_882_1562 202
70 3300050515 nmdc:mga0a205_260234_c1 nmdc:mga0a205_260234_c1_146_826 202
71 3300005458 Ga0070681_10320118 Ga0070681_103201182 203
72 3300005546 Ga0070696_100119745 Ga0070696_1001197451 203
73 3300027526 Ga0209968_1021774 Ga0209968_10217741 203
74 3300027543 Ga0209999_1006782 Ga0209999_10067822 203
75 3300005327 Ga0070658_10249584 Ga0070658_102495842 204
76 3300005329 Ga0070683_100133989 Ga0070683_1001339892 204
77 3300005336 Ga0070680_100115823 Ga0070680_1001158233 204
78 3300005339 Ga0070660_100132256 Ga0070660_1001322562 204
79 3300005366 Ga0070659_100665611 Ga0070659_1006656112 204
80 3300005455 Ga0070663_100081920 Ga0070663_1000819202 204
81 3300005578 Ga0068854_100017511 Ga0068854_1000175112 204
82 3300005615 Ga0070702_100454299 Ga0070702_1004542991 204
83 3300005616 Ga0068852_100584612 Ga0068852_1005846121 204
84 3300006042 Ga0075368_10006471 Ga0075368_100064712 204
85 3300006178 Ga0075367_10238939 Ga0075367_102389392 204
86 3300006847 Ga0075431_100039959 Ga0075431_1000399591 204
87 3300009093 Ga0105240_10115287 Ga0105240_101152871 204
88 3300009093 Ga0105240_10472205 Ga0105240_104722052 204
89 3300009147 Ga0114129_10500148 Ga0114129_105001481 204
90 3300009551 Ga0105238_10137658 Ga0105238_101376582 204
91 3300013102 Ga0157371_10045781 Ga0157371_100457814 204
92 3300013104 Ga0157370_10652373 Ga0157370_106523732 204
93 3300013105 Ga0157369_10018895 Ga0157369_100188956 204
94 3300013307 Ga0157372_10014053 Ga0157372_100140535 204
95 3300014969 Ga0157376_10242900 Ga0157376_102429002 204
96 3300025913 Ga0207695_10250474 Ga0207695_102504741 204
97 3300025919 Ga0207657_10263088 Ga0207657_102630882 204
98 3300025920 Ga0207649_10408579 Ga0207649_104085792 204
99 3300025949 Ga0207667_10107025 Ga0207667_101070252 204
100 3300025949 Ga0207667_10190732 Ga0207667_101907322 204
101 3300025949 Ga0207667_10505010 Ga0207667_105050102 204
102 3300025981 Ga0207640_10172015 Ga0207640_101720151 204
103 3300026067 Ga0207678_10069599 Ga0207678_100695992 204
104 3300026142 Ga0207698_10251430 Ga0207698_102514302 204
105 3300027866 Ga0209813_10003804 Ga0209813_100038042 204
106 3300037068 Ga0373925_0439922 Ga0373925_0439922_114_797 204
107 3300044684 Ga0466966_0012857 Ga0466966_0012857_3347_3988 204
108 3300050495 nmdc:mga04h51_3536_c1 nmdc:mga04h51_3536_c1_1417_2103 204
109 3300050507 nmdc:mga05p37_556006_c1 nmdc:mga05p37_556006_c1_66_731 204
110 3300053085 Ga0495619_0057036 Ga0495619_0057036_687_1370 204
111 3300005329 Ga0070683_100122296 Ga0070683_1001222962 205
112 3300005535 Ga0070684_100802515 Ga0070684_1008025151 205
113 3300025944 Ga0207661_10156975 Ga0207661_101569752 205
114 3300048904 Ga0496101_0263716 Ga0496101_0263716_288_923 205
115 3300005330 Ga0070690_100292557 Ga0070690_1002925572 206
116 3300005336 Ga0070680_100081796 Ga0070680_1000817963 206
117 3300005458 Ga0070681_10000537 Ga0070681_1000053723 206
118 3300005530 Ga0070679_100001266 Ga0070679_1000012664 206
119 3300005535 Ga0070684_100007871 Ga0070684_1000078715 206
120 3300005535 Ga0070684_100034892 Ga0070684_1000348924 206
121 3300005563 Ga0068855_100014308 Ga0068855_1000143084 206
122 3300005985 Ga0081539_10038688 Ga0081539_100386884 206
123 3300009098 Ga0105245_10677315 Ga0105245_106773152 206
124 3300009176 Ga0105242_10472181 Ga0105242_104721812 206
