F416035

General Info

Members Datasets Scaffolds Average Seq Length
344 180 688 370

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0001793|Ga0373934_0001793_1622_2761
Length 379
Sequence MKLTTTVLLGLCLAPAGFADDGDRLLRLDHYVQVRSTVPAIAGQSTQIYVREVVEAATALRGGPAADRVALFIHGAGTPAEVSFDVPYQDYSWMAYLAHAGFDVFSMDMTGYGRSTRPAAMNDPCNLTDKQQALYVPSLITLEKGAPCAPSYPRQMTTLASDWNDIDAVVNHVRALRHVDKLNLLAWSLGGPRSAGYAAQHADKVAKLVLLAPAYNRAAKADAPEQVPASGAAFNTQSREEFITNWDRQVGCPDQYTTGALDSVWSEMIASDPVGATWGSGVRRAPQVTSWGWTTAVVAKTQIPTLMVAGAHDKQVNPDRVRELYADLGSPKKVFVDLACSSHNAMWEKNHLLLFNASLEWLTQGTVQGKPEGMLRLGY

Samples

Sample ID Description Type Environment
1 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 1.45
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 12.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373934_0001793 3300035086 Bacteria 7889
2 Ga0065715_10089196 3300005293 Bacteria 12749
3 Ga0070658_10094338 3300005327 Unclassified 2469
4 Ga0070683_100000270 3300005329 Bacteria 35707
5 Ga0070683_100008700 3300005329 Bacteria 8631
6 Ga0070683_100038882 3300005329 Bacteria 4363
7 Ga0070683_100078549 3300005329 Unclassified 3088
8 Ga0070683_100226201 3300005329 Bacteria 1778
9 Ga0070670_100000476 3300005331 Bacteria 32289
10 Ga0070670_100149967 3300005331 Bacteria 2018
11 Ga0070677_10042644 3300005333 Bacteria 1798
12 Ga0068869_100174396 3300005334 Bacteria 1682
13 Ga0070666_10049243 3300005335 Bacteria 2831
14 Ga0070666_10227346 3300005335 Bacteria 1317
15 Ga0070680_100003358 3300005336 Bacteria 11946
16 Ga0070660_100025323 3300005339 Bacteria 4410
17 Ga0070691_10000471 3300005341 Bacteria 15009
18 Ga0070675_100226296 3300005354 Bacteria 1630
19 Ga0070671_100126757 3300005355 Bacteria 2149
20 Ga0070674_100091440 3300005356 Bacteria 2197
21 Ga0070673_100050702 3300005364 Bacteria 3246
22 Ga0070673_100220611 3300005364 Bacteria 1641
23 Ga0070667_100269995 3300005367 Bacteria 1525
24 Ga0070713_100010478 3300005436 Bacteria 6696
25 Ga0070713_100011857 3300005436 Bacteria 6369
26 Ga0070701_10031011 3300005438 Unclassified 2650
27 Ga0070700_100041025 3300005441 Bacteria 2836
28 Ga0070708_100270279 3300005445 Unclassified 1599
29 Ga0070681_10001619 3300005458 Bacteria 20054
30 Ga0070681_10012942 3300005458 Bacteria 8285
31 Ga0070706_100058644 3300005467 Bacteria 3553
32 Ga0070706_100242211 3300005467 Unclassified 1684
33 Ga0070707_100068549 3300005468 Bacteria 3415
34 Ga0070699_100010222 3300005518 Bacteria 8118
35 Ga0070679_100000460 3300005530 Bacteria 34597
36 Ga0070679_100078211 3300005530 Bacteria 3297
37 Ga0070684_100000429 3300005535 Bacteria 28837
38 Ga0070684_100044167 3300005535 Unclassified 3853
39 Ga0070684_100049359 3300005535 Bacteria 3652
40 Ga0070684_100190902 3300005535 Bacteria 1864
41 Ga0070684_100256701 3300005535 Bacteria 1598
42 Ga0070697_100254267 3300005536 Unclassified 1503
43 Ga0070693_100044906 3300005547 Bacteria 2502
44 Ga0070665_100010083 3300005548 Bacteria 9561
45 Ga0070665_100021737 3300005548 Bacteria 6451
46 Ga0068855_100045399 3300005563 Bacteria 5197
47 Ga0070664_100008270 3300005564 Bacteria 8415
48 Ga0070664_100106697 3300005564 Bacteria 2441
49 Ga0068857_100000711 3300005577 Bacteria 24791
50 Ga0068857_100008051 3300005577 Bacteria 9090
51 Ga0068857_100032494 3300005577 Unclassified 4614
52 Ga0068857_100041614 3300005577 Bacteria 4075
53 Ga0068857_100073774 3300005577 Unclassified 3041
54 Ga0068857_100080620 3300005577 Bacteria 2906
55 Ga0068856_100001812 3300005614 Bacteria 22314
56 Ga0068856_100007525 3300005614 Bacteria 10631
57 Ga0068856_100045508 3300005614 Bacteria 4322
58 Ga0068856_100055475 3300005614 Bacteria 3910
59 Ga0068852_100001130 3300005616 Bacteria 17657
