F415858

General Info

Members Datasets Scaffolds Average Seq Length
344 210 344 143

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100000047|Ga0070713_10000004761
Length 155
Sequence MNQPMATKAPAQRPVHRAVRPAQSLAAAFVFLAMLLAAFSLWTVIPLSWVYIASKLSHTQFPSGGPYAIVAVGIVASILIIAWLIGRLNNLYIRLTGTNRLAPIRPSWLKSMRDTGPIQGSVTVVEAVLMSSVLLAGLALTVWFFLLAGSPIPNQ

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
124 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
125 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
175 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
210 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 0
Rhizoplane 10.17
Rhizosphere 86.34
Stem 0
Stem Tuber 0
Unclassified 2.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10019188 3300001979 Bacteria 2413
2 JGI24751J29686_10030078 3300002459 Bacteria 1127
3 JGI25404J52841_10002165 3300003659 Bacteria 3668
4 Ga0070683_100006889 3300005329 Bacteria 9547
5 Ga0070683_100017657 3300005329 Bacteria 6304
6 Ga0070683_100029530 3300005329 Bacteria 4965
7 Ga0070683_100040821 3300005329 Bacteria 4266
8 Ga0070690_100110458 3300005330 Bacteria 1834
9 Ga0070670_100065738 3300005331 Bacteria 3112
10 Ga0070666_10221098 3300005335 Bacteria 1336
11 Ga0070680_100942625 3300005336 Bacteria 745
12 Ga0070682_100000011 3300005337 Bacteria 266253
13 Ga0070682_100249907 3300005337 Bacteria 1278
14 Ga0068868_100000141 3300005338 Bacteria 46406
15 Ga0070689_100006918 3300005340 Bacteria 7896
16 Ga0070689_100225164 3300005340 Bacteria 1540
17 Ga0070692_10031776 3300005345 Bacteria 2649
18 Ga0070668_100011596 3300005347 Bacteria 6561
19 Ga0070669_100152511 3300005353 Bacteria 1790
20 Ga0070669_100325126 3300005353 Archaea 1243
21 Ga0070675_100000036 3300005354 Bacteria 85959
22 Ga0070671_100203085 3300005355 Unclassified 1681
23 Ga0070674_100000007 3300005356 Bacteria 145531
24 Ga0070673_100000923 3300005364 Bacteria 16611
25 Ga0070659_100259040 3300005366 Bacteria 1443
26 Ga0070667_100001076 3300005367 Bacteria 24988
27 Ga0070714_101265320 3300005435 Bacteria 720
28 Ga0070713_100000047 3300005436 Bacteria 76760
29 Ga0070710_10747449 3300005437 Bacteria 694
30 Ga0070701_10185755 3300005438 Bacteria 1220
31 Ga0070711_100068131 3300005439 Bacteria 2499
32 Ga0070711_100396222 3300005439 Bacteria 1120
33 Ga0070678_100057886 3300005456 Bacteria 2842
34 Ga0070662_100000002 3300005457 Bacteria 253208
35 Ga0070681_10045866 3300005458 Bacteria 4371
36 Ga0070685_10000020 3300005466 Bacteria 104332
37 Ga0070685_10047925 3300005466 Bacteria 2459
38 Ga0070685_10736539 3300005466 Bacteria 722
39 Ga0070679_100000913 3300005530 Bacteria 25634
40 Ga0070684_100177410 3300005535 Bacteria 1936
41 Ga0070684_100212156 3300005535 Bacteria 1764
42 Ga0070684_100229062 3300005535 Bacteria 1696
43 Ga0070684_100304084 3300005535 Unclassified 1464
44 Ga0070684_100454417 3300005535 Bacteria 1184
45 Ga0070684_100609968 3300005535 Unclassified 1015
46 Ga0070695_100133859 3300005545 Bacteria 1711
47 Ga0070693_100000470 3300005547 Bacteria 18108
48 Ga0070665_100000141 3300005548 Bacteria 135473
49 Ga0068855_100269705 3300005563 Bacteria 1893
50 Ga0068855_100571757 3300005563 Archaea 1222
51 Ga0068857_101302913 3300005577 Bacteria 705
52 Ga0068854_100000097 3300005578 Bacteria 61139
53 Ga0068856_100002498 3300005614 Bacteria 18913
54 Ga0068856_100013571 3300005614 Bacteria 7887
55 Ga0068856_101528670 3300005614 Bacteria 681
56 Ga0068852_100000002 3300005616 Bacteria 268221
57 Ga0068852_100090267 3300005616 Bacteria 2740
58 Ga0068866_10000003 3300005718 Bacteria 281675
59 Ga0068861_100194758 3300005719 Archaea 1697
60 Ga0068861_100554561 3300005719 Bacteria 1048
61 Ga0068863_100000022 3300005841 Bacteria 188278
62 Ga0068863_100045159 3300005841 Bacteria 4181
63 Ga0068858_100000118 3300005842 Bacteria 83359
64 Ga0068858_100000508 3300005842 Bacteria 40801
65 Ga0068858_100215249 3300005842 Bacteria 1819
66 Ga0068860_100004743 3300005843 Bacteria 13853
67 Ga0068860_100030106 3300005843 Bacteria 5221
68 Ga0068860_100880786 3300005843 Bacteria 911
69 Ga0068862_100023531 3300005844 Bacteria 5163
70 Ga0068862_101649689 3300005844 Unclassified 649
71 Ga0081455_10019712 3300005937 Bacteria 6370
72 Ga0081540_1000100 3300005983 Bacteria 91640
73 Ga0075365_10525046 3300006038 Unclassified 837
74 Ga0070715_10145173 3300006163 Unclassified 1157
75 Ga0068871_101534759 3300006358 Bacteria 630
76 Ga0075433_10003354 3300006852 Bacteria 12382
77 Ga0068865_100000013 3300006881 Bacteria 141352
78 Ga0068865_100600756 3300006881 Bacteria 930
79 Ga0105245_10000125 3300009098 Bacteria 73764
80 Ga0105245_10006201 3300009098 Bacteria 10517
81 Ga0105247_10001978 3300009101 Bacteria 14224
82 Ga0105247_10118602 3300009101 Bacteria 1712
83 Ga0105247_10232053 3300009101 Bacteria 1254
84 Ga0105247_10383088 3300009101 Unclassified 998
85 Ga0105242_10000117 3300009176 Bacteria 57885
86 Ga0105242_10000908 3300009176 Bacteria 23020
87 Ga0105242_10462824 3300009176 Bacteria 1198
88 Ga0105248_10000020 3300009177 Bacteria 284637
89 Ga0105249_10000178 3300009553 Bacteria 74768