125 3300010375 Ga0105239_10678440 Ga0105239_106784402 206
126 3300013100 Ga0157373_10237043 Ga0157373_102370432 206
127 3300013104 Ga0157370_10002583 Ga0157370_1000258321 206
128 3300013105 Ga0157369_10032821 Ga0157369_100328212 206
129 3300013105 Ga0157369_10205671 Ga0157369_102056713 206
130 3300013307 Ga0157372_10004564 Ga0157372_100045642 206
131 3300025912 Ga0207707_10145600 Ga0207707_101456002 206
132 3300025913 Ga0207695_10010019 Ga0207695_100100195 206
133 3300025917 Ga0207660_10001001 Ga0207660_100010014 206
134 3300025921 Ga0207652_10002364 Ga0207652_100023642 206
135 3300025927 Ga0207687_10092523 Ga0207687_100925232 206
136 3300025941 Ga0207711_10609089 Ga0207711_106090892 206
137 3300025944 Ga0207661_10138373 Ga0207661_101383732 206
138 3300045051 Ga0451576_0182534 Ga0451576_0182534_504_1187 206
139 3300048915 Ga0496112_0088305 Ga0496112_0088305_641_1282 206
140 3300049570 Ga0501033_0101509 Ga0501033_0101509_1122_1805 206
141 3300053087 Ga0500643_008915 Ga0500643_008915_2687_3367 206
142 3300053096 Ga0500641_0001099 Ga0500641_0001099_6463_7176 206
143 3300005290 Ga0065712_10175497 Ga0065712_101754972 207
144 3300005329 Ga0070683_100373759 Ga0070683_1003737592 207
145 3300005331 Ga0070670_100012097 Ga0070670_1000120974 207
146 3300005331 Ga0070670_100061345 Ga0070670_1000613452 207
147 3300005334 Ga0068869_100016426 Ga0068869_1000164262 207
148 3300005336 Ga0070680_100007449 Ga0070680_1000074494 207
149 3300005337 Ga0070682_100008710 Ga0070682_1000087103 207
150 3300005338 Ga0068868_100019705 Ga0068868_1000197052 207
151 3300005338 Ga0068868_100058182 Ga0068868_1000581823 207
152 3300005338 Ga0068868_100294885 Ga0068868_1002948852 207
153 3300005339 Ga0070660_100031636 Ga0070660_1000316363 207
154 3300005343 Ga0070687_100013571 Ga0070687_1000135712 207
155 3300005344 Ga0070661_100001686 Ga0070661_1000016864 207
156 3300005344 Ga0070661_100008607 Ga0070661_1000086075 207
157 3300005347 Ga0070668_100342360 Ga0070668_1003423602 207
158 3300005353 Ga0070669_100446158 Ga0070669_1004461582 207
159 3300005355 Ga0070671_100500971 Ga0070671_1005009712 207
160 3300005364 Ga0070673_100377148 Ga0070673_1003771482 207
161 3300005364 Ga0070673_100624139 Ga0070673_1006241392 207
162 3300005366 Ga0070659_100009705 Ga0070659_1000097053 207
163 3300005366 Ga0070659_100951765 Ga0070659_1009517651 207
164 3300005367 Ga0070667_100049075 Ga0070667_1000490753 207
165 3300005367 Ga0070667_100195360 Ga0070667_1001953602 207
166 3300005457 Ga0070662_100021590 Ga0070662_1000215902 207
167 3300005457 Ga0070662_100365407 Ga0070662_1003654072 207
168 3300005458 Ga0070681_10012055 Ga0070681_100120555 207
169 3300005458 Ga0070681_10118671 Ga0070681_101186712 207
170 3300005466 Ga0070685_10058253 Ga0070685_100582533 207
171 3300005466 Ga0070685_10065184 Ga0070685_100651843 207
172 3300005530 Ga0070679_100111728 Ga0070679_1001117283 207
173 3300005535 Ga0070684_100004930 Ga0070684_1000049306 207
174 3300005535 Ga0070684_100011110 Ga0070684_1000111105 207
175 3300005535 Ga0070684_100027899 Ga0070684_1000278991 207
176 3300005535 Ga0070684_100229939 Ga0070684_1002299392 207
177 3300005535 Ga0070684_100261006 Ga0070684_1002610062 207
178 3300005535 Ga0070684_100359375 Ga0070684_1003593751 207
179 3300005535 Ga0070684_100458819 Ga0070684_1004588192 207