60 Ga0068859_100003100 3300005617 Bacteria 16872
61 Ga0068859_100187267 3300005617 Bacteria 2154
62 Ga0068864_100008123 3300005618 Bacteria 8654
63 Ga0068864_100019145 3300005618 Bacteria 5723
64 Ga0068864_100041595 3300005618 Bacteria 3931
65 Ga0068864_100206932 3300005618 Bacteria 1805
66 Ga0068861_100142076 3300005719 Bacteria 1960
67 Ga0068851_10059248 3300005834 Bacteria 1958
68 Ga0068870_10029960 3300005840 Bacteria 2747
69 Ga0068863_100187324 3300005841 Bacteria 1988
70 Ga0068858_100054082 3300005842 Bacteria 3712
71 Ga0068858_100057211 3300005842 Bacteria 3604
72 Ga0068860_100023237 3300005843 Bacteria 5991
73 Ga0068860_100206999 3300005843 Bacteria 1903
74 Ga0081539_10000047 3300005985 Bacteria 275235
75 Ga0070712_100297157 3300006175 Bacteria 1306
76 Ga0097621_100015951 3300006237 Bacteria 5666
77 Ga0097621_100029776 3300006237 Bacteria 4315
78 Ga0097621_100044593 3300006237 Bacteria 3578
79 Ga0097621_100046565 3300006237 Bacteria 3510
80 Ga0097621_100082278 3300006237 Bacteria 2681
81 Ga0097621_100175917 3300006237 Unclassified 1847
82 Ga0068871_100001580 3300006358 Bacteria 15312
83 Ga0068871_100008507 3300006358 Bacteria 7379
84 Ga0068871_100029520 3300006358 Bacteria 4307
85 Ga0068871_100058249 3300006358 Bacteria 3145
86 Ga0068871_100069669 3300006358 Bacteria 2889
87 Ga0068871_100184416 3300006358 Bacteria 1795
88 Ga0075428_100444987 3300006844 Bacteria 1388
89 Ga0075430_100022439 3300006846 Bacteria 5371
90 Ga0075430_100191187 3300006846 Bacteria 1701
91 Ga0075431_100005723 3300006847 Bacteria 12287
92 Ga0075431_100234849 3300006847 Bacteria 1867
93 Ga0075431_100263133 3300006847 Bacteria 1750
94 Ga0075429_100032271 3300006880 Bacteria 4552
95 Ga0068865_100017871 3300006881 Bacteria 4567
96 Ga0097620_100003100 3300006931 Bacteria 16872
97 Ga0097620_100187255 3300006931 Bacteria 2154
98 Ga0099794_10025338 3300007265 Unclassified 2731
99 Ga0099794_10028729 3300007265 Bacteria 2587
100 Ga0105240_10019336 3300009093 Bacteria 9102
101 Ga0105240_10026902 3300009093 Bacteria 7542
102 Ga0105240_10039368 3300009093 Bacteria 6055
103 Ga0105240_10401285 3300009093 Unclassified 1544
104 Ga0111539_10000002 3300009094 Bacteria 983359
105 Ga0111539_10006726 3300009094 Bacteria 14795
106 Ga0111539_10033095 3300009094 Bacteria 6276
107 Ga0111539_10044241 3300009094 Bacteria 5335
108 Ga0111539_10293107 3300009094 Bacteria 1893
109 Ga0105245_10000490 3300009098 Bacteria 36264
110 Ga0105245_10001329 3300009098 Bacteria 22371
111 Ga0105245_10026070 3300009098 Bacteria 5144
112 Ga0105245_10031131 3300009098 Bacteria 4720
113 Ga0105245_10032149 3300009098 Bacteria 4645
114 Ga0105245_10105108 3300009098 Bacteria 2618
115 Ga0105245_10403335 3300009098 Bacteria 1367
116 Ga0105247_10007752 3300009101 Bacteria 6569
117 Ga0114129_10035545 3300009147 Bacteria 7038
118 Ga0105243_10047722 3300009148 Unclassified 3373
119 Ga0105243_10102739 3300009148 Bacteria 2376
120 Ga0105241_10008941 3300009174 Bacteria 7365
121 Ga0105241_10014043 3300009174 Bacteria 5870
122 Ga0105241_10040680 3300009174 Bacteria 3510
123 Ga0105241_10147592 3300009174 Unclassified 1921
124 Ga0105242_10002238 3300009176 Bacteria 15262
125 Ga0105242_10002411 3300009176 Bacteria 14696
126 Ga0105242_10005257 3300009176 Bacteria 9994
127 Ga0105242_10120553 3300009176 Unclassified 2250
128 Ga0105248_10040321 3300009177 Bacteria 5234
129 Ga0105248_10073407 3300009177 Unclassified 3845
130 Ga0105248_10117442 3300009177 Unclassified 3000
131 Ga0105248_10131035 3300009177 Bacteria 2829
132 Ga0105248_10219899 3300009177 Bacteria 2138
133 Ga0105248_10281575 3300009177 Unclassified 1872
134 Ga0105248_10552667 3300009177 Bacteria 1299