90 Ga0105249_10003509 3300009553 Bacteria 13564
91 Ga0105249_10599277 3300009553 Bacteria 1156
92 Ga0105239_10122892 3300010375 Bacteria 2885
93 Ga0157373_10685860 3300013100 Bacteria 750
94 Ga0157370_10002971 3300013104 Bacteria 20162
95 Ga0157370_10114257 3300013104 Bacteria 2522
96 Ga0157369_10000307 3300013105 Bacteria 65486
97 Ga0157374_10140962 3300013296 Bacteria 2340
98 Ga0157374_10613952 3300013296 Bacteria 1098
99 Ga0157378_10003176 3300013297 Bacteria 14588
100 Ga0157378_10027515 3300013297 Bacteria 5017
101 Ga0157378_10057890 3300013297 Bacteria 3455
102 Ga0163162_10308767 3300013306 Bacteria 1714
103 Ga0163162_10350213 3300013306 Bacteria 1610
104 Ga0157372_10000053 3300013307 Bacteria 128824
105 Ga0157375_10057452 3300013308 Bacteria 3846
106 Ga0157375_10291123 3300013308 Unclassified 1796
107 Ga0157375_10308761 3300013308 Bacteria 1746
108 Ga0163163_10783757 3300014325 Bacteria 1017
109 Ga0157380_10000236 3300014326 Bacteria 33220
110 Ga0157379_10059769 3300014968 Bacteria 3408
111 Ga0163161_10047839 3300017792 Bacteria 3088
112 Ga0206356_10387693 3300020070 Bacteria 1124
113 Ga0207656_10000211 3300025321 Bacteria 20768
114 Ga0207682_10000155 3300025893 Bacteria 31180
115 Ga0207642_10000002 3300025899 Bacteria 658166
116 Ga0207642_10045644 3300025899 Bacteria 1947
117 Ga0207710_10000821 3300025900 Bacteria 16775
118 Ga0207710_10233278 3300025900 Unclassified 916
119 Ga0207685_10016697 3300025905 Bacteria 2355
120 Ga0207707_10115283 3300025912 Bacteria 2348
121 Ga0207695_10216989 3300025913 Bacteria 1821
122 Ga0207663_10033961 3300025916 Bacteria 3045
123 Ga0207663_10050267 3300025916 Bacteria 2590
124 Ga0207660_10062694 3300025917 Bacteria 2679
125 Ga0207652_10003850 3300025921 Bacteria 12292
126 Ga0207681_10472247 3300025923 Unclassified 1023
127 Ga0207650_10187297 3300025925 Bacteria 1652
128 Ga0207659_10000013 3300025926 Bacteria 172742
129 Ga0207687_10000756 3300025927 Bacteria 21840
130 Ga0207687_10001648 3300025927 Bacteria 15405
131 Ga0207700_10000033 3300025928 Bacteria 123113
132 Ga0207664_10186435 3300025929 Bacteria 1784
133 Ga0207664_10424999 3300025929 Bacteria 1184
134 Ga0207644_10232964 3300025931 Unclassified 1464
135 Ga0207690_10158076 3300025932 Bacteria 1687
136 Ga0207690_10194275 3300025932 Bacteria 1537
137 Ga0207706_10000001 3300025933 Bacteria 423014
138 Ga0207686_10000254 3300025934 Bacteria 40780
139 Ga0207686_10098091 3300025934 Bacteria 1950
140 Ga0207686_10469766 3300025934 Bacteria 971
141 Ga0207670_10005811 3300025936 Bacteria 6811
142 Ga0207669_10000001 3300025937 Bacteria 377747
143 Ga0207704_10000040 3300025938 Bacteria 90178
144 Ga0207704_11307563 3300025938 Bacteria 620
145 Ga0207711_10000006 3300025941 Bacteria 792692
146 Ga0207689_10914227 3300025942 Bacteria 740
147 Ga0207661_10000198 3300025944 Bacteria 39018
148 Ga0207661_10010942 3300025944 Bacteria 6551
149 Ga0207661_10029396 3300025944 Bacteria 4220
150 Ga0207661_10725562 3300025944 Bacteria 914
151 Ga0207667_10210066 3300025949 Bacteria 1995
152 Ga0207667_10435992 3300025949 Bacteria 1332
153 Ga0207651_10079536 3300025960 Bacteria 2355
154 Ga0207712_10000118 3300025961 Bacteria 85518
155 Ga0207712_10007734 3300025961 Bacteria 6796
156 Ga0207712_10688708 3300025961 Bacteria 891
157 Ga0207668_10005384 3300025972 Bacteria 7532
158 Ga0207640_10000370 3300025981 Bacteria 29030
159 Ga0207658_10003877 3300025986 Bacteria 10532
160 Ga0207677_10000397 3300026023 Bacteria 29959
161 Ga0207703_10000061 3300026035 Bacteria 132671
162 Ga0207703_10566425 3300026035 Unclassified 1072
163 Ga0207639_10012718 3300026041 Bacteria 5870
164 Ga0207639_10015804 3300026041 Bacteria 5329
165 Ga0207702_10000637 3300026078 Bacteria 38379
166 Ga0207702_10009958 3300026078 Bacteria 7970
167 Ga0207702_10018008 3300026078 Bacteria 5847
168 Ga0207702_11194280 3300026078 Bacteria 755
169 Ga0207641_10000016 3300026088 Bacteria 307363
170 Ga0207641_10489148 3300026088 Bacteria 1193
171 Ga0207675_100146769 3300026118 Archaea 2243
172 Ga0207675_101199463 3300026118 Bacteria 779
173 Ga0207683_10081237 3300026121 Bacteria 2877
174 Ga0207698_10000004 3300026142 Bacteria 313614
175 Ga0207698_10045811 3300026142 Bacteria 3297
176 Ga0268266_10000056 3300028379 Bacteria 289176
177 Ga0268266_10000601 3300028379 Bacteria 49250
178 Ga0268266_10601911 3300028379 Bacteria 1056
179 Ga0268265_10004453 3300028380 Bacteria 9721
180 Ga0268265_11063205 3300028380 Unclassified 802
181 Ga0268264_10002435 3300028381 Bacteria 16359
182 Ga0268264_10093781 3300028381 Bacteria 2594
183 Ga0268264_10127452 3300028381 Bacteria 2252
184 Ga0268264_10769294 3300028381 Bacteria 960
185 Ga0268264_10808981 3300028381 Bacteria 937
186 Ga0265318_10154364 3300028577 Unclassified 842
187 Ga0265338_10000244 3300028800 Bacteria 100528
188 Ga0265325_10137675 3300031241 Bacteria 1163
189 Ga0265331_10011583 3300031250 Bacteria 4824
190 Ga0265327_10343147 3300031251 Bacteria 653
191 Ga0373937_0005521 3300036401 Bacteria 10841
192 Ga0451800_1419717 3300041459 Bacteria 548