180 3300005539 Ga0068853_100258893 Ga0068853_1002588932 207
181 3300005543 Ga0070672_100153098 Ga0070672_1001530982 207
182 3300005544 Ga0070686_100199434 Ga0070686_1001994342 207
183 3300005545 Ga0070695_100064883 Ga0070695_1000648832 207
184 3300005547 Ga0070693_100002684 Ga0070693_1000026845 207
185 3300005548 Ga0070665_100225586 Ga0070665_1002255861 207
186 3300005548 Ga0070665_100284162 Ga0070665_1002841622 207
187 3300005563 Ga0068855_100252936 Ga0068855_1002529362 207
188 3300005563 Ga0068855_100393794 Ga0068855_1003937942 207
189 3300005564 Ga0070664_100010516 Ga0070664_1000105166 207
190 3300005564 Ga0070664_100025087 Ga0070664_1000250872 207
191 3300005564 Ga0070664_100084638 Ga0070664_1000846381 207
192 3300005577 Ga0068857_100005676 Ga0068857_1000056762 207
193 3300005577 Ga0068857_100021311 Ga0068857_1000213114 207
194 3300005577 Ga0068857_100513414 Ga0068857_1005134142 207
195 3300005578 Ga0068854_100333133 Ga0068854_1003331332 207
196 3300005614 Ga0068856_100003118 Ga0068856_10000311816 207
197 3300005614 Ga0068856_100242863 Ga0068856_1002428632 207
198 3300005615 Ga0070702_100001210 Ga0070702_1000012105 207
199 3300005616 Ga0068852_100272870 Ga0068852_1002728702 207
200 3300005617 Ga0068859_100069480 Ga0068859_1000694804 207
201 3300005617 Ga0068859_100770233 Ga0068859_1007702332 207
202 3300005618 Ga0068864_100004023 Ga0068864_1000040238 207
203 3300005834 Ga0068851_10097232 Ga0068851_100972321 207
204 3300005840 Ga0068870_10014121 Ga0068870_100141212 207
205 3300005840 Ga0068870_10048653 Ga0068870_100486532 207
206 3300005841 Ga0068863_100202536 Ga0068863_1002025363 207
207 3300005841 Ga0068863_100653386 Ga0068863_1006533862 207
208 3300005844 Ga0068862_100430673 Ga0068862_1004306732 207
209 3300006237 Ga0097621_100035250 Ga0097621_1000352502 207
210 3300006871 Ga0075434_100633119 Ga0075434_1006331192 207
211 3300006881 Ga0068865_100089149 Ga0068865_1000891493 207
212 3300006931 Ga0097620_100069473 Ga0097620_1000694734 207
213 3300006931 Ga0097620_100770291 Ga0097620_1007702912 207
214 3300007076 Ga0075435_100338882 Ga0075435_1003388822 207
215 3300009093 Ga0105240_10417669 Ga0105240_104176692 207
216 3300009093 Ga0105240_10613015 Ga0105240_106130152 207
217 3300009094 Ga0111539_10153504 Ga0111539_101535042 207
218 3300009098 Ga0105245_10174490 Ga0105245_101744902 207
219 3300009098 Ga0105245_10208966 Ga0105245_102089662 207
220 3300009174 Ga0105241_10034803 Ga0105241_100348032 207
221 3300009176 Ga0105242_10002426 Ga0105242_100024265 207
222 3300009176 Ga0105242_10351185 Ga0105242_103511852 207
223 3300009177 Ga0105248_10045024 Ga0105248_100450242 207
224 3300009177 Ga0105248_10078676 Ga0105248_100786764 207
225 3300009177 Ga0105248_10105793 Ga0105248_101057932 207
226 3300009177 Ga0105248_10185184 Ga0105248_101851842 207
227 3300009551 Ga0105238_10075022 Ga0105238_100750222 207
228 3300009553 Ga0105249_11000598 Ga0105249_110005982 207
229 3300009553 Ga0105249_11159847 Ga0105249_111598472 207
230 3300011119 Ga0105246_10000740 Ga0105246_100007404 207
231 3300011119 Ga0105246_10422260 Ga0105246_104222602 207
232 3300013100 Ga0157373_10014369 Ga0157373_100143692 207
233 3300013100 Ga0157373_10265431 Ga0157373_102654312 207
234 3300013102 Ga0157371_10030505 Ga0157371_100305054 207
235 3300013105 Ga0157369_10166940 Ga0157369_101669402 207