135 Ga0105237_10016704 3300009545 Bacteria 7620
136 Ga0105237_10029749 3300009545 Bacteria 5550
137 Ga0105237_10073470 3300009545 Bacteria 3412
138 Ga0105237_10098697 3300009545 Bacteria 2911
139 Ga0105237_10124487 3300009545 Bacteria 2572
140 Ga0105237_10212398 3300009545 Bacteria 1935
141 Ga0105237_10285723 3300009545 Bacteria 1652
142 Ga0105238_10002619 3300009551 Bacteria 17943
143 Ga0105238_10005378 3300009551 Bacteria 12655
144 Ga0105238_10033796 3300009551 Bacteria 5203
145 Ga0105238_10037528 3300009551 Bacteria 4925
146 Ga0105238_10042237 3300009551 Bacteria 4618
147 Ga0105238_10059483 3300009551 Bacteria 3828
148 Ga0105238_10069572 3300009551 Unclassified 3520
149 Ga0105238_10108124 3300009551 Bacteria 2762
150 Ga0105249_10118654 3300009553 Bacteria 2511
151 Ga0099796_10049250 3300010159 Unclassified 1456
152 Ga0105239_10001006 3300010375 Bacteria 39492
153 Ga0105239_10012990 3300010375 Bacteria 9264
154 Ga0105239_10028611 3300010375 Bacteria 6127
155 Ga0105239_10050464 3300010375 Unclassified 4563
156 Ga0105239_10066174 3300010375 Bacteria 3970
157 Ga0105239_10475776 3300010375 Unclassified 1419
158 Ga0105246_10030518 3300011119 Bacteria 3561
159 Ga0105246_10031969 3300011119 Bacteria 3486
160 Ga0105246_10078215 3300011119 Bacteria 2349
161 Ga0105246_10241799 3300011119 Bacteria 1427
162 Ga0157370_10003838 3300013104 Bacteria 17525
163 Ga0157370_10005328 3300013104 Bacteria 14443
164 Ga0157369_10001252 3300013105 Bacteria 31596
165 Ga0157369_10018627 3300013105 Bacteria 7783
166 Ga0157374_10003740 3300013296 Bacteria 12790
167 Ga0157374_10039137 3300013296 Bacteria 4363
168 Ga0157374_10041742 3300013296 Bacteria 4230
169 Ga0157374_10049699 3300013296 Bacteria 3896
170 Ga0157374_10189806 3300013296 Unclassified 2010
171 Ga0157378_10014594 3300013297 Bacteria 6878
172 Ga0157378_10129451 3300013297 Bacteria 2335
173 Ga0157378_10134395 3300013297 Unclassified 2292
174 Ga0163162_10001848 3300013306 Bacteria 19926
175 Ga0163162_10051094 3300013306 Bacteria 4146
176 Ga0163162_10356914 3300013306 Bacteria 1595
177 Ga0157372_10003563 3300013307 Bacteria 16762
178 Ga0157372_10072604 3300013307 Bacteria 3878
179 Ga0157375_10017899 3300013308 Bacteria 6409
180 Ga0157375_10061093 3300013308 Bacteria 3740
181 Ga0163163_10003894 3300014325 Bacteria 12725
182 Ga0163163_10036439 3300014325 Bacteria 4778
183 Ga0163163_10087629 3300014325 Unclassified 3123
184 Ga0163163_10116296 3300014325 Bacteria 2705
185 Ga0163163_10119531 3300014325 Bacteria 2668
186 Ga0163163_10440396 3300014325 Bacteria 1363
187 Ga0157380_10087736 3300014326 Bacteria 2558
188 Ga0157379_10019192 3300014968 Bacteria 6037
189 Ga0157376_10069254 3300014969 Bacteria 2990
190 Ga0207710_10067225 3300025900 Unclassified 1637
191 Ga0207699_10071695 3300025906 Bacteria 2120
192 Ga0207705_10160122 3300025909 Unclassified 1691
193 Ga0207654_10018877 3300025911 Bacteria 3626
194 Ga0207707_10000710 3300025912 Bacteria 33104
195 Ga0207707_10344276 3300025912 Bacteria 1285
196 Ga0207695_10000736 3300025913 Bacteria 63434
197 Ga0207695_10008925 3300025913 Bacteria 12481
198 Ga0207671_10076034 3300025914 Bacteria 2512
199 Ga0207671_10101418 3300025914 Bacteria 2181
200 Ga0207663_10086265 3300025916 Bacteria 2070
201 Ga0207660_10033770 3300025917 Bacteria 3542
202 Ga0207657_10037399 3300025919 Bacteria 4334
203 Ga0207652_10001452 3300025921 Bacteria 20972
204 Ga0207652_10169408 3300025921 Bacteria 1959
205 Ga0207681_10260755 3300025923 Bacteria 1357
206 Ga0207694_10000519 3300025924 Bacteria 34909
207 Ga0207694_10001805 3300025924 Bacteria 17837
208 Ga0207694_10008394 3300025924 Bacteria 7799
209 Ga0207694_10031661 3300025924 Bacteria 4043