193 Ga0451807_0397996 3300041486 Bacteria 2163
194 Ga0451807_1530714 3300041486 Bacteria 2551
195 Ga0451833_0323757 3300041491 Bacteria 2414
196 Ga0451845_0846721 3300041501 Bacteria 935
197 Ga0451843_1144523 3300041509 Bacteria 841
198 Ga0451853_0304406 3300041512 Bacteria 1077
199 Ga0451853_2220791 3300041512 Bacteria 855
200 Ga0466963_0000004 3300044694 Bacteria 102526
201 Ga0466963_1247852 3300044694 Unclassified 522
202 Ga0466957_0051828 3300044842 Bacteria 2498
203 Ga0466967_0000001 3300045976 Bacteria 229823
204 Ga0495592_0062413 3300046454 Bacteria 2736
205 Ga0495592_0192034 3300046454 Bacteria 1383
206 Ga0495592_0254875 3300046454 Bacteria 1158
207 Ga0495603_0000107 3300046455 Bacteria 39283
208 Ga0495603_0004009 3300046455 Bacteria 8766
209 Ga0495629_0000260 3300046459 Bacteria 46062
210 Ga0495629_0000487 3300046459 Bacteria 33176
211 Ga0495629_0061332 3300046459 Bacteria 2628
212 Ga0495629_0238199 3300046459 Bacteria 1253
213 Ga0495638_0405507 3300046460 Bacteria 706
214 Ga0495641_0000005 3300046461 Bacteria 206626
215 Ga0495651_0016929 3300046462 Bacteria 5645
216 Ga0495653_0048901 3300046463 Bacteria 3261
217 Ga0495653_0069771 3300046463 Bacteria 2631
218 Ga0495582_0000001 3300046473 Bacteria 252434
219 Ga0495662_0000001 3300046476 Bacteria 179185
220 Ga0495662_0110749 3300046476 Bacteria 1345
221 Ga0495594_0000089 3300046499 Bacteria 41876
222 Ga0495606_0000040 3300046507 Bacteria 223500
223 Ga0495608_0001804 3300046511 Bacteria 15293
224 Ga0495608_0028576 3300046511 Bacteria 3789
225 Ga0495618_0000014 3300046514 Bacteria 163136
226 Ga0495628_0077458 3300046516 Bacteria 2586
227 Ga0495628_0549905 3300046516 Bacteria 829
228 Ga0495630_0013940 3300046517 Bacteria 5848
229 Ga0495630_0121932 3300046517 Bacteria 1978
230 Ga0495644_0001062 3300046523 Bacteria 11440
231 Ga0495652_0000010 3300046529 Bacteria 261584
232 Ga0495652_0076609 3300046529 Bacteria 2774
233 Ga0495640_0105129 3300046533 Bacteria 1849
234 Ga0495586_0000083 3300046535 Bacteria 57851
235 Ga0495586_0110161 3300046535 Bacteria 1532
236 Ga0495587_0023739 3300046536 Bacteria 3767
237 Ga0495587_0035754 3300046536 Bacteria 2991
238 Ga0495587_0171365 3300046536 Bacteria 1233
239 Ga0495621_0001691 3300046539 Bacteria 5781
240 Ga0495597_0212297 3300046542 Bacteria 771
241 Ga0495645_0084432 3300046543 Bacteria 2274
242 Ga0495622_0000218 3300046557 Bacteria 45469
243 Ga0495667_0000020 3300046559 Bacteria 180876
244 Ga0495634_0507462 3300046642 Bacteria 706
245 Ga0495635_0000031 3300046663 Bacteria 110244
246 Ga0495588_0000338 3300046674 Bacteria 30480
247 Ga0495657_0000001 3300046675 Bacteria 445641
248 Ga0495657_0028860 3300046675 Bacteria 3896
249 Ga0495599_0015716 3300046678 Bacteria 4698
250 Ga0495599_0029798 3300046678 Bacteria 3423
251 Ga0495599_0095270 3300046678 Bacteria 1857
252 Ga0495647_0000001 3300046681 Bacteria 222371
253 Ga0495647_0000341 3300046681 Bacteria 13120
254 Ga0495647_0005224 3300046681 Bacteria 4254
255 Ga0495658_0000002 3300046683 Bacteria 309651
256 Ga0495658_0003808 3300046683 Bacteria 7472
257 Ga0495613_0000005 3300046689 Bacteria 222558
258 Ga0495624_0000019 3300046690 Bacteria 102237
259 Ga0495624_0007669 3300046690 Bacteria 7575
260 Ga0495670_0090682 3300046691 Bacteria 1564
261 Ga0495649_0013634 3300046694 Bacteria 4684
262 Ga0495600_0005957 3300046809 Bacteria 7378
263 Ga0495600_0039936 3300046809 Bacteria 3056
264 Ga0495660_0225769 3300046810 Bacteria 880
265 Ga0495604_0000067 3300047317 Bacteria 90345
266 Ga0495604_0022899 3300047317 Bacteria 4985
267 Ga0495604_0417336 3300047317 Archaea 881
268 Ga0495674_0002248 3300047319 Bacteria 18976
269 Ga0495672_0023161 3300047320 Bacteria 4026
270 Ga0495676_0000238 3300047321 Bacteria 44160
271 Ga0495676_0001364 3300047321 Bacteria 21008
272 Ga0495676_0054841 3300047321 Bacteria 3165
273 Ga0495676_0241110 3300047321 Bacteria 1238
274 Ga0495680_0000143 3300047322 Bacteria 71946
275 Ga0495680_0000488 3300047322 Bacteria 44631
276 Ga0495680_0002541 3300047322 Bacteria 18636
277 Ga0495675_0000300 3300047444 Bacteria 35530
278 Ga0495679_010122 3300047446 Bacteria 3724
279 Ga0495685_042389 3300047447 Bacteria 1553
280 Ga0495684_0588954 3300047471 Bacteria 752
281 Ga0495686_0030941 3300047472 Bacteria 3474
282 Ga0495593_0118052 3300047673 Bacteria 1351
283 Ga0495593_0122626 3300047673 Bacteria 1322
284 Ga0495593_0326107 3300047673 Bacteria 767
285 Ga0495602_0000007 3300048088 Bacteria 273212
286 Ga0495602_0000611 3300048088 Bacteria 33553
287 Ga0495602_0959503 3300048088 Bacteria 566
288 Ga0496100_0000001 3300048903 Bacteria 530179
289 Ga0496100_0000059 3300048903 Bacteria 65518
290 Ga0496101_0000004 3300048904 Bacteria 331599
291 Ga0496101_0000135 3300048904 Bacteria 65518
292 Ga0496102_0000294 3300048905 Bacteria 64001
293 Ga0496102_1047275 3300048905 Bacteria 736
294 Ga0496103_0000159 3300048906 Bacteria 71148
295 Ga0496103_0381021 3300048906 Unclassified 906
296 Ga0496104_0000015 3300048907 Bacteria 374530
297 Ga0496105_0000004 3300048908 Bacteria 475798
298 Ga0496105_0012055 3300048908 Bacteria 6842