236 3300013306 Ga0163162_10371198 Ga0163162_103711982 207
237 3300013306 Ga0163162_10555871 Ga0163162_105558712 207
238 3300013306 Ga0163162_10585765 Ga0163162_105857652 207
239 3300013307 Ga0157372_10104874 Ga0157372_101048744 207
240 3300013307 Ga0157372_10172147 Ga0157372_101721472 207
241 3300013307 Ga0157372_10201592 Ga0157372_102015922 207
242 3300013308 Ga0157375_10011506 Ga0157375_100115062 207
243 3300013308 Ga0157375_10114633 Ga0157375_101146333 207
244 3300013308 Ga0157375_10127039 Ga0157375_101270392 207
245 3300014325 Ga0163163_10011972 Ga0163163_100119725 207
246 3300014325 Ga0163163_10045719 Ga0163163_100457192 207
247 3300014325 Ga0163163_10783621 Ga0163163_107836212 207
248 3300014745 Ga0157377_10007774 Ga0157377_100077744 207
249 3300014968 Ga0157379_10320651 Ga0157379_103206512 207
250 3300014969 Ga0157376_10064884 Ga0157376_100648842 207
251 3300014969 Ga0157376_10209203 Ga0157376_102092032 207
252 3300017792 Ga0163161_10089485 Ga0163161_100894852 207
253 3300025321 Ga0207656_10135668 Ga0207656_101356681 207
254 3300025908 Ga0207643_10015691 Ga0207643_100156914 207
255 3300025912 Ga0207707_10002059 Ga0207707_1000205912 207
256 3300025912 Ga0207707_10267977 Ga0207707_102679772 207
257 3300025912 Ga0207707_10449248 Ga0207707_104492482 207
258 3300025917 Ga0207660_10026312 Ga0207660_100263122 207
259 3300025919 Ga0207657_10036213 Ga0207657_100362132 207
260 3300025920 Ga0207649_10290369 Ga0207649_102903691 207
261 3300025921 Ga0207652_10003711 Ga0207652_100037119 207
262 3300025921 Ga0207652_10085091 Ga0207652_100850912 207
263 3300025923 Ga0207681_10145440 Ga0207681_101454402 207
264 3300025923 Ga0207681_10567717 Ga0207681_105677171 207
265 3300025925 Ga0207650_10037062 Ga0207650_100370622 207
266 3300025925 Ga0207650_10314135 Ga0207650_103141352 207
267 3300025927 Ga0207687_10012147 Ga0207687_100121472 207
268 3300025927 Ga0207687_10018747 Ga0207687_100187472 207
269 3300025928 Ga0207700_10124644 Ga0207700_101246442 207
270 3300025931 Ga0207644_10496005 Ga0207644_104960051 207
271 3300025932 Ga0207690_10045874 Ga0207690_100458742 207
272 3300025932 Ga0207690_10244423 Ga0207690_102444232 207
273 3300025933 Ga0207706_10009004 Ga0207706_100090048 207
274 3300025933 Ga0207706_10514088 Ga0207706_105140882 207
275 3300025934 Ga0207686_10113027 Ga0207686_101130272 207
276 3300025934 Ga0207686_10132787 Ga0207686_101327872 207
277 3300025934 Ga0207686_10143449 Ga0207686_101434492 207
278 3300025940 Ga0207691_10372439 Ga0207691_103724392 207
279 3300025941 Ga0207711_10120509 Ga0207711_101205092 207
280 3300025941 Ga0207711_10129708 Ga0207711_101297083 207
281 3300025941 Ga0207711_10273279 Ga0207711_102732792 207
282 3300025942 Ga0207689_10000611 Ga0207689_1000061116 207
283 3300025944 Ga0207661_10048072 Ga0207661_100480722 207
284 3300025944 Ga0207661_10248010 Ga0207661_102480102 207
285 3300025945 Ga0207679_10000616 Ga0207679_100006164 207
286 3300025945 Ga0207679_10042722 Ga0207679_100427222 207
287 3300025960 Ga0207651_10097023 Ga0207651_100970233 207
288 3300025960 Ga0207651_10186289 Ga0207651_101862892 207
289 3300025972 Ga0207668_10058116 Ga0207668_100581163 207
290 3300025972 Ga0207668_10081808 Ga0207668_100818082 207
291 3300025981 Ga0207640_10308063 Ga0207640_103080632 207