210 Ga0207694_10186310 3300025924 Bacteria 1684
211 Ga0207650_10006088 3300025925 Bacteria 8226
212 Ga0207687_10010444 3300025927 Bacteria 6066
213 Ga0207687_10032622 3300025927 Bacteria 3528
214 Ga0207687_10045144 3300025927 Bacteria 3045
215 Ga0207700_10000874 3300025928 Bacteria 17379
216 Ga0207700_10046450 3300025928 Bacteria 3211
217 Ga0207644_10049197 3300025931 Bacteria 3017
218 Ga0207706_10127637 3300025933 Bacteria 2236
219 Ga0207686_10002337 3300025934 Bacteria 10369
220 Ga0207686_10005973 3300025934 Bacteria 6535
221 Ga0207686_10134498 3300025934 Unclassified 1700
222 Ga0207709_10186797 3300025935 Bacteria 1468
223 Ga0207704_10009200 3300025938 Bacteria 4756
224 Ga0207711_10001331 3300025941 Bacteria 23378
225 Ga0207711_10017092 3300025941 Bacteria 6026
226 Ga0207711_10030961 3300025941 Bacteria 4514
227 Ga0207711_10053758 3300025941 Bacteria 3454
228 Ga0207689_10011054 3300025942 Bacteria 7756
229 Ga0207689_10103602 3300025942 Bacteria 2338
230 Ga0207661_10000942 3300025944 Bacteria 19151
231 Ga0207661_10019094 3300025944 Bacteria 5103
232 Ga0207661_10074095 3300025944 Bacteria 2790
233 Ga0207661_10151083 3300025944 Unclassified 2007
234 Ga0207661_10155940 3300025944 Bacteria 1978
235 Ga0207679_10015130 3300025945 Bacteria 5089
236 Ga0207667_10000286 3300025949 Bacteria 69623
237 Ga0207667_10020184 3300025949 Bacteria 7417
238 Ga0207667_10035279 3300025949 Bacteria 5366
239 Ga0207712_10029922 3300025961 Bacteria 3658
240 Ga0207640_10049425 3300025981 Bacteria 2723
241 Ga0207677_10027544 3300026023 Bacteria 3581
242 Ga0207703_10085216 3300026035 Bacteria 2644
243 Ga0207639_10015223 3300026041 Bacteria 5420
244 Ga0207708_10027916 3300026075 Bacteria 4273
245 Ga0207702_10002807 3300026078 Bacteria 16307
246 Ga0207702_10042502 3300026078 Unclassified 3813
247 Ga0207702_10054286 3300026078 Unclassified 3395
248 Ga0207702_10223535 3300026078 Unclassified 1755
249 Ga0207648_10035559 3300026089 Bacteria 4388
250 Ga0207676_10011418 3300026095 Bacteria 6349
251 Ga0207676_10072924 3300026095 Bacteria 2761
252 Ga0207674_10001790 3300026116 Bacteria 27420
253 Ga0207674_10008956 3300026116 Bacteria 11501
254 Ga0207674_10036045 3300026116 Bacteria 5159
255 Ga0207675_100020144 3300026118 Bacteria 6220
256 Ga0207675_100176516 3300026118 Bacteria 2044
257 Ga0207683_10015800 3300026121 Bacteria 6426
258 Ga0207698_10001587 3300026142 Bacteria 13256
259 Ga0207428_10000004 3300027907 Bacteria 727800
260 Ga0207428_10053449 3300027907 Bacteria 3220
261 Ga0207428_10129543 3300027907 Bacteria 1931
262 Ga0268266_10013084 3300028379 Bacteria 7155
263 Ga0268266_10227985 3300028379 Unclassified 1715
264 Ga0268264_10086646 3300028381 Bacteria 2691
265 Ga0265325_10006098 3300031241 Bacteria 7367
266 Ga0265329_10045302 3300031242 Bacteria 1406
267 Ga0265313_10001687 3300031595 Bacteria 20403
268 Ga0265314_10008548 3300031711 Bacteria 8753
269 Ga0265314_10089451 3300031711 Bacteria 2008
270 Ga0307409_100004744 3300031995 Bacteria 7700
271 Ga0307409_100368856 3300031995 Bacteria 1361
272 Ga0307416_100025161 3300032002 Bacteria 4360
273 Ga0307415_100210411 3300032126 Bacteria 1551
274 Ga0373923_0047715 3300035111 Bacteria 1786
275 Ga0373953_0011040 3300035117 Bacteria 3158
276 Ga0373954_0002248 3300035118 Bacteria 8030
277 Ga0373956_0070019 3300035119 Bacteria 1600
278 Ga0373955_0062995 3300035172 Bacteria 2052
279 Ga0373931_0051972 3300035691 Unclassified 2184
280 Ga0373927_0055687 3300035695 Unclassified 2557
281 Ga0373927_0096767 3300035695 Bacteria 1919
282 Ga0373927_0205331 3300035695 Unclassified 1294
283 Ga0373933_0131695 3300035724 Unclassified 1573