299 Ga0496106_0000030 3300048909 Bacteria 136804
300 Ga0496106_0000056 3300048909 Bacteria 90682
301 Ga0496106_0000252 3300048909 Bacteria 37666
302 Ga0496107_0000005 3300048910 Bacteria 281747
303 Ga0496107_0000054 3300048910 Bacteria 60902
304 Ga0496107_0034493 3300048910 Bacteria 3625
305 Ga0496108_0283719 3300048911 Bacteria 1441
306 Ga0496109_0000012 3300048912 Bacteria 229699
307 Ga0496109_0000173 3300048912 Bacteria 63867
308 Ga0496110_0003674 3300048913 Bacteria 11801
309 Ga0496111_0000035 3300048914 Bacteria 54459
310 Ga0496111_1037670 3300048914 Bacteria 586
311 Ga0496112_0000025 3300048915 Bacteria 146197
312 Ga0496112_0002208 3300048915 Bacteria 15521
313 Ga0496113_0000026 3300048916 Bacteria 63999
314 Ga0496113_0135151 3300048916 Archaea 1937
315 Ga0496114_0000039 3300048917 Bacteria 138486
316 Ga0496114_0006763 3300048917 Bacteria 9033
317 Ga0496114_0032937 3300048917 Bacteria 4268
318 Ga0496115_0000011 3300048918 Bacteria 222529
319 Ga0496115_0003457 3300048918 Bacteria 11348
320 Ga0496119_0024169 3300048922 Bacteria 4283
321 Ga0496120_0131230 3300048923 Bacteria 1283
322 Ga0501042_0023002 3300049578 Bacteria 4356
323 Ga0501068_0843042 3300049584 Bacteria 602
324 Ga0501075_0472412 3300049591 Bacteria 956
325 Ga0501081_0386092 3300049743 Bacteria 1035
326 nmdc:mga0a205_53_c2 3300050515 Bacteria 54696
327 Ga0495601_0000158 3300053077 Bacteria 37317
328 Ga0495601_0001218 3300053077 Bacteria 14090
329 Ga0495601_0004657 3300053077 Bacteria 7939
330 Ga0495601_0022253 3300053077 Bacteria 3890
331 Ga0495655_0000002 3300053083 Bacteria 312752
332 Ga0495655_0007306 3300053083 Bacteria 2047
333 Ga0495595_0000002 3300053084 Bacteria 445641
334 Ga0495595_0000045 3300053084 Bacteria 63054
335 Ga0495595_0011420 3300053084 Bacteria 3713
336 Ga0495619_0000008 3300053085 Bacteria 305999
337 Ga0495619_0000102 3300053085 Bacteria 64345
338 Ga0495619_0000268 3300053085 Bacteria 37980
339 Ga0495619_0002874 3300053085 Bacteria 11197
340 Ga0495619_1208788 3300053085 Unclassified 500
341 Ga0500566_0000683 3300053094 Bacteria 19070
342 Ga0500641_0000831 3300053096 Bacteria 11108
343 Ga0500614_000427 3300053123 Bacteria 10952
344 Ga0500628_000001 3300053129 Bacteria 564074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0843042 Ga0501068_0843042_190_585 114
2 3300046681 Ga0495647_0000341 Ga0495647_0000341_12718_13110 117
3 3300005842 Ga0068858_100000508 Ga0068858_10000050810 121
4 3300053085 Ga0495619_0000008 Ga0495619_0000008_173951_174397 121
5 3300046455 Ga0495603_0004009 Ga0495603_0004009_755_1168 122
6 3300005355 Ga0070671_100203085 Ga0070671_1002030851 124
7 3300005438 Ga0070701_10185755 Ga0070701_101857553 127
8 3300014325 Ga0163163_10783757 Ga0163163_107837572 127
9 3300046460 Ga0495638_0405507 Ga0495638_0405507_247_630 127
10 3300046523 Ga0495644_0001062 Ga0495644_0001062_4188_4622 127
11 3300028381 Ga0268264_10002435 Ga0268264_1000243512 128
12 3300046473 Ga0495582_0000001 Ga0495582_0000001_57962_58408 128
13 3300046683 Ga0495658_0000002 Ga0495658_0000002_181568_182014 128
14 3300005331 Ga0070670_100065738 Ga0070670_1000657382 131
15 3300005437 Ga0070710_10747449 Ga0070710_107474491 131
16 3300005466 Ga0070685_10000020 Ga0070685_1000002027 131
17 3300005614 Ga0068856_100002498 Ga0068856_1000024983 131
18 3300005614 Ga0068856_100013571 Ga0068856_1000135716 131
19 3300005616 Ga0068852_100000002 Ga0068852_100000002198 131
20 3300006881 Ga0068865_100000013 Ga0068865_10000001345 131
21 3300013104 Ga0157370_10002971 Ga0157370_1000297118 131
22 3300013104 Ga0157370_10114257 Ga0157370_101142573 131
23 3300025938 Ga0207704_10000040 Ga0207704_1000004041 131
24 3300025941 Ga0207711_10000006 Ga0207711_10000006235 131
25 3300026041 Ga0207639_10015804 Ga0207639_100158045 131
26 3300026078 Ga0207702_10000637 Ga0207702_1000063734 131
27 3300026078 Ga0207702_10018008 Ga0207702_100180082 131
28 3300026142 Ga0207698_10000004 Ga0207698_1000000487 131
29 3300045976 Ga0466967_0000001 Ga0466967_0000001_135211_135606 131
30 3300046454 Ga0495592_0062413 Ga0495592_0062413_255_650 131
31 3300046514 Ga0495618_0000014 Ga0495618_0000014_94657_95052 131
32 3300046517 Ga0495630_0013940 Ga0495630_0013940_1576_1971 131
33 3300046694 Ga0495649_0013634 Ga0495649_0013634_1210_1605 131
34 3300047321 Ga0495676_0000238 Ga0495676_0000238_7791_8186 131
35 3300047321 Ga0495676_0241110 Ga0495676_0241110_19_414 131
36 3300048905 Ga0496102_1047275 Ga0496102_1047275_325_720 131
37 3300048915 Ga0496112_0000025 Ga0496112_0000025_128880_129275 131
38 3300048916 Ga0496113_0135151 Ga0496113_0135151_147_542 131
39 3300053077 Ga0495601_0000158 Ga0495601_0000158_7520_7924 134
40 3300009098 Ga0105245_10006201 Ga0105245_1000620110 135
41 3300009176 Ga0105242_10462824 Ga0105242_104628242 135
42 3300041512 Ga0451853_0304406 Ga0451853_0304406_252_659 135
43 3300046461 Ga0495641_0000005 Ga0495641_0000005_124388_124795 135
44 3300046511 Ga0495608_0028576 Ga0495608_0028576_2336_2785 135
45 3300046516 Ga0495628_0549905 Ga0495628_0549905_336_797 135
46 3300046543 Ga0495645_0084432 Ga0495645_0084432_1431_1838 135