292 3300025986 Ga0207658_10082264 Ga0207658_100822642 207
293 3300026023 Ga0207677_10119300 Ga0207677_101193002 207
294 3300026023 Ga0207677_10219310 Ga0207677_102193102 207
295 3300026035 Ga0207703_10159382 Ga0207703_101593822 207
296 3300026035 Ga0207703_10415957 Ga0207703_104159572 207
297 3300026075 Ga0207708_10395287 Ga0207708_103952872 207
298 3300026078 Ga0207702_10029194 Ga0207702_100291942 207
299 3300026088 Ga0207641_10017716 Ga0207641_100177162 207
300 3300026095 Ga0207676_10001052 Ga0207676_100010522 207
301 3300026095 Ga0207676_10407479 Ga0207676_104074792 207
302 3300026116 Ga0207674_10000120 Ga0207674_1000012047 207
303 3300026116 Ga0207674_10015240 Ga0207674_100152404 207
304 3300026121 Ga0207683_10099699 Ga0207683_100996992 207
305 3300026121 Ga0207683_10311255 Ga0207683_103112552 207
306 3300026121 Ga0207683_10651009 Ga0207683_106510092 207
307 3300026142 Ga0207698_10251628 Ga0207698_102516282 207
308 3300028380 Ga0268265_10177257 Ga0268265_101772572 207
309 3300031731 Ga0307405_10008940 Ga0307405_100089402 207
310 3300031824 Ga0307413_10054698 Ga0307413_100546982 207
311 3300031852 Ga0307410_10014915 Ga0307410_100149154 207
312 3300031901 Ga0307406_10004563 Ga0307406_100045634 207
313 3300031901 Ga0307406_10064885 Ga0307406_100648852 207
314 3300031903 Ga0307407_10049612 Ga0307407_100496122 207
315 3300031911 Ga0307412_10030643 Ga0307412_100306433 207
316 3300031995 Ga0307409_100679685 Ga0307409_1006796852 207
317 3300032002 Ga0307416_100014321 Ga0307416_1000143214 207
318 3300032005 Ga0307411_10148154 Ga0307411_101481542 207
319 3300032126 Ga0307415_100009621 Ga0307415_1000096212 207
320 3300035691 Ga0373931_0038806 Ga0373931_0038806_1175_1798 207
321 3300036401 Ga0373937_1050696 Ga0373937_1050696_57_680 207
322 3300039437 Ga0436365_0244643 Ga0436365_0244643_695_1384 207
323 3300039437 Ga0436365_1790669 Ga0436365_1790669_317_985 207
324 3300044694 Ga0466963_0009965 Ga0466963_0009965_951_1604 207
325 3300044842 Ga0466957_0309125 Ga0466957_0309125_135_788 207
326 3300045051 Ga0451576_0538265 Ga0451576_0538265_460_1083 207
327 3300045976 Ga0466967_0090544 Ga0466967_0090544_710_1363 207
328 3300046459 Ga0495629_0009156 Ga0495629_0009156_6488_7111 207
329 3300046473 Ga0495582_0323277 Ga0495582_0323277_187_840 207
330 3300046499 Ga0495594_0113147 Ga0495594_0113147_352_975 207
331 3300046689 Ga0495613_0668766 Ga0495613_0668766_35_658 207
332 3300047315 Ga0495581_0293085 Ga0495581_0293085_156_779 207
333 3300048911 Ga0496108_0551708 Ga0496108_0551708_104_754 207
334 3300048913 Ga0496110_0038626 Ga0496110_0038626_47_697 207
335 3300048914 Ga0496111_0022804 Ga0496111_0022804_1207_1857 207
336 3300048915 Ga0496112_0063816 Ga0496112_0063816_2484_3107 207
337 3300049570 Ga0501033_0037001 Ga0501033_0037001_116_862 207
338 3300049570 Ga0501033_0120134 Ga0501033_0120134_462_1091 207
339 3300049575 Ga0501039_0293113 Ga0501039_0293113_370_1116 207
340 3300049581 Ga0501047_0122406 Ga0501047_0122406_1183_1929 207
341 3300049822 Ga0501035_0071768 Ga0501035_0071768_2089_2835 207
342 3300049823 Ga0501044_0102568 Ga0501044_0102568_580_1326 207
343 3300049823 Ga0501044_0289714 Ga0501044_0289714_421_1050 207
344 3300050513 nmdc:mga0rr50_240899_c1 nmdc:mga0rr50_240899_c1_372_995 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01926