284 Ga0373947_0038230 3300035725 Unclassified 2850
285 Ga0373937_0010791 3300036401 Bacteria 7996
286 Ga0373937_0013729 3300036401 Bacteria 7137
287 Ga0373937_0023879 3300036401 Bacteria 5513
288 Ga0373937_0026369 3300036401 Bacteria 5252
289 Ga0373937_0033646 3300036401 Bacteria 4657
290 Ga0373925_0020016 3300037068 Bacteria 4869
291 Ga0373925_0151206 3300037068 Bacteria 1823
292 Ga0373925_0183175 3300037068 Bacteria 1659
293 Ga0395900_0066419 3300037418 Bacteria 3706
294 Ga0439450_004131 3300042008 Bacteria 2457
295 Ga0495592_0011259 3300046454 Bacteria 6764
296 Ga0495580_0021439 3300046472 Unclassified 4767
297 Ga0495582_0019623 3300046473 Unclassified 3697
298 Ga0495664_0143080 3300046477 Unclassified 1450
299 Ga0495630_0005542 3300046517 Bacteria 8909
300 Ga0495587_0020070 3300046536 Bacteria 4129
301 Ga0495667_0042446 3300046559 Bacteria 3016
302 Ga0495684_0019442 3300047471 Bacteria 5230
303 Ga0495684_0126928 3300047471 Bacteria 1918
304 Ga0495602_0005520 3300048088 Bacteria 13267
305 Ga0496104_0304150 3300048907 Bacteria 1507
306 Ga0496112_0015161 3300048915 Bacteria 7182
307 Ga0496114_0154447 3300048917 Bacteria 1992
308 Ga0496114_0245214 3300048917 Bacteria 1576
309 Ga0496115_0102180 3300048918 Bacteria 2351
310 Ga0501033_0070135 3300049570 Bacteria 2575
311 Ga0501036_0016489 3300049572 Bacteria 6171
312 Ga0501038_0032910 3300049574 Bacteria 4569
313 Ga0501039_0172942 3300049575 Bacteria 1698
314 Ga0501040_0006595 3300049576 Bacteria 7534
315 Ga0501040_0142619 3300049576 Bacteria 1688
316 Ga0501041_0017428 3300049577 Unclassified 4274
317 Ga0501042_0069973 3300049578 Bacteria 2510
318 Ga0501046_0004024 3300049580 Bacteria 13423
319 Ga0501048_0111917 3300049582 Bacteria 1928
320 Ga0501068_0004034 3300049584 Bacteria 7988
321 Ga0501071_0008877 3300049587 Bacteria 6665
322 Ga0501071_0190585 3300049587 Bacteria 1538
323 Ga0501073_0011175 3300049589 Bacteria 6565
324 Ga0501075_0002682 3300049591 Bacteria 11896
325 Ga0501076_0004095 3300049592 Bacteria 10307
326 Ga0501079_0002750 3300049741 Bacteria 12822
327 Ga0501045_0002541 3300049824 Bacteria 12433
328 nmdc:mga05p37_4776_c1 3300050507 Bacteria 15834
329 nmdc:mga09592_29203_c1 3300050508 Bacteria 4586
330 nmdc:mga0qj67_193121_c1 3300050509 Bacteria 1654
331 nmdc:mga0qj67_3659_c1 3300050509 Bacteria 11103
332 nmdc:mga06r32_143157_c1 3300050510 Bacteria 2368
333 nmdc:mga06r32_25250_c1 3300050510 Bacteria 5526
334 nmdc:mga06r32_364538_c1 3300050510 Unclassified 1428
335 nmdc:mga08y16_15250_c1 3300050511 Bacteria 8084
336 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
337 nmdc:mga08y16_55338_c1 3300050511 Bacteria 4146
338 nmdc:mga08y16_582_c1 3300050511 Bacteria 33956
339 nmdc:mga08y16_79993_c1 3300050511 Bacteria 3407
340 Ga0495601_0152862 3300053077 Unclassified 1507
341 Ga0500568_0001879 3300053139 Bacteria 12933
342 Ga0500590_002778 3300053148 Bacteria 7893
343 Ga0501084_0003797 3300054114 Bacteria 12291
344 Ga0501082_0002169 3300060353 Bacteria 17202
345 Ga0373934_0001793
346 Ga0065715_10089196
347 Ga0070658_10094338
348 Ga0070683_100000270
349 Ga0070683_100008700
350 Ga0070683_100038882
351 Ga0070683_100078549
352 Ga0070683_100226201
353 Ga0070670_100000476
354 Ga0070670_100149967
355 Ga0070677_10042644
356 Ga0068869_100174396
357 Ga0070666_10049243
358 Ga0070666_10227346
359 Ga0070680_100003358
360 Ga0070660_100025323
361 Ga0070691_10000471
362 Ga0070675_100226296
363 Ga0070671_100126757
364 Ga0070674_100091440
365 Ga0070673_100050702
366 Ga0070673_100220611
367 Ga0070667_100269995
368 Ga0070713_100010478
369 Ga0070713_100011857
370 Ga0070701_10031011
371 Ga0070700_100041025
372 Ga0070708_100270279
373 Ga0070681_10001619
374 Ga0070681_10012942