47 3300046678 Ga0495599_0015716 Ga0495599_0015716_1543_1950 135
48 3300047322 Ga0495680_0000488 Ga0495680_0000488_32361_32768 135
49 3300048914 Ga0496111_1037670 Ga0496111_1037670_148_555 135
50 3300053123 Ga0500614_000427 Ga0500614_000427_9707_10114 135
51 3300005466 Ga0070685_10736539 Ga0070685_107365391 137
52 3300046539 Ga0495621_0001691 Ga0495621_0001691_5305_5739 137
53 3300047320 Ga0495672_0023161 Ga0495672_0023161_1409_1843 137
54 3300005337 Ga0070682_100000011 Ga0070682_10000001120 138
55 3300005578 Ga0068854_100000097 Ga0068854_1000000975 138
56 3300006163 Ga0070715_10145173 Ga0070715_101451732 138
57 3300013307 Ga0157372_10000053 Ga0157372_1000005381 138
58 3300025321 Ga0207656_10000211 Ga0207656_100002119 138
59 3300025905 Ga0207685_10016697 Ga0207685_100166973 138
60 3300025927 Ga0207687_10001648 Ga0207687_100016485 138
61 3300025981 Ga0207640_10000370 Ga0207640_1000037015 138
62 3300047317 Ga0495604_0417336 Ga0495604_0417336_12_446 138
63 3300053085 Ga0495619_0000102 Ga0495619_0000102_27600_28016 138
64 3300009098 Ga0105245_10000125 Ga0105245_1000012528 141
65 3300010375 Ga0105239_10122892 Ga0105239_101228924 141
66 3300013105 Ga0157369_10000307 Ga0157369_1000030745 141
67 3300025925 Ga0207650_10187297 Ga0207650_101872972 141
68 3300005337 Ga0070682_100249907 Ga0070682_1002499072 142
69 3300046529 Ga0495652_0000010 Ga0495652_0000010_253641_254072 143
70 3300046536 Ga0495587_0171365 Ga0495587_0171365_673_1104 143
71 3300001979 JGI24740J21852_10019188 JGI24740J21852_100191882 144
72 3300002459 JGI24751J29686_10030078 JGI24751J29686_100300782 144
73 3300003659 JGI25404J52841_10002165 JGI25404J52841_100021654 144
74 3300005329 Ga0070683_100006889 Ga0070683_1000068897 144
75 3300005329 Ga0070683_100017657 Ga0070683_1000176575 144
76 3300005329 Ga0070683_100029530 Ga0070683_1000295306 144
77 3300005329 Ga0070683_100040821 Ga0070683_1000408215 144
78 3300005330 Ga0070690_100110458 Ga0070690_1001104582 144
79 3300005335 Ga0070666_10221098 Ga0070666_102210982 144
80 3300005336 Ga0070680_100942625 Ga0070680_1009426251 144
81 3300005338 Ga0068868_100000141 Ga0068868_10000014121 144
82 3300005340 Ga0070689_100006918 Ga0070689_1000069187 144
83 3300005340 Ga0070689_100225164 Ga0070689_1002251643 144
84 3300005345 Ga0070692_10031776 Ga0070692_100317765 144
85 3300005347 Ga0070668_100011596 Ga0070668_1000115964 144
86 3300005353 Ga0070669_100152511 Ga0070669_1001525112 144
87 3300005353 Ga0070669_100325126 Ga0070669_1003251261 144
88 3300005354 Ga0070675_100000036 Ga0070675_10000003654 144
89 3300005356 Ga0070674_100000007 Ga0070674_100000007139 144
90 3300005364 Ga0070673_100000923 Ga0070673_1000009231 144
91 3300005366 Ga0070659_100259040 Ga0070659_1002590402 144
92 3300005367 Ga0070667_100001076 Ga0070667_10000107628 144
93 3300005435 Ga0070714_101265320 Ga0070714_1012653201 144
94 3300005436 Ga0070713_100000047 Ga0070713_10000004761 144
95 3300005439 Ga0070711_100068131 Ga0070711_1000681312 144
96 3300005439 Ga0070711_100396222 Ga0070711_1003962221 144
97 3300005456 Ga0070678_100057886 Ga0070678_1000578864 144
98 3300005457 Ga0070662_100000002 Ga0070662_100000002212 144
99 3300005458 Ga0070681_10045866 Ga0070681_100458665 144
100 3300005466 Ga0070685_10047925 Ga0070685_100479253 144
101 3300005530 Ga0070679_100000913 Ga0070679_1000009137 144
102 3300005535 Ga0070684_100177410 Ga0070684_1001774103 144
103 3300005535 Ga0070684_100212156 Ga0070684_1002121563 144
104 3300005535 Ga0070684_100229062 Ga0070684_1002290622 144
105 3300005535 Ga0070684_100304084 Ga0070684_1003040842 144
106 3300005535 Ga0070684_100454417 Ga0070684_1004544172 144
107 3300005535 Ga0070684_100609968 Ga0070684_1006099682 144
108 3300005545 Ga0070695_100133859 Ga0070695_1001338592 144
109 3300005547 Ga0070693_100000470 Ga0070693_1000004705 144
110 3300005548 Ga0070665_100000141 Ga0070665_100000141115 144
111 3300005563 Ga0068855_100269705 Ga0068855_1002697053 144
112 3300005563 Ga0068855_100571757 Ga0068855_1005717572 144
113 3300005577 Ga0068857_101302913 Ga0068857_1013029132 144
114 3300005614 Ga0068856_101528670 Ga0068856_1015286702 144
115 3300005616 Ga0068852_100090267 Ga0068852_1000902674 144
116 3300005718 Ga0068866_10000003 Ga0068866_10000003281 144
117 3300005719 Ga0068861_100194758 Ga0068861_1001947581 144
118 3300005719 Ga0068861_100554561 Ga0068861_1005545612 144
119 3300005841 Ga0068863_100000022 Ga0068863_10000002220 144
120 3300005841 Ga0068863_100045159 Ga0068863_1000451592 144
121 3300005842 Ga0068858_100000118 Ga0068858_10000011866 144
122 3300005842 Ga0068858_100215249 Ga0068858_1002152492 144
123 3300005843 Ga0068860_100004743 Ga0068860_1000047434 144
124 3300005843 Ga0068860_100030106 Ga0068860_1000301063 144
125 3300005843 Ga0068860_100880786 Ga0068860_1008807861 144
126 3300005844 Ga0068862_100023531 Ga0068862_1000235315 144
127 3300005844 Ga0068862_101649689 Ga0068862_1016496892 144
128 3300005937 Ga0081455_10019712 Ga0081455_100197126 144
129 3300005983 Ga0081540_1000100 Ga0081540_100010021 144