MMR_HSR1

50S ribosome-binding GTPase

40

158

0.84

PF02421

FeoB_N

Ferrous iron transport protein B

39

207

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1svi-assembly1.cif.gz_A crystal structure of the gtp-binding protein ysxc complexed with gdp 0.9218 9 202
1svi-assembly1.cif.gz_A crystal structure of the gtp-binding protein ysxc complexed with gdp 0.9122 9 202
1sul-assembly1.cif.gz_A crystal structure of the apo-ysxc 0.9076 10 202
3pqc-assembly1.cif.gz_A crystal structure of thermotoga maritima ribosome biogenesis gtp-binding protein engb (ysxc/yiha) in complex with gdp 0.905 9 200
1svw-assembly2.cif.gz_B crystal structure of ysxc complexed with gmppnp 0.9042 10 202
ID Description Score Start End Superfamily
1sulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9076 10 202 3.40.50.300
3pqcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.905 9 200 3.40.50.300
af_C0H4D6_57_283_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.901 26 201 3.40.50.300
3pqcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8961 9 200 3.40.50.300
af_Q8IL49_94_294_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8951 12 199 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V7RU34-F1-model_v4 Tr-type G domain-containing protein 0.9816 107 206 GO:0003924
GO:0005525
GO:0005829
AF-A0A1Q7JA29-F1-model_v4 G domain-containing protein 0.9789 115 201
AF-A0A0F2IZF0-F1-model_v4 deleted 0.97 104 201
AF-A0A143BP95-F1-model_v4 Probable GTP-binding protein EngB 0.9577 9 207 GO:0000917
GO:0005525
GO:0046872
AF-A0A645HEP8-F1-model_v4 Putative GTP-binding protein EngB 0.9536 104 201 GO:0005829

Feature Viewer

pLDDT pTM Quality
85.24 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map