375 Ga0070706_100058644
376 Ga0070706_100242211
377 Ga0070707_100068549
378 Ga0070699_100010222
379 Ga0070679_100000460
380 Ga0070679_100078211
381 Ga0070684_100000429
382 Ga0070684_100044167
383 Ga0070684_100049359
384 Ga0070684_100190902
385 Ga0070684_100256701
386 Ga0070697_100254267
387 Ga0070693_100044906
388 Ga0070665_100010083
389 Ga0070665_100021737
390 Ga0068855_100045399
391 Ga0070664_100008270
392 Ga0070664_100106697
393 Ga0068857_100000711
394 Ga0068857_100008051
395 Ga0068857_100032494
396 Ga0068857_100041614
397 Ga0068857_100073774
398 Ga0068857_100080620
399 Ga0068856_100001812
400 Ga0068856_100007525
401 Ga0068856_100045508
402 Ga0068856_100055475
403 Ga0068852_100001130
404 Ga0068859_100003100
405 Ga0068859_100187267
406 Ga0068864_100008123
407 Ga0068864_100019145
408 Ga0068864_100041595
409 Ga0068864_100206932
410 Ga0068861_100142076
411 Ga0068851_10059248
412 Ga0068870_10029960
413 Ga0068863_100187324
414 Ga0068858_100054082
415 Ga0068858_100057211
416 Ga0068860_100023237
417 Ga0068860_100206999
418 Ga0081539_10000047
419 Ga0070712_100297157
420 Ga0097621_100015951
421 Ga0097621_100029776
422 Ga0097621_100044593
423 Ga0097621_100046565
424 Ga0097621_100082278
425 Ga0097621_100175917
426 Ga0068871_100001580
427 Ga0068871_100008507
428 Ga0068871_100029520
429 Ga0068871_100058249
430 Ga0068871_100069669
431 Ga0068871_100184416
432 Ga0075428_100444987
433 Ga0075430_100022439
434 Ga0075430_100191187
435 Ga0075431_100005723
436 Ga0075431_100234849
437 Ga0075431_100263133
438 Ga0075429_100032271
439 Ga0068865_100017871
440 Ga0097620_100003100
441 Ga0097620_100187255
442 Ga0099794_10025338
443 Ga0099794_10028729
444 Ga0105240_10019336
445 Ga0105240_10026902
446 Ga0105240_10039368
447 Ga0105240_10401285
448 Ga0111539_10000002
449 Ga0111539_10006726
450 Ga0111539_10033095
451 Ga0111539_10044241
452 Ga0111539_10293107
453 Ga0105245_10000490
454 Ga0105245_10001329
455 Ga0105245_10026070
456 Ga0105245_10031131
457 Ga0105245_10032149
458 Ga0105245_10105108
459 Ga0105245_10403335
460 Ga0105247_10007752
461 Ga0114129_10035545
462 Ga0105243_10047722
463 Ga0105243_10102739
464 Ga0105241_10008941
465 Ga0105241_10014043
466 Ga0105241_10040680
467 Ga0105241_10147592
468 Ga0105242_10002238
469 Ga0105242_10002411
470 Ga0105242_10005257
471 Ga0105242_10120553
472 Ga0105248_10040321
473 Ga0105248_10073407
474 Ga0105248_10117442
475 Ga0105248_10131035
476 Ga0105248_10219899
477 Ga0105248_10281575
478 Ga0105248_10552667
479 Ga0105237_10016704
480 Ga0105237_10029749
481 Ga0105237_10073470
482 Ga0105237_10098697
483 Ga0105237_10124487
484 Ga0105237_10212398
485 Ga0105237_10285723
486 Ga0105238_10002619
487 Ga0105238_10005378
488 Ga0105238_10033796
489 Ga0105238_10037528
490 Ga0105238_10042237
491 Ga0105238_10059483
492 Ga0105238_10069572
493 Ga0105238_10108124
494 Ga0105249_10118654
495 Ga0099796_10049250
496 Ga0105239_10001006
497 Ga0105239_10012990
498 Ga0105239_10028611
499 Ga0105239_10050464
500 Ga0105239_10066174
501 Ga0105239_10475776
502 Ga0105246_10030518
503 Ga0105246_10031969
504 Ga0105246_10078215
505 Ga0105246_10241799
506 Ga0157370_10003838
507 Ga0157370_10005328
508 Ga0157369_10001252
509 Ga0157369_10018627
510 Ga0157374_10003740
511 Ga0157374_10039137
512 Ga0157374_10041742
513 Ga0157374_10049699
514 Ga0157374_10189806
515 Ga0157378_10014594
516 Ga0157378_10129451
517 Ga0157378_10134395
518 Ga0163162_10001848
519 Ga0163162_10051094
520 Ga0163162_10356914
521 Ga0157372_10003563
522 Ga0157372_10072604
523 Ga0157375_10017899
524 Ga0157375_10061093
525 Ga0163163_10003894
526 Ga0163163_10036439
527 Ga0163163_10087629
528 Ga0163163_10116296
529 Ga0163163_10119531