130 3300006038 Ga0075365_10525046 Ga0075365_105250461 144
131 3300006358 Ga0068871_101534759 Ga0068871_1015347592 144
132 3300006852 Ga0075433_10003354 Ga0075433_100033549 144
133 3300006881 Ga0068865_100600756 Ga0068865_1006007561 144
134 3300009101 Ga0105247_10001978 Ga0105247_1000197814 144
135 3300009101 Ga0105247_10118602 Ga0105247_101186023 144
136 3300009101 Ga0105247_10232053 Ga0105247_102320532 144
137 3300009101 Ga0105247_10383088 Ga0105247_103830882 144
138 3300009176 Ga0105242_10000117 Ga0105242_1000011734 144
139 3300009176 Ga0105242_10000908 Ga0105242_1000090821 144
140 3300009177 Ga0105248_10000020 Ga0105248_10000020141 144
141 3300009553 Ga0105249_10000178 Ga0105249_1000017846 144
142 3300009553 Ga0105249_10003509 Ga0105249_100035097 144
143 3300009553 Ga0105249_10599277 Ga0105249_105992772 144
144 3300013100 Ga0157373_10685860 Ga0157373_106858602 144
145 3300013296 Ga0157374_10140962 Ga0157374_101409623 144
146 3300013296 Ga0157374_10613952 Ga0157374_106139523 144
147 3300013297 Ga0157378_10003176 Ga0157378_100031762 144
148 3300013297 Ga0157378_10027515 Ga0157378_100275154 144
149 3300013297 Ga0157378_10057890 Ga0157378_100578905 144
150 3300013306 Ga0163162_10308767 Ga0163162_103087673 144
151 3300013306 Ga0163162_10350213 Ga0163162_103502132 144
152 3300013308 Ga0157375_10057452 Ga0157375_100574522 144
153 3300013308 Ga0157375_10291123 Ga0157375_102911232 144
154 3300013308 Ga0157375_10308761 Ga0157375_103087613 144
155 3300014326 Ga0157380_10000236 Ga0157380_1000023616 144
156 3300014968 Ga0157379_10059769 Ga0157379_100597692 144
157 3300017792 Ga0163161_10047839 Ga0163161_100478393 144
158 3300020070 Ga0206356_10387693 Ga0206356_103876932 144
159 3300025893 Ga0207682_10000155 Ga0207682_100001559 144
160 3300025899 Ga0207642_10000002 Ga0207642_10000002531 144
161 3300025899 Ga0207642_10045644 Ga0207642_100456442 144
162 3300025900 Ga0207710_10000821 Ga0207710_100008219 144
163 3300025900 Ga0207710_10233278 Ga0207710_102332782 144
164 3300025912 Ga0207707_10115283 Ga0207707_101152833 144
165 3300025913 Ga0207695_10216989 Ga0207695_102169892 144
166 3300025916 Ga0207663_10033961 Ga0207663_100339612 144
167 3300025916 Ga0207663_10050267 Ga0207663_100502672 144
168 3300025917 Ga0207660_10062694 Ga0207660_100626942 144
169 3300025921 Ga0207652_10003850 Ga0207652_100038507 144
170 3300025923 Ga0207681_10472247 Ga0207681_104722472 144
171 3300025926 Ga0207659_10000013 Ga0207659_10000013106 144
172 3300025927 Ga0207687_10000756 Ga0207687_1000075623 144
173 3300025928 Ga0207700_10000033 Ga0207700_1000003346 144
174 3300025929 Ga0207664_10186435 Ga0207664_101864352 144
175 3300025929 Ga0207664_10424999 Ga0207664_104249993 144
176 3300025931 Ga0207644_10232964 Ga0207644_102329642 144
177 3300025932 Ga0207690_10158076 Ga0207690_101580763 144
178 3300025932 Ga0207690_10194275 Ga0207690_101942752 144
179 3300025933 Ga0207706_10000001 Ga0207706_10000001393 144
180 3300025934 Ga0207686_10000254 Ga0207686_1000025429 144
181 3300025934 Ga0207686_10098091 Ga0207686_100980913 144
182 3300025934 Ga0207686_10469766 Ga0207686_104697662 144
183 3300025936 Ga0207670_10005811 Ga0207670_100058116 144
184 3300025937 Ga0207669_10000001 Ga0207669_1000000111 144
185 3300025938 Ga0207704_11307563 Ga0207704_113075632 144
186 3300025942 Ga0207689_10914227 Ga0207689_109142272 144
187 3300025944 Ga0207661_10000198 Ga0207661_1000019833 144
188 3300025944 Ga0207661_10010942 Ga0207661_100109425 144
189 3300025944 Ga0207661_10029396 Ga0207661_100293965 144
190 3300025944 Ga0207661_10725562 Ga0207661_107255622 144
191 3300025949 Ga0207667_10210066 Ga0207667_102100662 144
192 3300025949 Ga0207667_10435992 Ga0207667_104359922 144
193 3300025960 Ga0207651_10079536 Ga0207651_100795361 144
194 3300025961 Ga0207712_10000118 Ga0207712_1000011832 144
195 3300025961 Ga0207712_10007734 Ga0207712_100077345 144
196 3300025961 Ga0207712_10688708 Ga0207712_106887082 144
197 3300025972 Ga0207668_10005384 Ga0207668_100053844 144
198 3300025986 Ga0207658_10003877 Ga0207658_1000387713 144
199 3300026023 Ga0207677_10000397 Ga0207677_1000039736 144
200 3300026035 Ga0207703_10000061 Ga0207703_1000006183 144
201 3300026035 Ga0207703_10566425 Ga0207703_105664252 144
202 3300026041 Ga0207639_10012718 Ga0207639_100127183 144
203 3300026078 Ga0207702_10009958 Ga0207702_100099586 144
204 3300026078 Ga0207702_11194280 Ga0207702_111942802 144
205 3300026088 Ga0207641_10000016 Ga0207641_10000016141 144
206 3300026088 Ga0207641_10489148 Ga0207641_104891482 144
207 3300026118 Ga0207675_100146769 Ga0207675_1001467693 144
208 3300026118 Ga0207675_101199463 Ga0207675_1011994632 144
209 3300026121 Ga0207683_10081237 Ga0207683_100812372 144
210 3300026142 Ga0207698_10045811 Ga0207698_100458112 144
211 3300028379 Ga0268266_10000056 Ga0268266_10000056122 144
212 3300028379 Ga0268266_10000601 Ga0268266_1000060117 144
213 3300028379 Ga0268266_10601911 Ga0268266_106019112 144
214 3300028380 Ga0268265_10004453 Ga0268265_100044536 144
215 3300028380 Ga0268265_11063205 Ga0268265_110632051 144