530 Ga0163163_10440396
531 Ga0157380_10087736
532 Ga0157379_10019192
533 Ga0157376_10069254
534 Ga0207710_10067225
535 Ga0207699_10071695
536 Ga0207705_10160122
537 Ga0207654_10018877
538 Ga0207707_10000710
539 Ga0207707_10344276
540 Ga0207695_10000736
541 Ga0207695_10008925
542 Ga0207671_10076034
543 Ga0207671_10101418
544 Ga0207663_10086265
545 Ga0207660_10033770
546 Ga0207657_10037399
547 Ga0207652_10001452
548 Ga0207652_10169408
549 Ga0207681_10260755
550 Ga0207694_10000519
551 Ga0207694_10001805
552 Ga0207694_10008394
553 Ga0207694_10031661
554 Ga0207694_10186310
555 Ga0207650_10006088
556 Ga0207687_10010444
557 Ga0207687_10032622
558 Ga0207687_10045144
559 Ga0207700_10000874
560 Ga0207700_10046450
561 Ga0207644_10049197
562 Ga0207706_10127637
563 Ga0207686_10002337
564 Ga0207686_10005973
565 Ga0207686_10134498
566 Ga0207709_10186797
567 Ga0207704_10009200
568 Ga0207711_10001331
569 Ga0207711_10017092
570 Ga0207711_10030961
571 Ga0207711_10053758
572 Ga0207689_10011054
573 Ga0207689_10103602
574 Ga0207661_10000942
575 Ga0207661_10019094
576 Ga0207661_10074095
577 Ga0207661_10151083
578 Ga0207661_10155940
579 Ga0207679_10015130
580 Ga0207667_10000286
581 Ga0207667_10020184
582 Ga0207667_10035279
583 Ga0207712_10029922
584 Ga0207640_10049425
585 Ga0207677_10027544
586 Ga0207703_10085216
587 Ga0207639_10015223
588 Ga0207708_10027916
589 Ga0207702_10002807
590 Ga0207702_10042502
591 Ga0207702_10054286
592 Ga0207702_10223535
593 Ga0207648_10035559
594 Ga0207676_10011418
595 Ga0207676_10072924
596 Ga0207674_10001790
597 Ga0207674_10008956
598 Ga0207674_10036045
599 Ga0207675_100020144
600 Ga0207675_100176516
601 Ga0207683_10015800
602 Ga0207698_10001587
603 Ga0207428_10000004
604 Ga0207428_10053449
605 Ga0207428_10129543
606 Ga0268266_10013084
607 Ga0268266_10227985
608 Ga0268264_10086646
609 Ga0265325_10006098
610 Ga0265329_10045302
611 Ga0265313_10001687
612 Ga0265314_10008548
613 Ga0265314_10089451
614 Ga0307409_100004744
615 Ga0307409_100368856
616 Ga0307416_100025161
617 Ga0307415_100210411
618 Ga0373923_0047715
619 Ga0373953_0011040
620 Ga0373954_0002248
621 Ga0373956_0070019
622 Ga0373955_0062995
623 Ga0373931_0051972
624 Ga0373927_0055687
625 Ga0373927_0096767
626 Ga0373927_0205331
627 Ga0373933_0131695
628 Ga0373947_0038230
629 Ga0373937_0010791
630 Ga0373937_0013729
631 Ga0373937_0023879
632 Ga0373937_0026369
633 Ga0373937_0033646
634 Ga0373925_0020016
635 Ga0373925_0151206
636 Ga0373925_0183175
637 Ga0395900_0066419
638 Ga0439450_004131
639 Ga0495592_0011259
640 Ga0495580_0021439
641 Ga0495582_0019623
642 Ga0495664_0143080
643 Ga0495630_0005542
644 Ga0495587_0020070
645 Ga0495667_0042446
646 Ga0495684_0019442
647 Ga0495684_0126928
648 Ga0495602_0005520
649 Ga0496104_0304150
650 Ga0496112_0015161
651 Ga0496114_0154447
652 Ga0496114_0245214
653 Ga0496115_0102180
654 Ga0501033_0070135
655 Ga0501036_0016489
656 Ga0501038_0032910
657 Ga0501039_0172942
658 Ga0501040_0006595
659 Ga0501040_0142619
660 Ga0501041_0017428
661 Ga0501042_0069973
662 Ga0501046_0004024
663 Ga0501048_0111917
664 Ga0501068_0004034
665 Ga0501071_0008877
666 Ga0501071_0190585
667 Ga0501073_0011175
668 Ga0501075_0002682
669 Ga0501076_0004095
670 Ga0501079_0002750
671 Ga0501045_0002541
672 nmdc:mga05p37_4776_c1
673 nmdc:mga09592_29203_c1
674 nmdc:mga0qj67_193121_c1
675 nmdc:mga0qj67_3659_c1
676 nmdc:mga06r32_143157_c1
677 nmdc:mga06r32_25250_c1
678 nmdc:mga06r32_364538_c1
679 nmdc:mga08y16_15250_c1
680 nmdc:mga08y16_2_c1
681 nmdc:mga08y16_55338_c1
682 nmdc:mga08y16_582_c1
683 nmdc:mga08y16_79993_c1
684 Ga0495601_0152862
685 Ga0500568_0001879
686 Ga0500590_002778
687 Ga0501084_0003797
688 Ga0501082_0002169

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

65

350

0.79

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

69

350

0.78

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

70

354

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8083 27 363
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8011 27 363
4lyd-assembly1.cif.gz_A-2 crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1 0.7745 30 362
6eb3-assembly3.cif.gz_C structural and enzymatic characterization of an esterase from a metagenomic library 0.7587 33 361
3d2c-assembly1.cif.gz_A structure of 4d3, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution 0.7575 73 364
ID Description Score Start End Superfamily
af_A0A1D6PYN0_10_142_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8856 294 334 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8333 31 217 3.40.50.1820
af_Q922Q6_49_247_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8206 33 363 3.40.50.1820
af_Q922Q6_49_247_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8094 33 363 3.40.50.1820
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7852 33 215 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1F2T3K7-F1-model_v4 AB hydrolase-1 domain-containing protein 0.992 31 378 GO:0016020
GO:0046464
GO:0047372
AF-A0A1F2T3K7-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9891 31 378 GO:0016020
GO:0046464
GO:0047372
AF-A0A1Q7H716-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9825 86 378 GO:0016020
AF-A0A536WWA3-F1-model_v4 Alpha/beta hydrolase 0.973 158 378 GO:0016787
AF-A0A7V9S7K0-F1-model_v4 Alpha/beta hydrolase 0.9661 19 378 GO:0016787

Map