216 3300028381 Ga0268264_10093781 Ga0268264_100937811 144
217 3300028381 Ga0268264_10127452 Ga0268264_101274522 144
218 3300028381 Ga0268264_10769294 Ga0268264_107692942 144
219 3300028381 Ga0268264_10808981 Ga0268264_108089811 144
220 3300028577 Ga0265318_10154364 Ga0265318_101543641 144
221 3300028800 Ga0265338_10000244 Ga0265338_1000024473 144
222 3300031241 Ga0265325_10137675 Ga0265325_101376751 144
223 3300031250 Ga0265331_10011583 Ga0265331_100115833 144
224 3300031251 Ga0265327_10343147 Ga0265327_103431471 144
225 3300036401 Ga0373937_0005521 Ga0373937_0005521_6549_6995 144
226 3300041459 Ga0451800_1419717 Ga0451800_1419717_103_537 144
227 3300041486 Ga0451807_0397996 Ga0451807_0397996_1378_1812 144
228 3300041486 Ga0451807_1530714 Ga0451807_1530714_2058_2492 144
229 3300041491 Ga0451833_0323757 Ga0451833_0323757_1085_1519 144
230 3300041501 Ga0451845_0846721 Ga0451845_0846721_368_802 144
231 3300041509 Ga0451843_1144523 Ga0451843_1144523_376_822 144
232 3300041512 Ga0451853_2220791 Ga0451853_2220791_44_478 144
233 3300044694 Ga0466963_0000004 Ga0466963_0000004_94384_94830 144
234 3300044694 Ga0466963_1247852 Ga0466963_1247852_21_455 144
235 3300044842 Ga0466957_0051828 Ga0466957_0051828_308_742 144
236 3300046454 Ga0495592_0192034 Ga0495592_0192034_425_871 144
237 3300046454 Ga0495592_0254875 Ga0495592_0254875_672_1118 144
238 3300046455 Ga0495603_0000107 Ga0495603_0000107_7489_7923 144
239 3300046459 Ga0495629_0000260 Ga0495629_0000260_44794_45228 144
240 3300046459 Ga0495629_0000487 Ga0495629_0000487_21127_21561 144
241 3300046459 Ga0495629_0061332 Ga0495629_0061332_854_1288 144
242 3300046459 Ga0495629_0238199 Ga0495629_0238199_217_663 144
243 3300046462 Ga0495651_0016929 Ga0495651_0016929_272_718 144
244 3300046463 Ga0495653_0048901 Ga0495653_0048901_2304_2750 144
245 3300046463 Ga0495653_0069771 Ga0495653_0069771_164_598 144
246 3300046476 Ga0495662_0000001 Ga0495662_0000001_40597_41043 144
247 3300046476 Ga0495662_0110749 Ga0495662_0110749_231_665 144
248 3300046499 Ga0495594_0000089 Ga0495594_0000089_15312_15749 144
249 3300046507 Ga0495606_0000040 Ga0495606_0000040_106046_106480 144
250 3300046511 Ga0495608_0001804 Ga0495608_0001804_7406_7852 144
251 3300046516 Ga0495628_0077458 Ga0495628_0077458_1610_2056 144
252 3300046517 Ga0495630_0121932 Ga0495630_0121932_945_1379 144
253 3300046529 Ga0495652_0076609 Ga0495652_0076609_271_705 144
254 3300046533 Ga0495640_0105129 Ga0495640_0105129_176_622 144
255 3300046535 Ga0495586_0000083 Ga0495586_0000083_7451_7897 144
256 3300046535 Ga0495586_0110161 Ga0495586_0110161_717_1163 144
257 3300046536 Ga0495587_0023739 Ga0495587_0023739_631_1065 144
258 3300046536 Ga0495587_0035754 Ga0495587_0035754_1357_1803 144
259 3300046542 Ga0495597_0212297 Ga0495597_0212297_18_467 144
260 3300046557 Ga0495622_0000218 Ga0495622_0000218_30778_31215 144
261 3300046559 Ga0495667_0000020 Ga0495667_0000020_47556_47990 144
262 3300046642 Ga0495634_0507462 Ga0495634_0507462_198_644 144
263 3300046663 Ga0495635_0000031 Ga0495635_0000031_98041_98487 144
264 3300046674 Ga0495588_0000338 Ga0495588_0000338_29211_29657 144
265 3300046675 Ga0495657_0000001 Ga0495657_0000001_274706_275140 144
266 3300046675 Ga0495657_0028860 Ga0495657_0028860_1057_1503 144
267 3300046678 Ga0495599_0029798 Ga0495599_0029798_214_660 144
268 3300046678 Ga0495599_0095270 Ga0495599_0095270_135_569 144
269 3300046681 Ga0495647_0000001 Ga0495647_0000001_42593_43039 144
270 3300046681 Ga0495647_0005224 Ga0495647_0005224_2097_2543 144
271 3300046683 Ga0495658_0003808 Ga0495658_0003808_5540_5986 144
272 3300046689 Ga0495613_0000005 Ga0495613_0000005_127762_128208 144
273 3300046690 Ga0495624_0000019 Ga0495624_0000019_32501_32947 144
274 3300046690 Ga0495624_0007669 Ga0495624_0007669_916_1362 144
275 3300046691 Ga0495670_0090682 Ga0495670_0090682_281_715 144
276 3300046809 Ga0495600_0005957 Ga0495600_0005957_4633_5079 144
277 3300046809 Ga0495600_0039936 Ga0495600_0039936_708_1154 144
278 3300046810 Ga0495660_0225769 Ga0495660_0225769_27_461 144
279 3300047317 Ga0495604_0000067 Ga0495604_0000067_82080_82514 144
280 3300047317 Ga0495604_0022899 Ga0495604_0022899_3172_3627 144
281 3300047319 Ga0495674_0002248 Ga0495674_0002248_7178_7612 144
282 3300047321 Ga0495676_0001364 Ga0495676_0001364_7175_7609 144
283 3300047321 Ga0495676_0054841 Ga0495676_0054841_676_1110 144
284 3300047322 Ga0495680_0000143 Ga0495680_0000143_25137_25583 144
285 3300047322 Ga0495680_0002541 Ga0495680_0002541_848_1282 144
286 3300047444 Ga0495675_0000300 Ga0495675_0000300_7614_8048 144
287 3300047446 Ga0495679_010122 Ga0495679_010122_1004_1450 144
288 3300047447 Ga0495685_042389 Ga0495685_042389_641_1087 144
289 3300047471 Ga0495684_0588954 Ga0495684_0588954_259_705 144
290 3300047472 Ga0495686_0030941 Ga0495686_0030941_2275_2709 144
291 3300047673 Ga0495593_0118052 Ga0495593_0118052_258_704 144
292 3300047673 Ga0495593_0122626 Ga0495593_0122626_743_1177 144
293 3300047673 Ga0495593_0326107 Ga0495593_0326107_248_682 144
294 3300048088 Ga0495602_0000007 Ga0495602_0000007_128646_129101 144
295 3300048088 Ga0495602_0000611 Ga0495602_0000611_7472_7918 144
296 3300048088 Ga0495602_0959503 Ga0495602_0959503_63_497 144
297 3300048903 Ga0496100_0000001 Ga0496100_0000001_358078_358512 144
298 3300048903 Ga0496100_0000059 Ga0496100_0000059_13385_13831 144
299 3300048904 Ga0496101_0000004 Ga0496101_0000004_159430_159864 144
300 3300048904 Ga0496101_0000135 Ga0496101_0000135_51688_52134 144
301 3300048905 Ga0496102_0000294 Ga0496102_0000294_864_1298 144
302 3300048906 Ga0496103_0000159 Ga0496103_0000159_62891_63325 144
303 3300048906 Ga0496103_0381021 Ga0496103_0381021_287_721 144
304 3300048907 Ga0496104_0000015 Ga0496104_0000015_202713_203147 144
305 3300048908 Ga0496105_0000004 Ga0496105_0000004_272652_273086 144
306 3300048908 Ga0496105_0012055 Ga0496105_0012055_2625_3071 144
307 3300048909 Ga0496106_0000030 Ga0496106_0000030_7772_8218 144
308 3300048909 Ga0496106_0000056 Ga0496106_0000056_80403_80837 144
309 3300048909 Ga0496106_0000252 Ga0496106_0000252_8723_9169 144
310 3300048910 Ga0496107_0000005 Ga0496107_0000005_171736_172170 144
311 3300048910 Ga0496107_0000054 Ga0496107_0000054_51688_52134 144
312 3300048910 Ga0496107_0034493 Ga0496107_0034493_804_1250 144
313 3300048911 Ga0496108_0283719 Ga0496108_0283719_186_620 144
314 3300048912 Ga0496109_0000012 Ga0496109_0000012_43084_43530 144
315 3300048912 Ga0496109_0000173 Ga0496109_0000173_2163_2597 144
316 3300048913 Ga0496110_0003674 Ga0496110_0003674_4036_4470 144
317 3300048914 Ga0496111_0000035 Ga0496111_0000035_17716_18150 144
318 3300048915 Ga0496112_0002208 Ga0496112_0002208_3560_3994 144
319 3300048916 Ga0496113_0000026 Ga0496113_0000026_35519_35953 144
320 3300048917 Ga0496114_0000039 Ga0496114_0000039_10047_10481 144
321 3300048917 Ga0496114_0006763 Ga0496114_0006763_5993_6439 144
322 3300048917 Ga0496114_0032937 Ga0496114_0032937_205_639 144
323 3300048918 Ga0496115_0000011 Ga0496115_0000011_124325_124759 144
324 3300048918 Ga0496115_0003457 Ga0496115_0003457_896_1330 144
325 3300048922 Ga0496119_0024169 Ga0496119_0024169_267_701 144
326 3300048923 Ga0496120_0131230 Ga0496120_0131230_233_667 144
327 3300049578 Ga0501042_0023002 Ga0501042_0023002_3246_3680 144
328 3300049591 Ga0501075_0472412 Ga0501075_0472412_408_842 144
329 3300049743 Ga0501081_0386092 Ga0501081_0386092_589_1023 144
330 3300050515 nmdc:mga0a205_53_c2 nmdc:mga0a205_53_c2_29210_29656 144
331 3300053077 Ga0495601_0001218 Ga0495601_0001218_6991_7446 144
332 3300053077 Ga0495601_0004657 Ga0495601_0004657_3679_4113 144
333 3300053077 Ga0495601_0022253 Ga0495601_0022253_703_1149 144
334 3300053083 Ga0495655_0000002 Ga0495655_0000002_134800_135234 144
335 3300053083 Ga0495655_0007306 Ga0495655_0007306_50_484 144
336 3300053084 Ga0495595_0000002 Ga0495595_0000002_170502_170936 144
337 3300053084 Ga0495595_0000045 Ga0495595_0000045_42235_42681 144
338 3300053084 Ga0495595_0011420 Ga0495595_0011420_2544_2999 144
339 3300053085 Ga0495619_0000268 Ga0495619_0000268_25656_26090 144
340 3300053085 Ga0495619_0002874 Ga0495619_0002874_1667_2113 144
341 3300053085 Ga0495619_1208788 Ga0495619_1208788_40_486 144
342 3300053094 Ga0500566_0000683 Ga0500566_0000683_17632_18066 144
343 3300053096 Ga0500641_0000831 Ga0500641_0000831_9791_10225 144
344 3300053129 Ga0500628_000001 Ga0500628_000001_223469_223903 144

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j11-assembly1.cif.gz_A the crystal structure of a secreted protein esxb (wild-type, in p21 space group) from bacillus anthracis str. sterne 0.7083 9 86
4j7k-assembly1.cif.gz_A the crystal structure of a secreted protein esxb (mutant e54q) from bacillus anthracis str. sterne 0.7059 9 86
4j41-assembly2.cif.gz_C the crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne 0.7039 9 86
4j10-assembly1.cif.gz_A the crystal structure of a secreted protein esxb (semet-labeled) from bacillus anthracis str. sterne 0.6997 9 86
4j41-assembly1.cif.gz_A the crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne 0.6987 9 86
ID Description Score Start End Superfamily
4mrpA01 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.7443 10 86 1.20.1560.10
4j41E00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HP0062-like domain 0.7184 9 86 1.10.287.850
4j11A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HP0062-like domain 0.7083 9 86 1.10.287.850
4j7kA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HP0062-like domain 0.7059 9 86 1.10.287.850
4j41C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HP0062-like domain 0.7039 9 86 1.10.287.850
ID Description Score Start End GO Terms
AF-A0A537YLU3-F1-model_v4 Uncharacterized protein 0.8375 3 144 GO:0016020
AF-A0A537YLU3-F1-model_v4 Uncharacterized protein 0.8321 3 144 GO:0016020
AF-A0A538EPV6-F1-model_v4 Uncharacterized protein 0.7326 2 144 GO:0016020
AF-A0A399XQI7-F1-model_v4 Uncharacterized protein 0.7312 6 130 GO:0016020
AF-A0A6J4KQK9-F1-model_v4 Uncharacterized protein 0.727 7 138 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.39 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map